1SF3A

Structure of the reduced form of the p94a mutant of amicyanin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
105
structure length
105
Chain Sequence
b'DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTAHPFMRGKVVVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amicyanin
publication title Structural Studies of Two Mutants of Amicyanin from Paracoccus denitrificans That Stabilize the Reduced State of the Copper.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
total genus 27
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2004-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1sf3A00
4GP4B 1XB6A 5TK4A 4YSQA 5I5JA 3X1FA 3FPXA 1SNRA 1JOIA 1URIA 2PPFA 3UABA 3CDZA 1L9SA 4F2EA 1JZJA 1M9WA 2PCYA 2PP8A 1PZBA 4G7QB 2FQGA 1ZDQA 4N8UA 2PLTA 1WA0X 4L0PB 3TBCA 1ASPA 2XLLA 2HX7A 1OE1A 2GHZA 1M56B 1XMEB 2R7EB 3HEIB 3FU7B 2BO0A 4GXFA 4ZK8A 1PF3A 1OOWA 5B1BB 2IH8A 3N2JA 4AZUA 1FWXA 3OMIB 1JZEA 1MG3C 1PNDA 1V55B 1TKWA 3BQVA 4DP9X 2TSBA 2FT6A 1WS7A 4F2FA 1GS7A 1MZZA 4JKNA 4HHGA 4QLWA 4YSSA 3T9WA 2MTAA 2AZAA 2Q9OA 1BXUA 3T6XA 4YSDA 2MRYA 2IDQA 1ET8A 3X1EA 3PPSA 4HIPA 3UAEA 5B3SB 1V54B 1AANA 4KNSA 2CBPA 3FQYA 2DYRB 4BWWA 3NP3A 3QJQB 1IBZA 1L9PA 2XWZA 1ZIBA 3NJIA 3WIAA 5IY5B 3WNIA 1DYZA 4NAJA 2XX1A 1PY0A 2JXMA 2A3TA 1AS8A 6PCYA 3BVDB 1E67A 2AFNA 5B7FA 1PLCA 1SHXA 2HRHA 2UXTA 5FC9A 1AQ8A 2X88A 4G71B 1JZFA 4A67A 1JERA 4GP8B 4AKPA 3TASA 1M57B 2EIJB 4DP0X 2PP7A 3WG7B 2PCFA 5I5IA 4CSZA 3KW8A 1F56A 1NIBA 3ZDWA 3SQRA 1GY2A 3OMNB 3QJRB 4HCFA 2UXGA 2PP9A 1RZPA 2AZUA 2DY2A 4HHWA 4W9ZA 4ENZA 2WO3B 4DP6X 3X1NA 1NINA 1OE3A 2PPEA 3AW5A 5I6OA 4PAZA 1NWOA 1KBVA 3OMAB 5B1AB 2BP0B 5D4JA 4UAHA 2BP8A 5I6KA 3CG8A 1GS8A 2TSAA 4E9TA 2YAQA 1AAJA 4YSOA 1JZGA 4BDVB 3PXLA 2XVBA 1UATA 1W6WA 2XXFA 3V9EA 1QNIA 4KO5A 1SDDB 4GP5B 1BXAA 1W6LA 4KNTA 2GBAA 1KBWA 3X1GA 2RACA 2Y1AA 3ASOB 1OE2A 2GIMA 5B7MA 2EINB 1BYPA 2B3IA 2ZONA 3QPKA 7PAZA 2XYBA 3SBRA 4G70B 4E9SA 5AZUA 3NSCA 2EILB 2YAMA 3GDCA 1NIFA 1E65A 4HZ1A 3WNJA 1ASOA 2AVFA 1GS6X 2YXWA 3C75A 1ID2A 4HALA 1N70A 1E30A 2I7SA 4P5RA 3X2QB 3CDZB 1MZYA 3FS9A 2Q5BA 1V10A 5D4HA 4BXVA 1A3ZA 5PCYA 1OCRB 4A2DA 3IBOA 3AY2A 3SBQA 1AR1B 1ASQA 1ZPUA 3NJNA 3FYIB 1AZUA 3IE9A 2J57A 2J55A 3N55A 1SF3A 2H5UA 4NERA 3QJSB 3CVCA 2ZOOA 3ZIYA 3FT0A 4KO7A 2YAOA 1CURA 4QKTA 3V9CA 1IUZA 4Q89A 1R1CA 1J5DA 2CUAA 4BXSV 1PLBA 4AKQA 4YSAA 1GY1A 2H47C 3OD3A 4FA7B 5I6NA 1QHQA 2FT8A 3PAVA 1OCZB 5B1JC 1WS8A 2YXVA 4A66A 1KCBA 1KV7A 2VMJA 2I85A 1B3IA 2JFCA 2VW7A 2P80D 4BWUA 2IDSA 2UX6A 3FSAA 1OF0A 2QPDB 1GSKA 1ZV2A 2BW5A 2UX7A 4RH4A 3JTBA 1WA1X 4YSCA 1L9TA 4Q8BA 4BWTA 5I5MA 4AX3A 2XU9A 1XB8A 4G7SB 3AG1B 1N68A 3AG4B 3NJFA 3AZUA 4G72B 5I6PA 4F7KA 1ZIAA 5B7EA 1VLXA 3ABMB 1KGYE 2GSMB 2FWLB 2W88A 1PMYA 3WKPA 2OV0A 1NICA 4KOCA 1E5ZA 3NSYA 3T71A 3FPYA 1RZQA 1AOZA 4X4KA 3NP4A 4YSRA 2I7OA 1GR7A 1FA4A 4A2HA 3G5WA 7PCYA 2BWIA 3ABKB 3X1BA 2IH9A 1NPJA 5E9NA 1PZAA 4E9RA 3S8FB 2X87A 1CYWA 2AANA 2CAKA 2B08A 4YSPA 2HX8A 2FQDA 1JXGA 2BZCA 2PPAA 1NIDA 4DP7X 3EHBB 1YLBB 4K9JA 4CSPA 1AIZA 2BP8B 2IDTA 2BHFA 1WA2X 3S3DB 2QDVA 3UADA 3FSWA 1CUOA 4AI7A 1BAWA 3ERXA 1HAWA 3IN2A 5AKRA 2UXVA 3IEAA 4DP1X 1DZ0A 3H56A 3WI9A 1OV8A 1AG0A 5A7EA 1TEGA 2Y69B 1CC3A 2W8CA 4TXVB 3QJVB 1NIEA 1L9QA 3FU8A 1X9UA 3PLYA 1MDAA 1X9RA 2YAEA 2GI0A 3KW7A 4NB7A 2QDWA 1CYXA 2IWFA 1TU2A 3FQ2A 1AZCA 2P80A 1BQ5A 3OQRA 3FSVA 1ILUA 4WKXA 3S8GB 2XX0A 2EIMB 2XUWA 4KOBA 2YARA 1T5KA 3FSZA 4YSTA 2VM3A 3QJUB 3ABGA 1PLAA 3UGEA 4DP5X 1J9QA 3CZUB 2FQEA 1PNCA 4KO9A 4M4RB 3SBPA 4BDVA 5I28A 1KCWA 1AS6A 2ZWNA 2VN3A 1J9SA 1ET5A 2BWDA 1IBYA 3QJTB 3DKHA 3GYRA 4M3HA 1QLEB 2IWEA 4YVNA 2FTAA 1BQKA 4N4YB 1BQRA 1MG2C 3NYKA 1A4CA 2DYSB 3EH5B 3NJLA 3T6WA 1NTDA 1PZCA 1JZHA 2OCCB 3PAZA 3H4FA 1JVLA 5I6MA 3FYEB 3MX0B 4DPBX 2IDUA 2XV2A 1AG6A 3EH3B 4E9YA 2E86A 4A68A 3JT2A 2J5WA 3UAAA 2EIKB 1WAEA 3T6ZA 3TA4D 2HRGA 1L9OA 5PAZA 9PCYA 3NJJA 4GYBA 3AG2B 1E5YA 5ANHA 2HLEB 2JKWA 1AZBA 4YSEA 3EH4B 1IC0A 1KDIA 4DPCX 1W8EA 1RKRA 1HFUA 3CVBA 2WO2B 1XB3A 3WKQA 2R7EA 4MFHA 2H3XC 3NSFA 3FU7A 4HCGA 3TU6A 6PAZA 5B1JA 4E9XA 1J5CA 1ADWA 1L9RA 2LLNA 5F7BA 5F7AA 2VSKB 2DWSA 4GY4A 3ASNB 3TBBA 1SFDA 2HZHA 1SFHA 1A8ZA 2FQFA 1NWPA 1J9TA 2VSMB 3PAUA 1KYAA 1ET7A 2YAFA 4E9QA 1NDTA 2VW4A 4E9WA 2BZ7A 2FT7A 2YAHA 1I53A 4PCYA 1TEFA 3DIVA 3ZBMA 2GC4C 3ABLB 8PAZA 3H4HA 2IAAC 3QQXA 2PPDA 3DTUB 1ILSA 3NJMA 4YL4A 1AACA 4FAAB 4YSUA 2VW6A 5EHFA 2QPEB 2QT6A 4DP8X 3D12B 1BEXA 1IKOP 2FNWA 4DPAX 1GW0A 4HAKA 4JHUA 1NZRA 2FJSA 1JVOA 2DWTA 2N0MA 3GXUB 2IWKA 2GB2A 1BYOA 2CCWA 3S3BB 4P5SA 2VM4A 1SJMA 2CALA 2XXGA 3U25A 2HX9A 2BW4A 1OCCB 4WTQA 2PPCA 5D4IA 3ZX1A 1RCYA 2DV6A 4E9VA 3EF4A 4YVUA 4HCIA 1AZNA 1A65A 1NPNA 2NRDA 1A4AA 3PCYA 4A2GA 1OCOB 2YAPA 3NSDA 3NT0A 4UF7C 5I26A 5AFAA 1BXVA 1HAUA 2CJ3A 2OJ1A 2UXFA 1A4BA 2YQBA 4G7RB 3AG3B 3NJHA 1AS7A 2IDFA 3IN0A 3FQ1A 3OM3B 4DP2X 3FU9A 2BP0A 3S3CB 1J9RA 1KDJA 3L45A 4KNUA 4A2FA 1SF5A 4A2EA 4DP4X 5B1KA 2HXAA 2XV3A 4BK5C 1PAZA 4UANA 2WSDA 3RYMA 3T6VA 3CVDA 4JHVA 1EHKB 1EZLA 2J56A 3NJGA 2XV0A 1ETJA 1NIAA 1SDDA 1ZDSA 5LDUA 1JZIA 3NJKA 1JXDA 1AZRA 4W1TA 4KO6A 4EF3A 3HB3B 5I6LA 2GC7C 3MBWB 1GYCA 1PCSA 3UACA 5TK2A 2ZXWB 4AKOA 1SHWA 1FFTB 1JXFA
chains in the Genus database with same CATH superfamily
4KXZH 2AABH 1SJEA 3GTTA 4OLVH 3W2DH 1XTMA 4U49A 4FQCL 4KTEL 1QHPA 4WI9A 2GG1A 5B38G 3AGVA 2ZUUA 2NY3B 2JIXB 3MUJA 3RZCC 3M8OH 1C12A 1IFGA 4Y19B 5DS2A 5BRZA 3RVVC 3SCMB 1KSRA 2Z35B 4AQAA 4DWHA 2VC2B 1HHJB 2A77H 3AWFA 2FATL 4BA8A 4N2GA 4ESKA 3WL9A 3BRDA 3RGVD 1LO4H 2XLLA 4G43A 4TLSA 1IL1A 2HX7A 2WQUA 4HIEA 1AR2A 4M61B 1I1YA 3ZGHA 4CUCA 2TAAA 2LE9A 1F45A 4GXFA 2EIBA 3RI5K 1UXWA 1MN4A 3B2DC 4MA8H 1DSFH 4LHUG 5TQ0H 2QVFB 5A2AA 1IARB 2IH8A 3VE0A 5DI8A 4BV1A 2YPLE 3QUKB 4P2OA 1V55B 1ZT7B 5T3XD 1KGCD 4NIKB 1UACL 2VTFA 1QX1A 3DBXB 4KRPB 3S8WA 5EMYA 5IB5A 3NABL 2BX5A 5JHMA 5MEPA 2ITCA 5F1NB 4DPRA 3PWJA 3QUMH 1ET8A 1BJMA 3J7HA 5T1LD 3GSNL 4ZX3A 1T4WA 4UM9B 2R1WB 5TQ2L 4GS7B 1XH1A 3QJQB 2F9BT 4PRDA 5EU4B 3S4SG 5ADPL 1CDYA 3QC5X 4X80H 1D9KD 1B88A 1S7TA 2UZPA 4H8QA 4PRPA 5DFWH 5HDLA 1QFWL 5AAWA 5FWQA 1NCTA 3CQFA 4FQ2L 1SXSA 4WTXA 2XVKA 4WGWB 4X0KB 1KXTB 3GJFA 1E67A 3PQYD 1SUHA 3C2SA 4PBDA 4ZAKD 2AFNA 3FULA 2F54D 1JV5A 2NR6C 4HV8B 2X88A 3HPLA 1A4JB 3MYJA 1FYTB 5GRUL 4GP8B 3PWPE 1M57B 5DUMH 5AW9B 2R69H 3GXFA 1KTLA 2B8OT 2WWOA 2WZ5A 4X7DC 5B8CB 3AS1A 3QIBC 4F2MB 4ZODA 2AITA 1B6UA 1SQ2N 1W0YT 4JE0A 3RZCD 2WM0A 3RVVD 2EADA 4BKSC 3SQRA 2V2XB 3OMNB 1EEYA 1R3LB 2XTJB 4KK5D 5DD3H 4K2UL 4XMPL 5CP3A 4M48H 5IHWA 2KC0A 2GFBB 1O7SA 4CAGA 1IM3D 4H2CA 4PY7B 2AJSL 5LGYA 4DN4L 4ETYA 1ZS8B 1F6FB 1UCTA 5CZKA 4UQ2A 4W9ZA 3KYAA 3D18A 1D5BB 1CFQA 5GIRA 4ZFGH 4XPAH 5D1ZD 1TSRA 1OE3A 3HAEA 4ZOAA 4UT6A 3LMJH 2Y22A 3KVPA 4FA8A 3MFFA 3H2QA 5GGTH 4PJGE 4X42A 3V2AR 4BEIA 2PR4L 3ROOA 4WV1C 3CG8A 3VQLA 1IGML 4JFXA 4X5XA 4YE4H 1HINL 3GHEL 3DX3A 4R4NC 1IC5L 2KI6A 5EUKA 5HHVL 3IFPA 2LVCA 1SDDB 4JL1A 1P7KB 2X5PA 3QR2A 4Y1AA 3K6NA 1K85A 3KPPA 4L1DA 4O51B 4NO0D 1OTTC 1HX0A 3ASOB 5AW2B 1HL9A 1UQSB 4LU5H 1KJ3L 4GO8A 5CU5A 2QSTA 4IHBA 3KHOA 1KGXA 4EDWL 2AQSA 5C08D 1A1OB 3LRSB 1JPTL 1ND0B 1I85C 4U6VL 3N6YA 5IEHB 5KAQF 2XG5A 5INCA 5F21B 2OTWA 4JJHA 4JRYA 1FNSH 1T3FA 3BIBX 2NR6D 3CZSA 4Z3IA 3STLA 1YAZA 5HYJB 3W9DA 2Q7YA 1CIUA 1Z9OA 4A7UA 2EC8A 3FFOA 2J25A 3UG3A 2ENSA 3GSRB 1MCLA 4RA3A 4YX2L 3CZGA 1X6LA 2Q5BA 4V33A 1G9NL 3I9AA 4L8CB 2ICEB 5TGBB 1DN0B 4EBQH 5KYWB 3BUPA 1B0GA 3BGMA 3QULB 1U8LB 12E8L 1AXTL 1CGXA 1PZ3A 2IBZY 3SBQA 5ICZA 5FOBA 2F58L 4M6OH 1AZUA 4TRPL 1FNLA 4HPYH 4WJ5A 3MRIA 5GRXG 2V9RA 1EAPA 3Q6GL 3IT8D 4N86A 4P5TA 4GUPB 3BW9B 2VB5A 4A6YB 1IQWH 1VCBC 4HF5H 2BSRB 2YBRA 1Z32X 2J12B 1KPRB 3QDMB 1EZVX 2F5AH 1ZA3A 1MW2A 2IPUK 2KUTA 4BUHA 4Q89A 4EVNB 4P2QD 2PO6A 3MJ8B 1E9QB 3Q48A 1UD2A 4K8RC 4N8CH 2IG2L 5I6NA 4XVJH 3PAVA 5EZLA 3US1A 2EUWA 4A37A 3QJHB 3VG0L 4AOFA 3LIZH 3ECBA 3H7LA 4G42A 4GRLC 1KN4H 4R4ND 4YXLH 3VX0A 4DGUA 3ZL4L 5I1EL 3CC5A 1G1KA 1WH0A 2H0JA 3K2IA 2PN5A 3B9KA 3G6JA 5EEWA 1XAKA 1MJJA 2DQUH 1JRHH 3QCTL 3QAZB 5DJDA 1OTTD 1KFAH 4RWYH 3ARGB 2BVYA 4MAYA 4FP8H 1CXLA 1XT5A 4HMCA 3JWNG 1X5HA 1U91A 2F18A 4OTXL 4ZS7L 4TVUA 1EZSA 3CFTA 4LL4A 3KBEA 3WEMA 4IBYA 3NJFA 3P4OA 3TBYB 1JV2B 3GRGA 4K55A 1DQLL 1E3ZA 5FA3A 2OA9A 4NKIL 5FKAB 2IPTL 3CPLA 3T2PA 2FGZA 4L3FA 4LVOC 5A2IH 5SV3A 3HHRB 1ZVYA 1YEJL 1LE5B 4ZMQA 4F7CA 2DB8A 4NPYA 3QH3B 1BSIA 1RPKA 3V8OA 3BUYA 4H0GA 4OLUL 4P49A 4KY1H 3F8UB 3ZE1E 4QTHB 4WO4C 3KPOB 4MLIA 4U1IB 3QQDB 3UTSA 4OQ1A 1G0YR 5AVZB 1FZOA 1YZZA 5BOZG 4PW3A 1JZ2A 1MY5A 3FQRA 4HXAH 1WICA 3R4DA 1HHIB 1JXGA 4OCWL 4WI7A 2ADJB 5EO0A 1A25A 2CRYA 5LCVA 1MVYA 1FSKC 4JMXA 2OYKA 4OJDH 2WIMA 3WEXA 4ZFOB 2C1OA 5T5NG 1RJYA 3CSYA 1WBYB 2ADGA 1O7DC 5IVXA 2Q1EA 1R34A 2JKXA 2MMXA 2VLKD 4MKTA 1U6AH 2FO1A 4DP1X 4GRLD 4XMZA 3DARA 2HVBA 4PYHA 3PXHA 4U1HA 1X9UA 4YN3A 3F85A 4EN3A 2EICA 4JQXA 4M6ML 4GUOA 4PRNB 3SJVD 5C8JB 2BNUA 2OMTB 3B3IB 4PJEE 3FSVA 1K5NA 2XX0A 2XUWA 3MLVL 1F00I 3S2CA 2ZUSA 2A6JA 3FRUB 2GSGB 3Q3GA 3UGEA 3IDGB 4F8NA 3MV01 5I8CA 1T2JA 4RRPA 1JYVA 1A66A 3U4BH 1BW8A 3WHXA 5GJTH 3ARVA 3DSNA 5CFAA 1FH5L 2L7UA 3VTMA 3AROA 3ML8A 2VMEA 2BSSB 5I1CH 3NJLA 1NTDA 1OGTA 2W60B 1ACXA 3PAZA 3FQXB 4NQVB 4WO4D 3VWJC 1JIBA 4G1EA 4KKNA 5I0VA 3DX0A 2OJZH 4AM0B 5I19L 3KPLB 3BPOC 2XV2A 3ZHLA 3AXHA 5FA4A 3A6BL 4I48B 4N8VA 4NSKA 2H26A 3MLZH 5CUSH 3EXLA 3MRPA 2UY6A 3DUSA 1UKSA 3WD5L 2CGYA 1R3HB 1AY1H 3N04A 4MHHG 3VB9A 3WSQL 2EDKA 1KWKA 3D5OF 1FORH 2EXSA 3L2MA 3OSVA 1I9JH 2VWEE 3IRCA 1ADQA 2H3KA 3UBGA 1XCQB 1N8ZA 1IC0A 1QNZL 3ARDB 1TJGL 5GXBB 1JS4A 1HDMA 2G5RA 2FWOB 4L3EA 4OZGF 1FL5B 2P8LB 3FC8A 4I2XE 2AJVH 2WIIA 3IF1B 4PI0A 1FI8C 4QRSA 1TQUA 4S0SD 4X6FA 1RFDH 3SKUD 4P57A 3F7YA 3H6JA 5F96L 1ZCRA 3PREA 1QFWI 2R1XB 3LX9A 3Q6FA 3BAYA 4PWHA 2BHZA 3PAUA 4OZFB 1INEH 2XN2A 1T21A 2DIEA 3CN1A 2P7TB 3IJHB 5BCAA 5D1QE 1O0VA 3EW3B 1FV1A 4GIOA 4AJVA 4JNXA 2FSEB 3H9HB 2ITDB 3D2TA 3QJFA 4FKHA 2ZIDA 3WXWL 3AABA 4OKVA 5C0BA 4ZTPL 3KCPA 4DKAA 1KB5B 8PAZA 3NN8B 1U92B 4HSCX 1Z9PA 3CZLA 3D9AH 3DTUB 4G8GA 1YO4A 3ARFC 4WFGE 2E7LC 2UUDH 1N64H 5IK3B 5D71L 3VWJD 4F33A 2B3RA 2R0WL 4PJAE 5JZ7D 4JPWL 3I6GA 3S88H 1Z0NA 4YPJA 4YLQT 2WD0A 3L9RA 2AXFA 3N41B 2WY3B 3H3PL 4LQFL 2Z6FA 4ZO7A 4ZNCD 5IB3B 3TVMB 2ADIB 4AIZA 5A6IA 1NGXA 4NBZB 4OIFA 5T1DH 1BYOA 2QQNL 6CGTA 1DQQA 4OM0H 1VJSA 4U1LB 4WFFD 1W2KT 1SJMA 4A04A 2VNCA 2RTTA 3RZWA 4OLWH 1R3IL 4FNLH 3AU1B 3FONB 4RAUB 2WXFA 5EH1A 5FIEA 5IW1B 5IQ7H 2V33A 3NCJL 4FTDA 3ULUC 1OCCB 3CX5K 4JY4A 4D94A 5D4IA 4D9RE 4E5XB 1BFSA 5IQ9B 2HUHA 2N1KA 2DD8H 3CV5A 4TVPH 3KYKL 3TNMB 2NRDA 5GGRA 1GA2A 1BQSA 1QATA 3RTQA 1OM3H 3O6MH 2F53E 4G7RB 3TBTB 2CIKB 2NMSA 1NM9A 2F1EA 3UJIH 4HKJB 4FQLH 5DHXB 3K46A 5HHMB 5AOLA 1QA9A 4Y4KB 1MELA 5DZNA 3VFRB 2XN9E 4P59H 5EBLA 2YSSB 5B39G 4EE2A 4KNUA 5KSAB 2K6ZA 4DP4X 2WSKA 5CGYC 4BZ2A 1NFKA 2XWJB 4PCSA 3DROB 4CADB 3KCWA 1ECZA 1EHKB 2XFXB 2V8LA 1K8DA 1W0VB 4XNUH 5EU3B 2EC9U 4NKOA 1LJMA 3OKNA 4KO6A 5C0IA 5E56A 3C6SB 2B1HL 1KXQE 2VLLB 3CXHK 5TK2A 1ZVSA 4NIYE 3ZJAA 2CLRA 3ARFD 5C9JB 2DWEB 4F8PA 4YSQA 1XB6A 4M9PA 1Q8MA 4IJTA 1Q9KA 4TLKA 3IDJA 5HSFA 1OD9A 3P77B 4U6HB 4B53A 3C60C 4C56D 1TMCB 2GKIA 4HQQL 4KUZH 1NCDL 3BP4A 4FZ8L 4YNYA 4KDTA 4ZD3L 5HGDA 1YJDL 3PY9A 4ZQKB 4DERA 5DSCB 5DK2A 1OVZA 5EZJB 4F2EA 4U1KB 2B0SH 2PCYA 3VJ6B 2CUMA 3N9GH 5E99H 4ELMA 3VMOA 4PJFB 5D7JB 4JQIL 3MI6A 4GI6A 4XCFL 4L9LA 2ARJQ 3ULUD 2DJMA 1E4XH 1FIEA 2EKJA 3A3YB 3VI4A 3CN2A 3MX0A 3OB8A 4CVUA 1TSHA 2DDQL 4RMWA 2IV8A 5CZXC 4PJIB 4YGAB 5MEQB 5I74C 1NOAA 3QHFH 2MIZA 1UZ6F 1XIWB 4NEHB 3ETSA 3O2VH 5LN8A 1XO8A 2QGEA 3PV6A 2AVGA 3L7EB 2X4UA 3MFGB 4PVNA 2RJMA 3CHRA 4WY7L 1NGYB 2MTAA 5M95B 5DJYB 3FO1B 4YHOH 1M9SA 4NFCA 2AMUA 3RAJL 4OJEH 1J8HE 4PVLA 4BQ8A 4U7MA 4YUEH 1CVSC 1V54B 2AV1B 3A5VA 4KWUA 5CGYD 5C92A 4P5MA 5EBWB 5JLZA 1JGEA 2B7DT 1TNMA 1UFGA 2D7MA 4OF3A 3HI1A 3LJ3A 1FNFA 3VYNA 4DGVL 1DYZA 2VDMB 5FM4A 5EUOE 3NA4A 1U58A 4Q9QH 1WZ1L 1CT8B 1AHKA 3FOMB 2EE0A 1DCEA 1JGUL 5DRWA 5FC9A 4BGDA 3TPUA 1LO3H 4Y5XB 4XOEA 5KVFH 2YD7A 4XRCB 3SE8L 1U2HA 3TASA 4FFYA 4X6DB 4KHXL 1S5HA 5I5IA 1M6OA 4AYFB 1LWHA 3C60D 1MHPH 5DJAA 4DT2A 1NIBA 4ZTOL 1GGBH 5F7DB 1P53A 2LU4A 1JXJA 2GTQA 2VDKH 3L4VA 4M8VA 5A43C 1ZHNA 2B16A 2OMWB 2ZF9A 1G6RA 3M46A 1KCVH 1SOKA 4H4NA 3W3BA 1OHQA 3OAZK 4ZUUB 2NT0A 5D9SA 2I5YH 4MCZA 3MJ7B 5I1AB 5DHDA 3RWEB 4B50A 1JWMA 3KYNA 3CH1A 2CXGA 1CU4L 1N6QH 3K6FA 2QFPA 3O4LE 2BIPA 3CHXA 4HEPG 5BXFA 3UBXA 5CBAB 1LP9B 5CZXD 3UTPD 1YEGL 4PJXB 2FH6A 2DM3A 2NY0C 2W0PA 2OCJA 5TE4H 3IXAA 1BZ7B 1JNLH 1YN7B 1LDPH 4H1LB 4TNGA 4S1QL 4GW5B 2OW6A 4UB0L 2A99A 4AEEA 1UATA 4BQBA 3IJYA 3G5XB 2F7RA 4XBPA 5GS0C 1CCZA 1RIHH 3DVNB 1KCUH 4KAQL 1ETA1 5EPMA 4X9FA 4JVPA 4EAEA 1XGYL 2NXYB 1NAKH 3IETA 4X4YA 1DBKL 1IM9D 5C0CE 4YJZL 1VFUA 3V4LA 2QPUA 5GGVL 1D6VL 1EFXB 4Y2LA 5F0MB 3RWIA 2HLAA 2WANA 5C07B 3HS0A 3OLEA 2JELH 2PETA 3AQDA 3WUWB 1S7UA 2XYBA 3ML9A 4NM8L 1V7NL 4ANKA 4FXKC 5ACLA 2VLRD 3WO4B 2B20A 3MRHB 5K9KB 2AVFA 2CU9A 4JPIA 2TRHA 1CR9L 5ITBL 3RNKA 4MJ2A 3I2CH 3MRKB 3ZKNC 4L18A 2ZX7A 1CICA 1P1ZA 2WGNB 4LVHB 1RQ5A 4XVSL 5E6SB 3IAQA 1RD6A 2NY7L 4XHQA 4JFDB 4UT7H 3QIUB 2VDLB 1NCAL 2J55A 2NY3C 1L9MA 2XRAH 1OL0A 2I07B 3PP4L 3SCMC 3ZDYB 3ZO0A 1F5WA 4UOW0 2GI7A 2ZOOA 3AAZA 4PRIE 3SDXA 1CDIA 2KZWA 5H35B 3O6FB 4PP2B 1QUNA 1F18A 5GS1C 1M53A 3HC3H 3HJEA 1VB9A 4P2RE 2Z91B 1QSZA 3ESPA 1R1CA 2PR9A 2O61A 5IB2A 1RSFA 1RUMH 2IALB 3SKNA 5B4MC 1NGPH 5CCKH 4Z7WE 4JFVA 3EDEA 3OD3A 2NY0D 2R2HB 3GBLA 1A14H 1AKJB 1UWXH 1OK0A 3QG7H 1G1YA 2FX7H 2CZNA 1KCBA 2YPVL 1U3NA 1E4WH 2VW7A 4IRJC 2DM7A 4MD0B 4I0KA 1UWFA 5K39B 5GS0D 1UJ3C 1BBJA 3SPVA 3FB5B 3BGAA 1KN2H 3MREB 5T3XL 3AFLA 4ZUSB 3AITA 5BV7C 2VZ1A 4AE1A 2WBKA 1G7PA 4BWTA 2HFGL 3OC5A 1HWGB 3HR5A 4JFOB 4PQXA 3D0LA 4XBGB 4NN6B 3A23A 1QWHA 1V8HA 3MOAH 4GS7C 2NDFA 4N2FA 5CWSA 3AG4B 4Q0XL 5L7XH 3RX5A 1ZIAA 4W9HC 2WCPA 5B7EA 3W0WA 5EOTB 3HMXH 4EI5C 5AEAA 4XX1G 5DLML 1OP3H 4KJYA 1BMZA 3JUZA 1AYRA 3EYSL 1T2QH 3SE4A 5HJBA 1WLHA 4Z7OB 3HB3D 1P5UB 2P9RA 2V6HA 3DJZA 3ETBJ 4HUXB 5B1CA 5L88L 4X4KA 3CK0H 5SWSA 1I9EA 1NDGB 2HKHH 4CSTA 4OLXL 1ESOA 3SE6A 3IDXH 3G5WA 3DUHA 5IHBA 1ZHLA 4WTWA 2ZCHL 5E9NA 3RY5A 4FTVB 2NY3D 2JIXD 4H5SA 3H0TB 1JPFB 4Y19D 1LO0L 3SCMD 3V0AC 4C4KO 5G5DA 5IIEA 1KBPA 2XSKA 2XTJC 2HH0H 3TT3H 2Y07L 2LAAA 5F3HB 1BQLL 3WHE0 4OIIL 2XWEA 4PRHE 3RWCB 1FL6A 2BHFA 5AAMA 3V5HA 1AHMA 4DQOH 3W81A 1MCHA 1EXUB 2F19L 1AE6L 1NMAH 3L9YA 3SODB 2JQZA 3MJGX 3TNNA 2C3XA 1ZLUH 2ICCA 2R56H 3O11B 3IN2A 3SGEH 3EBHA 4IRJD 2QELA 1ES0A 3UZEC 1A1NA 1ERNA 1JCKA 3CJJA 1ZANH 3RL2A 4ZZKA 4LLWB 4ZMLA 1T03H 1F6AA 4AGNA 3ZUNC 1UT9A 2WXMA 5AUMA 2WUBL 1BP3B 3ARSA 4WTZA 3QUYA 4PRAB 5HGHA 1DQDH 3EG9B 4LAJH 2E9GA 1JHLL 4UM9D 1N2RA 4TNVF 5BNXD 2J5LB 1MHHB 2V7HB 1G7MA 3ESMA 1PY9A 2WQXA 1MIMH 4Q56A 4YIQA 4L4VB 3WU1A 1EVUA 1CXIA 1UWEH 3LNIA 3SBPA 3VW3L 4J3SA 2VN3A 3IDNB 2ICES 1LWJA 3EYQC 4X7CC 4N6RA 2XWBB 2V2WB 3D08A 1A4KA 4KY2A 3SDCA 4Q9CA 5I1IH 1BQRA 3BIAX 5C0GB 4GRMA 5CILL 3VNZA 5C6TL 4F91B 4ISVA 1FYTD 4HBCL 2DLGA 3MV8A 1I1YB 2QGBA 3KLAA 3KZ8A 1JTPA 4NQUA 2ZWSA 3PWUA 4UILH 4GBXB 5FGBC 1ZLVK 2X2JA 3ET9F 2ICEC 3NACL 1UVQA 1RZIB 5G2NA 5KOVC 2MNJB 5I73B 1I1FB 3IJEB 2XTJD 2OR9L 1L9OA 3N41F 3GIVA 3BT2L 1Z1WA 4DKFL 4HWZA 2KPNA 1GGCL 3P0VH 2F1BA 1DZBA 3BE1H 5B22A 1GJIA 4WVRA 1IAKB 3HNVH 1MIEH 1DEEA 5ADOH 4OD2A 4K3DH 2W80C 1B0RA 4AT6B 1ODUA 4PRDB 4LSPL 2BC4A 3L5WA 4GSQA 3FCTB 3D52A 3RBSA 4QRPA 4GLRI 3P11H 4E9XA 1DUYA 3LNDA 3AVEA 2Z92B 2OYPA 3RNQB 1ADWA 1J5CA 3OG4B 4UI2A 3HHSB 1NH6A 3LD8B 5F7BA 5AZEL 4CKVX 1YRKA 2COQA 1DJGA 4RSVA 5D7IB 1ZLSH 3TBBA 1DDHB 4LEBA 5JDSA 4XAWL 2VUYA 1HL8A 2WTRB 1PZUB 3QAZC 3U9UB 4UTAH 1P0SE 1QPXA 3FFCE 2Q76B 3ARGC 1GGUA 1TETL 2YEZA 5JOPD 3ULVH 4ZMTA 4BH8A 4YBQC 4KXDA 4DW2H 4FI6A 2VZTA 4AL8C 2EEFA 3BP7B 5DRZA 1HCVA 1F58H 5DA0B 1OAUH 4EI6A 3VGEA 4KVCL 2GVYA 5HYJD 5JXED 1RPQA 4LDOB 3UJJL 4FAAB 5ERWB 5J89A 3P2BA 5A2LH 3MRCB 1Q4NX 3RWJA 4NNPH 3D12B 3VXME 3Q8AA 3ZZLA 1SYVA 5FHAH 3RE0A 3LVTA 2O72A 3QUMA 3S3SA 3KDPB 1F1DA 2DMCA 2H2PC 4Q6YA 3ROOB 2Y7LA 3QEGL 4JFEE 4IBSA 5HTSA 2IOMA 1WFOA 4DO5A 4N1EA 3SZ6A 4XP5L 1NFIA 3QCVL 4X5XB 3RX8A 2DJUA 4Z9KB 4OT1H 3O41A 3GLDA 3SSGA 2X53A 5KVDH 5EUKB 2ZP0T 5AVTB 4AQ1C 2E9WA 2PPCA 3QDMD 3BO8A 1RCYA 3FH5A 4F92B 1TT6A 4PJFF 1DJHA 2Y6TE 3EIFA 3DI3B 3N40P 2NW3A 1QEXA 5FLVA 2CNYA 4M00A 4RIRA 1TVHA 4NC2B 2XQYK 1KNOB 1KTCA 4K0OA 2UXFA 1AHWC 1YNKH 2FJFA 4R4FH 2NXZB 4K8RL 4MCYA 4GG8B 4JO2H 5MENB 4YFLI 4D8OA 5HVFB 1W0WA 1CBVL 3DOSB 3FU9A 4X7SL 3ZE2E 2DWDB 4GXVL 4XCCH 4IIQB 1I3UA 1Y18B 2RFXB 3Q13A 4ANVA 1RERA 3KMDA 3OZLA 1ZTXH 1ZXKA 3PJSB 1F90L 4GQPH 3B9DA 5JHBA 2OMZB 1R3KB 2VRAA 1NM4A 3P73B 5JW5A 3ARGD 4UANA 1KYOJ 3UTTB 4AQ8C 5HJDA 4FI8A 4N1HB 3PGFL 3QXDA 1NC2A 1JFHA 2HT4C 2DWYA 2V5TA 3NJKA 4HHAB 1R5IA 4AYMC 2LTQB 3HRZA 3VYPA 3KXFE 5IJVB 3UP6A 2Z0BA 4JDVA 2G2RB 2ZSWA 2HTLD 3G7TA 3NQIA 3H2PA 5CSZA 5DJ2A 4GP4B 5GGTA 1BJ1H 4JFFB 2UZIL 1ZA3B 1AMXA 1MCOL 4PB9H 3FUIA 1G7JB 5K69A 4M1GL 5DQJA 3LEVH 1KWGA 2H2PD 7CGTA 2YSTA 1KBGL 3UABA 1FRGL 2KH2B 4X6DF 4P46A 4JDTL 5C6PB 2R0ZH 4HK0B 3U2SB 2Y36H 2UVEA 3TBCA 3BCDA 5EOCL 5E5MB 4DSYA 5DWUL 4NRXA 3LV3B 1WCBA 1U8IB 3G6JB 3I84A 3OPZL 1EBAA 1RURH 4CDHA 4DUVA 1N0XH 2D7QA 5AW1B 3GKWL 3Q9PA 3QDGB 4XC1L 2E46A 1JZEA 2FYYB 3L4CA 5K1NA 2R4SH 4UQAA 2VE6A 4WU5B 1A3RL 2CM5A 1TYEB 2AV7A 2AI0H 1EAOA 4OGZA 3ZDXE 1BFVH 2YXFA 3APMA 2TSBA 1MKFA 2EDNA 4IJ3B 5FA3B 2BNRB 4TUKL 4QRRA 4FKKA 1I7RA 1LP9F 2B4CC 2F61A 2AZAA 4PJXF 3W39A 4C4UA 1IX2A 1WUNT 3MR9A 4JO5A 1BVLA 4NPYB 3ULSA 4AZ8B 3LZFL 3L4ZA 1XH2A 4Z3JA 5FECB 1DFXA 1SXBA 2X6BA 4JRXB 3NP3A 3ISYA 5KSBE 1VF5C 1IC7H 4F57L 1CFVL 2HTKC 5SX4I 3S3PA 1SEBB 2XX1A 1UB6A 1BA9A 5DHVH 4JPKL 3MRNA 1OSZB 4LESA 2ZCKL 3OAUL 4UMGA 5IJKC 2GYSA 4L1BA 4R4BB 2QQKL 1FZJB 2DIJA 4UT9L 2CK0L 5F1OB 1Z3GH 2PP7A 4I18B 1T89C 4HZLB 3LIZA 3TS8A 3ALXA 1UEMA 3K8LA 3LN4A 4YZFE 1D3CA 4CMHC 4OGXH 5FB8A 4ATTA 5JMRA 2WPGA 4IMKA 3U30C 2J88L 3WN5C 3D0VB 3TVMC 3ZRSA 2EYTB 4JUSA 4JO1L 2WV3A 4HLZG 4WF7A 3HC0A 2FJGA 4M7KL 1FHGA 1INDL 5D93B 2VL5A 1E8WA 1PZ5B 1OZUA 3INUL 1Q9LB 3ZDYF 2EDRA 2BNUB 4R5XA 1H5BA 2DEYX 3HN3A 5FO7A 5HD8D 1FAIL 3L7FA 2NSXA 4I77L 3OR7B 3OAWA 2VGLM 5GGQL 1INQB 2YRPA 2GAZA 1C5DA 1MVUA 2BP8A 5I6KA 1T20A 2HSIA 4JPVH 4D0BA 4KGLA 4G83A 2DW5A 1RZ8B 4GT7A 3QXUA 2DTMH 1KJMA 2A73B 2O5NA 4S1DC 3X17A 3M07A 4Y4HB 3U48A 2GBAA 1U8OA 4JKWA 4ZOBA 3IWVA 2VT0A 5KG9A 5GJSH 3UYPA 3FTUA 4GKZB 2HTKD 1RIVL 2XWRA 4G1EB 3V5DB 3EYOB 1DBAL 1I9RH 3MNWA 3NSCA 4BK5A 4E41A 4ZW8A 5EU6E 3GUFA 1KEML 2YXWA 3LSOA 4TNEA 1N5YL 2R2EA 4OFKA 1KGCE 2X3AA 3JQOB 3LKOB 3PXJA 5AB1A 4MQXD 3RWDB 3SYPA 2BNQE 2V17L 3IU3B 1OCWH 2YGNA 1TCMA 1J0KA 3CIAA 4U3SB 5FYJD 4APQB 2CSPA 2ZWLT 4HWBL 2OL3B 5SX5H 1PSKL 4HVBA 2E7MA 4WHTA 5F9JB 4GG6A 4AIEA 1K4DB 4Z7OF 2G3MA 2YQGA 4EUPB 3WJLC 4ZYKA 2DQ6A 4YK4C 2NNCA 3R0NA 3IFOB 3GUTA 2BVTA 4HX1A 2MH4A 3TVMD 1WBZA 2HWZL 2BSTB 3WMQA 3RTLA 2YD9A 2NY5H 2X4OA 2UZYB 1MEXL 4WFHE 5E2WL 4G8IA 4AYDC 3T2QA 1JWSA 5D7JC 1TKWB 1IUZA 1GIGH 1NBZA 5DVPA 4N2NA 5T3ZL 4IBTA 4BA0A 4EIGB 3F7YB 3MV9B 3P2TA 4Y7MA 4X6BB 4MNQB 4FQQA 3WXVL 4ODVH 4C83B 3WJJA 3ULUL 3EJPA 1JUFB 3VWKC 4HUVB 5JW4M 3S36X 2MQGA 2P5EA 4S1DD 4KK9C 2PWFA 3KCPB 2WUCH 1L3WA 2UX7A 3ME0A 4K3GA 3ATAA 1WA1X 1LK2A 5HHMD 5IG7A 5TE6H 1NAMB 1VZGA 3P69A 2X41A 1U42A 2LU3A 3MRGB 5MI0B 3BAEL 1OF2A 4NC1C 2K6YA 5KSAD 5F97E 3NDYE 4UQ9A 4XNXL 5IREA 4O00A 4WUKL 1W15A 1B6DA 5IFAL 4NCDA 3GZPA 3BCFA 4R96B 3IAGC 2D73A 2VITB 1F4XH 2F7IA 5F44A 3CZEA 1RL1A 1F2XK 5LQBL 4BD4A 1KLUA 3TX4A 5A40E 5ACZA 4LNVA 4UV4L 3UL4A 4L1HA 4PJ5B 1A1MA 2EUXA 4KPHL 3BGFC 1DBMH 3ZR5A 2D7TL 4GAAA 4TSBL 4QOKB 1G7QA 1T04B 5HVGB 1EXHA 2ZNXA 1KB9K 4NRZA 1UZ8A 1EQWA 4I9WE 4AYID 1SZNA 4Z76B 4IKNA 2VR9A 2E7CA 1GR7A 2Y4SA 5FYKH 3T0DA 1MRFL 4JO3L 2BWIA 1QI5A 5J6GA 3Q43A 4L2YA 2VISB 1JXKA 1A3LH 1TZHB 1A0QH 1S7XA 2BSEA 4MA1B 5D96B 4PS4L 3VD3A 2DI9A 1BVKB 4LSSL 2ZF8A 1N0LB 2WLIA 3C09B 4L1TA 1KY6A 4MJ5A 4UV7H 5D7JD 5IB4A 3O2DL 1TFHA 4LOVA 3NFSH 3S37L 3STBA 3DETC 3OKLB 4N0UB 4PJCA 1TJIL 1X5MA 3DRTB 3S3DB 3AWGA 3NAAL 4H20L 4NZDA 2IAMB 4LCWE 3UZQA 3VWKD 5IFHL 2B59A 2QV4A 3RL1A 4ZUVA 4OCRH 5KBKA 4XMUA 1QFUL 1XIWD 2ZP8A 1NIEA 3P9MA 2GBVA 4HOMA 3CIQA 4CRPA 2YAEA 3V4PH 3H9SD 3ARTA 2E59A 4CW1A 1OT1A 3BT0A 1L3NA 1PZSA 4DVBA 1L7TH 3T0EE 1KYUA 3D4YA 4CC4C 4UQBA 2NXYC 1PS3A 3RY6A 5BQ7A 2R29L 4DP5X 1TZGH 1E42A 4FC3E 3GO1L 4N20A 3TA3A 5D7IF 1OW0A 3MBEA 1YMME 5HGDB 3QJOA 4JPSA 3MA7A 1CQKA 1LYQA 3WO4C 4Y89A 1GXEA 2VJ8A 3HBZA 4NJAH 4DOHE 4N6QA 3MV7B 5FO8B 3IVKA 2JKRM 3MX0B 3OX8A 4Q9RL 4NQSB 4XNBA 4BCXA 1A9BA 5D6CB 3QPXH 2E8ZA 4P9ML 2ZUTA 1KIRA 4Y5YB 2EIKB 3QIUC 2WLJA 1NCGA 4WU7A 4G2AA 1I8LC 1UWGH 2AGJH 2EYRA 1RZKH 3I6KB 3O8XB 1PPIA 3U1SH 1ZK9A 3U0WL 2Y2WA 3B37A 5JMOC 4PN6A 1EUUA 1WQVT 1YQVH 2BVOB 3H54A 3IFLL 3DETD 4CC1A 5C97A 1FFQA 3FQUB 4CVZB 4PRBA 1HQRA 1FBIH 1RJLB 2K78A 3ZRFC 3QSKB 2I9LA 1P4LB 5H8DA 4PJHB 4CGTA 1J12A 2DLIA 2EECA 1MCBA 3F6JA 1CMOA 4W6WB 1BVZA 1NEZB 3TXAA 3SDAB 3ZLQC 5EF2A 2AXJA 1ACCA 3IDMA 5EBMA 1L6ZA 3F7PC 4NUPA 1UM4H 2NXYD 3QORB 4MASA 3SHSA 3K71A 2EACA 3BZ4B 4OB5L 1B9ZA 1EFXD 4OUUA 1RZ7H 1MW1A 1S6NA 2ENYA 3RB5A 3MA9L 4OZFG 4NN6C 3OSKA 2VM9A 1CXFA 1VEOA 4WKZB 5K9OA 4NQEB 5KJRH 3QQXA 2QQLL 4YH6A 2J1YA 1UH2A 1M4KA 4LASL 1LE9A 3FKUS 2YPKB 5C0NC 1KLFA 1S4IA 5DQ9B 1QG3A 1KXVA 3DGGA 3UBXB 2O26U 3BRGC 4FQJH 2BIHA 4LRIA 3DX8B 3OVUB 3MYZA 4QXGL 4Z78A 5TTRA 1MFEL 4JFDD 2P28B 3QIUD 3ZMEA 1WEJH 4X4MA 2HVKB 3LZNA 2CKNA 3IXAB 1BG1A 1OAQL 3M45A 3PHOB 2B1AH 5CZVH 3K80A 3O6FD 3WMPA 2RD0A 2OULB 1N7ML 1CXKA 1JYNA 1IEBA 4MWFA 5I1GL 2VC2L 5IEKB 2LU5A 1TEYA 4E5XG 5HHXH 3KPRB 1U8NA 3AY4C 4QF1B 4L05A 4R83A 1I7ZA 2IGTA 4FYQA 1JPEA 2HLAB 2DOCA 5AFAA 4L8SB 5KYYB 3CFKB 4GRWE 1AKJD 2JKNA 3GB7B 3SKJL 2ZOUA 3LQAC 4UOW1 5I1JH 2A9AA 2YBGA 4PLNC 4LCCC 4G9FE 4HSQA 4XNDA 1SBSH 2FIKB 3US0A 4GW1B 1IC1A 1W72A 2DL2A 4LCIH 3BZDA 3QQ3B 3BKYL 2VJXA 4MDJA 4UMSA 4XO9A 4F9LA 5BV7L 1ZWIB 4G6AC 1DJXA 2BOCB 2J5LC 3ZTNH 4IOIB 4F8OA 3TTYA 3UO8B 3I9PA 5HI3C 3ZXAC 4KZDL 2F8VA 3EYUL 5L4FA 5HDRA 4DGWC 5I6LA 1GYCA 5E8NB 4HCRH 4OU3A 3AAZB 4AKOA 5FW6A 2EH7L 1IBDA 4HKBB 4X0NA 4XI5C 5C0ND 5EZOL 4AVIA 3X1FA 2YPLB 3RDJA 5IW6A 3L3GA 1VACA 1OTSC 3BH8B 4HH9A 2FR4B 3JWDH 4X5WA 1OB1B 3ZOAA 4HDIB 5JTWA 4FABH 3TYGH 3OXRA 2PW1B 2VDQH 2DBLH 3VH8A 2GJRA 1T83A 3TJHC 1O5PA 2P45B 3I85A 4EEEA 4PGEA 1Z3RA 5IF0A 2CKBH 3WFZA 1PG7H 4DEUA 3HR5B 1QYGL 3QZPA 4JDEB 1OP4A 4PV9A 3PUUA 4KTEH 2XKNB 5TH2B 2EUVA 4G5AA 6FABH 1MLBA 1G94A 5FYLL 4OQTL 1UH4A 2NY2C 3PWPB 1NFDE 5F0LB 1U8JB 5AAWC 5KVEH 4HIPA 3SY6A 3O81A 2IH3B 1R47A 4HIQA 2YFOA 4MX7B 2CCVA 3GNML 2JV6A 1CXHA 2PCPB 2DMBA 4LF3A 2N3JA 2G30A 3TH3T 3BVUA 2J6EL 3WGUB 4OAWB 2I9TB 5HI3D 1ZA6B 3G9AB 5C0AA 3DVGB 4ZNEA 3WKYA 5FYKU 1F4YL 3AQZA 5BRZD 1UGNA 4S2SB 5FV1L 1UACH 1F1AA 1SYSB 3A67L 2ZWZA 4F5CE 4G6KL 1HH6A 4AKPA 4DQAA 3NABH 4XPTH 2DMHA 1G5GA 1HHKB 4AJ0A 4PJGB 4XOAA 2WC7A 1GZPA 1YPZA 5JIMA 1U95B 5IHUH 1EGJA 3T77A 1Q90A 4ONFL 4QHLB 4YHKL 5CGBA 4UQEA 3BAXA 4HCFA 4LLYB 4YDVA 3BN9C 2H9GB 2VAAA 5ADPH 4QXUL 1KIQB 3ASWA 3RX9A 5KSVB 3WS3B 5GGSB 3QQ4A 3TJHD 2R2BA 5L8LB 3C8KA 2WQWA 1MSPA 3N5AA 1NINA 3HMXA 2PPEA 2IGFH 3OJVC 4XPGL 2CO6B 5GRUH 3MJWA 1XF2B 1IEAB 1CG9B 4XAKE 4A6YL 3B9VA 3T4AA 4A7QA 2AJXL 4UAHA 2F8OA 5E00A 2YMOA 3MGTA 2NLJB 4H44C 4J5VA 1FNEA 3MUGA 2QZQA 2O4EA 2EDFA 4YSOA 3BMVA 1KV3A 32C2B 4QT5A 3IKCA 3PNWA 4H1LG 5G55A 4LAQH 1J10A 5CBEA 3VM7A 5DGQA 2NCMA 1A4KB 4ODXA 5HHQB 3SDCB 4XMPH 5T3ZE 1KBWA 3MLWH 2A9DA 2Y72A 4DNLA 1AGBB 1OLZA 5JIIA 4O9HL 1XSKA 3SQOH 3V6OC 4HETA 3RUGE 3MNVB 4K71C 5ICXA 2K9UA 2B3IA 2FHCA 5IMLA 5ISZE 2ZKMX 4ODUB 3KR3L 3KXFA 3L5JA 1TTAA 3FBKA 1XVSA 4TTDC 1UKTA 1UVQB 3WNJA 1ASOA 4JN1L 1ORQA 4L23A 1OPGL 4V1DA 1IBFA 1QFOA 1B4RA 3JYBA 1WITA 3BN3B 5JPNA 3EYVB 3Q7JA 1IE4A 1HINH 2LTQC 3QFJA 3O3UN 1JL8A 1ZVNA 2Z4QA 4M4RA 4YHZH 4YOKA 1IC5H 4BQ6A 3CFCL 4JEGB 5I8OL 2FUTA 3BVTA 1R5VA 1Y6KR 3EFOA 3KYOA 1HSBA 1M1SA 3IMTA 5H4ZA 3BPNB 1DEEB 4HIXH 2DBJA 3JV4B 2PO6C 2XZAL 3BN9D 1KENH 2A1WL 3GC3A 1S7WA 2HFEA 1E2WA 4BFNA 2BC4B 3UP1A 4EDWH 4S1SL 3QYNA 1JPTH 5TDNA 4U6VH 3IGKA 3CX5J 2C4FT 3DX7B 4ICXA 4U6XB 4KV5E 5GPRA 4QKTA 3GSVB 3OL2A 3VXOA 5E70A 3CSGA 1EAJA 1PLBA 1BHGA 4PGJA 4QHUA 3B9KC 3CZFB 4Y1AD 4FA7B 3OKKB 2VQTA 2ZG1A 4FYRA 4YX2H 3L17A 4QLRA 3WFBH 4R7NA 3DX2A 1LQSR 4MAYC 5DA4A 3QEQA 3LEXA 5LBVA 3EBAA 4AMKL 2P80D 4UM8A 2C9SA 5JHAA 5GSVB 2NXZD 1XF3A 2QPDB 4IJ3C 1F3DJ 5IBTL 1JF1B 3Q6GH 2Y3AA 3ZE1B 4AM0Q 1MCNA 3FT2A 4N8PA 2KZKA 3O6LL 4MMYB 2EDYA 3GK8L 3LH2L 2YS4A 4U1JA 3AJ7A 1HK6A 1WWCA 3POHA 4KMLB 2AXGA 1GKOA 1IEHA 3UTTD 4F7KA 4X99A 5AL0A 3M1OA 4TTDD 2WWNA 1SUJA 4S1RL 5INDA 2I27N 4MLSA 1HILA 1WZLA 4BUQA 2X4TA 3QBTB 3QIWB 4G8EA 4D8PA 2XA8H 4PREB 1PY4A 3MO1A 3NBNA 2D9QB 4JJ5A 4LNRB 4ZXBB 2KLRA 3ZL4H 3O3AA 1RZQA 3L6FB 5FM8A 4MSWB 3OB0K 4MD5A 3GSWA 3IM1A 3N42B 4JFFD 1A6ZA 5DFTA 5DS8A 1P4BL 4JX0A 4CN1A 1T1ZA 3BLPX 3S34L 5HDQL 4JCMA 2PO6D 5F93C 4QJ4B 1BOGB 3AWEA 5GZNA 1BVNT 5HHPA 4OTXH 2X87A 4Q6IB 4ZS7H 4LMQI 2OXHB 4WJG3 2JJWA 3QEUB 4P9HC 3L81A 4KBPA 4R9HA 4PPTA 2BJML 4UTAA 2PPAA 1ZVHA 3ESOA 3EHBB 4NKIH 3HE7A 2HRPL 4PJEB 2X10A 1I8UA 2IPTH 3TIEB 1W0WB 2IDTA 5EIVA 1AIFA 1YEJH 2APXA 1G9MH 1JK8A 4K7PY 4EN3C 4ETQA 3B9KD 4X4XB 4DKEL 4K7FA 5C86A 4JQXC 4WCYH 4K9EC 3VRLE 3VXSA 5DURB 3QDGD 1XZ0B 4OLUH 3FQTB 2IMNA 5E1AA 1BFOB 1SJHA 2N59A 3WI9A 3CFDA 4O5LL 4L3CB 1GTFA 2EDHA 3I6LD 3HIZA 1G5AA 4F8QA 1ORSA 5C0JB 2A6KB 1R5IB 2QHLA 2BNRD 3D4CA 4QY8B 1MQKL 2MKWA 1IKNA 1AO7A 5EOQL 5E1IA 4FA6A 2MNUA 1WT5C 2J72A 5GZOA 4PJHF 1KG0B 4OCWH 1GJWA 4PR5A 1OAKL 2B4CL 4Y4HC 1DANU 1MXDA 2YARA 4KDWA 4Y5VB 2VLJA 2DS4A 2E75C 4JRXD 1JZ8A 1MWAL 3T1WA 2X4PB 3MJ6A 2FQEA 1PNCA 1E90A 3DTDA 2ZZUT 2P5WE 2BWDA 1IBYA 4YVNA 2LAGB 4J8QA 1QZ1A 3AMLA 3O3EB 3RPIA 3BEWB 3D06A 3B2PA 2FLMA 4XHJC 2N4IA 5JR1L 1JGVL 1CDHA 4PTTA 4XH2A 1ZE3H 3LEYL 2A6DB 4N0FA 4NYLB 4IW4C 4M6MH 1L7IH 5E0FA 4LBEB 4UOQA 5CR1A 1EFQA 1T1WA 4I2XB 4O02B 2X3CA 1S7RA 4DGIH 1MHCB 1WO2A 4WW2F 4A1RA 4K07A 4UZGA 4UYQA 5J3HC 1M05A 2SEBB 3IGAB 2FLRT 4QRAA 2MHAB 5HGAB 5KBLA 2VLME 1NGZA 3MR9B 1O75A 1BVLB 1MAML 3BYYA 4RFEA 3TO4A 1HKLL 5D1QB 1EO7A 3VQ1C 1HSAA 2B2XL 1FZKA 1HL5A 1KCKA 1DVTA 3FCBA 4FQXB 3MLTA 2YLKA 1FO0B 2JCCA 3EJJX 1XH3A 1J1PL 2XBZA 3FU7A 4B7IA 4HCGA 3CSPA 4AVJA 1J86A 5I19H 5DF0A 2YC1A 1JN6B 2Z93B 2CO2A 5I0ZA 5KSUB 3E3QE 3KDMA 4LMQE 2BVPB 1TOXA 1LMKA 2Y06L 3PV7A 2DWSA 4OSUL 4PJAB 5E1GA 2KL6A 4FD0A 1R46A 4Y4HD 3L4XA 1K5WA 3EYFA 3ROLA 2RCSL 3WSQH 2J73A 5MI0C 3CVIL 4LCYA 3UJTL 2XZCL 3Q06A 2VN6A 3P9LA 1CD0A 4AUUA 1QLFA 3IWUA 1SRDA 3QZMA 4J12A 1TJGH 2MNWA 3L16A 4MMXB 3HR6A 4FXLA 1SN0A 3NSJA 2XOTA 4E0RB 3LNHA 4F7PA 4NKDB 4XHJD 5E5RB 3HC0B 1Y07A 5BVJA 1QLEL 1ZY9A 1J1XL 3NDZE 4KZEH 4P99A 3JT0A 4LKXA 4TVSa 1KLGA 4DP8X 1TZOA 5I8KL 3PIQA 4TQ8A 4APQD 1S9YA 4LEXL 2F53B 5C0EA 5F96H 2V9TA 3FT4A 3ZTDC 3GXUB 5JW4N 3HAEG 3O3BA 1T4KA 3RBGA 1SOSA 1TNNA 3RG1C 2XN9B 1J0YA 2ALWA 4LLUA 4XBMA 3V0WH 3RTQC 5A6LA 5D96C 4MA1C 3GXDA 3WXWH 3QNYA 1UB5A 2W9EH 5HYQB 4WQOA 3FT9A 3HHMA 4H25B 5DHVA 4OUOA 3V4VB 1FVDB 3ELQA 1XSOA 3VUAA 2W94A 2JJSC 5BRQA 3MV9D 3EOAA 4MNQD 4YDJA 4OJCA 5D71H 5ALCL 4IU2A 5ILTH 4J8RA 3HA0A 4XGZB 4JPWH 5EC2B 5GRZA 2E4FA 2ED9A 4B9YA 3GSNB 4LP4A 4ORZC 3WFEH 3WKML 1Q38A 3QCUL 3KH3A 1EO5A 2QQNH 3WE6B 4G82A 1BFTA 4U2YA 4LVNC 1JPSH 4ZFQA 1R3IH 2MPVA 5C0DA 3AB0B 4G8GD 3PUCA 2UWEA 4LSRL 4WI4A 1DJWA 5A2CA 3BSGA 1QSFA 4UCFA 3T4YA 3MRFA 5FYLE 1AZRA 3PL6A 3KYKH 2ZWKA 1RP9A 3JYCA 4KDTC 4RETB 1X5GA 2J7LA 4DCQA 3QXTA 4PJ5D 4Z23A 1FZMB 3FTSA 3AC0A 3CPUA 2VDML 3CVHH 4G8IB 4K23L 5LG1A 3G5ZA 4QOKD 5DUBB 2A38A 1U8HB 4F20A 4L9LC 2OQJA 2EH8L 4PJ9B 1AGCA 4WO0A 3NPSB 1TQTA 5EV7A 3UYRL 1OP5K 3U4EA 4JZOA 5FDYA 2WQSA 4HJ1A 5C09E 4PJGF 4ZFFA 4OZHE 3F62A 1J8HB 4LPXA 2P5PA 4Y5YC 3RTQD 1HQ4B 3GLAA 1UENA 1CLYL 2HJKB 4F7MA 1MUJA 3ETBF 2ATPB 3RIFF 3RWHA 2FHFA 1C7TA 4LSUH 3A24A 1EERB 2WINA 2ZCLH 5MEOA 1G43A 1NGQL 1XGTA 5EUOB 4Y16B 2AQPA 1YN6B 4I5BA 1J1OH 4PG9A 4H8PA 4B9GA 2QTVA 2FBOJ 4LPUA 3REWA 3EAKA 4TUJA 2GT9B 2IAMD 2CRIA 4JKNA 4HQQH 1K4CA 2XI9A 3QNXB 4LSVH 4NGHL 2VN4A 5F7KC 1PIFA 5HY9B 5IOKA 1UKQA 1KLUB 2XICA 2XNAA 3BFQG 5ITFA 1O7VA 5E2TL 3ZN6A 4XP4L 1UURA 2DTSA 5IMKB 4OLYL 3KS0H 5BS0A 1EANA 3TZVB 3H3KA 5FFOA 4XCFH 1BYNA 4GAGL 3OKMB 3FHEA 4KU1A 3WIAA 2PWDA 3QORC 4NAJA 2K8QA 3X3FL 3D51A 5DJ8B 2DDQH 5TFSL 3ZT7A 1ECYA 3F7KA 2K3HA 3U46A 2X12A 4NZ8A 3IGLA 4I0CC 1MCWW 1YUKB 1NLBL 1BD2A 5E95B 1MDTA 1SHXA 5AW4B 3O4LB 4JM2B 4RZCB 5JXAH 1IGYA 3UTOA 4AVKA 4WY7H 1Z9LA 4CMMB 3V6ZA 2WXPA 5EOCJ 3VVWA 1KC5L 3INOA 4OH2A 3RAJH 4ZG1A 3MV7D 3I75B 3R8BB 2LT9A 3MXVL 2X1XR 3Q8EA 3P40A 3BDXA 4IKIA 1P9MA 1PBYA 2VXVL 1MNUH 3JVGC 3RL1B 5HPOA 1F0LA 3P9MB 5C0CB 5FDWB 1BLNB 1IJ9A 2GTWA 4BZ1L 3O8XD 2VDLL 3CQQA 3N43B 3AW5A 1MCRA 3K2MC 4PAZA 5F72S 4M7JL 5J06A 3F12B 2DL9A 2X6AA 3IKKA 4KHXH 2P8MA 3MAWA 1CE6A 1J7VR 3MRDB 2GTZA 2Q86B 2DF3A 4G1MA 1O9WA 3C9NA 3HZVB 4HIIA 3E2HC 3P4NA 3MCLL 3HS0C 2R0LL 2NX5E 3BMWA 2GUOA 4XCNA 4AC4A 1XXDC 4I0PA 2NZ9C 3GJFK 4OF5A 1TJHH 2X3BA 1LTXA 1H8NA 3T1FA 2VYRE 2BS9A 3TEZA 2EINB 1A6UL 1P7QA 3QORD 2R0KH 4PUBL 2X0WA 4UWQB 2C1PB 3ZE1F 1CICC 2R1YB 3SBRA 4PRIB 4WI6A 1YEKH 2VUOA 1YEGH 3VXUE 4NQDE 1YECH 2IQAA 4HAFA 1E65A 1TPXC 1W16A 1JGDA 1UZGA 3CLFH 5F1KC 3FW6A 4U4BA 4P2RB 1DJZA 3B5HA 1TUPA 3E9UA 4N8VG 4NQED 5TJWK 3X2QB 2CDEA 4DEWA 1J8RA 4U3XA 4Z7WB 3HCVA 2G0KA 3HS9A 3VFMB 5IWLA 4M7LH 4KAQH 1T0NA 4LLMB 3LXAA 4MXWL 2HKAA 1XGYH 4Y0GA 3EJUA 3V4PA 5J1AB 1YEDA 3FB8B 4GKNA 2DQGH 4N2IA 5GGVH 1D6VH 2B14A 1MJ7L 4WK4B 2AKRA 1H8SA 1OSYA 3N42F 3MUY1 4J2QA 5DRNA 4EUPG 3D39A 3FT0A 5L2KA 1IT9H 5ESQB 1CLZH 4Y9FA 3K6IA 5C0RL 2GEQA 1CDUA 2QMJA 1V7NH 3JWNH 4PWJA 4PW4A 1J11A 2DLFH 3MN8A 5D70L 3RVTD 1M7IA 1CR9H 4FS0A 1IQDA 2OMYB 4ZFZA 3ZZ1A 2PYFA 4AQOA 2FT8A 5K1JA 4PJEF 4N2KA 2DH3A 5LGJA 4A66A 1TYRA 2WYTA 2G75A 5DJXA 3ARYA 3MLXL 1U93B 4L37A 2E9JA 4U7SA 5EORH 5T5FL 4Z7UE 5EU7C 5AQ0A 3H1ZA 1D5IL 3WIHL 2NZ9D 1NLDL 1E3FA 3VD7A 3K0WA 1KT2B 1NJ9A 3LQAL 3T65A 2Q3ZA 4XC3L 3SE4C 3FQNA 3MJ9H 2MEJB 4Q4EA 4AX3A 3VDAA 3WTSA 2XU9A 5A1AA 3Q01A 4JREB 3SBWA 1EEQA 4JDZA 3F7QA 1DHKA 4OD3L 1CFNA 4PJ8B 1VGKA 4XCYA 3U6XS 5F3BB 1DUZB 3LKQB 1LGVA 1BGXL 1DQML 3L3JB 4P4RB 4Z78B 4JHZA 3BXNA 3QI9B 2LLGA 3T3ME 4LOFA 3TT1L 3IMBA 3II1A 5JOFB 5KS9A 4PRHB 3APFA 4X98B 5AW0B 3F5WB 5L2JA 1JNHB 4TUOB 1FL3A 2YMTA 1G7HA 3JBG7 5T3XH 3V0VB 1NUGA 3VRIA 1A6TB 1A7PL 4K7PH 4TKWA 1TR7A 5KANI 1NPJA 3JXAA 2O6CA 5EIQA 1O6SB 1I7ZB 2R4RL 2HFGH 3DX6A 3D3VE 4LSDA 3ULAB 1S9XA 1T1YA 2HX8A 1Q1JL 4Q0XH 2DLTA 2M1KA 3O9WA 2PXYB 1AIZA 1XV8A 2DLHA 4JL2A 5DLMH 5FXCH 3V0DA 3PWLB 1BZQK 3BP6B 2D3VA 5E5LA 4XWOC 4YFEA 4Z77A 1ZLWH 4TM9A 1W72B 4XN5A 1HH9A 3F7LA 2X4RB 4EZKA 4AI7A 1BAWA 5L88H 3DX9B 2A2QT 3FUEA 5E8OB 3N85H 4LRNH 1OV8A 2Y3NA 3AGWA 4X5PA 4BHUI 5F6HI 3PLYA 5F6IB 2IWGA 2ZQKA 2EKSB 1DQJB 2WKGA 3NK3A 4KMTL 1GGTA 3GD1C 5IB1A 4R26L 1AC0A 1TU2A 3PWPD 1K2DA 3F7VB 1I1AB 5DXWA 3VFUB 2WLLB 5MERB 2FECL 1MCCA 1NEUA 3MOBH 4XNMA 3SDCC 1LO5A 1XXFC 3L4TA 2ESVE 1VFMA 4WLCA 4A7GA 1CVRA 4OIIH 4XNQB 2YJLA 1KCRL 1D6EB 3CZUB 4PJAF 2F19H 3V5KA 1AE6H 4PU2A 5KVGL 1N3NA 1T5WA 2LW3A 3BRFA 3MDJA 4BUGA 3U4KA 1MVFA 2FTAA 1XWVA 4PB0H 3IFNL 4QXTB 4HKXA 5FF6A 3ZSSA 3MODH 2IADB 2A5UA 1Z6JT 3MKGA 5I66A 3K5RA 1EDQA 3RGHA 1E3XA 2PWHA 4HKZA 3FYEB 4GO9A 4ZSOA 4HULB 3P4LA 1JD9A 3DPBB 1PVHA 5B38B 5IJCC 3GSXA 3SEPA 2VJ0A 2LFGA 2C7UB 4ZPVB 3IDUA 3RJDA 1GOHA 1E2VA 3NUKA 3C2AL 2PNDA 3MMEA 3NCWA 2DPKA 5GGUB 3VW3H 3WAKA 2X0VA 3QG6B 2IO5A 1UD5A 4UT6L 4KTDL 4XWOD 5F7MC 2HLEB 3VCLA 2WOBA 3FFCB 1RZFH 2ZPKL 3TN0B 2JKWA 5D2LE 5C6TH 3WCYA 4HU8A 3PFQA 5KTEH 4XP1H 4IHOA 2EDQA 2CLVB 1E4JA 1SOXA 1YUHB 2WKOF 1P84K 2VDPB 2WO2B 3G6AA 3GRWH 3KBPA 4MJJA 4X6CE 4N90E 2CHZA 4IMLA 1TQWA 3BVWA 3TU6A 2CDGA 1I8KB 1FFRA 1YDPB 3ARBB 1R3JB 2C3GA 5KWYC 1I8MB 1L9RA 1Q94B 2X4QB 4Y2DB 3LN5A 3MNZA 3VXMB 3GSOA 1BREA 4LEEA 1IFHL 3MU3A 2ZXGA 2HZHA 3S5ZA 2VQ1B 1TTCA 4LB8A 3SDCD 4ES9A 2CD0A 2D0FA 3OTTA 3BT2H 2J1ZA 4OFYA 3V4UH 1AP2A 3D0AA 4GIPD 3X12A 4Y2NA 1GGCH 3RDTB 4TLTA 3S4SB 4JFEB 2H6UA 4O2CA 3UG5A 3VI3E 4ODSH 3EDKA 3NQKA 4KXBA 2WXLA 3L3DB 1GGYA 5DR5L 2CKBA 3QO0A 5E9DE 3DUUA 1BM3H 1FNAA 2OYLA 4FHBD 4LSPH 3ZMRA 3GJEA 4G9DB 3QIWC 4EKXA 1AACA 4BCZA 4JM4H 4Z7NE 1DVFB 5HYEA 3H9SE 5TF0A 2AXWA 4HAKA 5AZEH 1IRAY 4TS6A 2FJSA 2N0MA 3AADB 1IMHC 5JYMA 4HJEA 4IBWA 2C7FA 3L54A 3OKEA 5EDXA 3UBXG 3T4AB 1XAUA 5IVZB 5SWZE 3ZE2B 1TETH 4JR9H 4RFNB 2WOYA 4L4JA 1OGAA 3D48R 1N67A 4OIBA 5E8PA 3D85A 4C47A 4Q6IC 3E38A 5GGRY 4LGPB 1QO3B 2EUZA 2AQ3A 4JO8A 4QRPD 2Y1YA 4ZT1A 3EHBC 4GSXA 2XY1A 4I4WA 4NXKA 4U0QB 4KVCH 2H6PA 5DMKA 4NNXA 1NL0H 2ZUYA 4W9IC 1DJIA 4XMLL 4ZQTA 3QUZB 4FQPA 3U0PB 4YS4A 2IXQB 4Y9CA 5EN3A 3OJ2C 3L1OL 5GHWH 5EN2B 2APFA 3KXFB 3OWRA 3FHQA 1GOFA 4MCNA 2CJSA 5EUOF 5HHOE 3DHMA 4LPTA 1HWHB 1MF2L 1RZGA 2OMVB 3NIFE 3OG6B 4QCIA 1ULVA 4G6FB 4OF6A 4A2EA 5CJOH 4CJ1A 3POCA 1A2YB 3HRZC 4OCNC 3B1TA 2P5WA 1XMWA 2GJ6A 1AGDA 3V79C 1GW6A 1ZDSA 3GMQA 5DD6B 2G4GA 4QHPA 3U7WH 4BFBD 4M5YL 2XA3A 3K4ZA 1JNNH 4M1DH 3HG1A 4B60A 4EF3A 1DFBL 4G80A 3CN0A 4JN2A 5I1HL 2HFEB 1CXEA 1VKXB 1RUAL 5CLZA 3N1QC 1A6AA 1IJNA 2W91A 3QIWD 1KB9J 4P46C 4WHCA 3GPEA 1MAJA 2CDFA 4ZXBD 1SNRA 2VWEC 4UOJA 4OFQA 1CBVH 1TCRA 3KWWA 3EJSA 3ZDXB 4JM2F 3QP3A 1AFVH 4NCC1 1F90H 2C8NA 1LQBC 1UCBL 4KKQA 3TJEH 5JORB 1QLRA 2GPZA 5LCVL 5IMOA 2NY6B 4NQCE 3R18A 3PGFH 4PV8A 1JPGA 3BHBA 4NHCH 2BH0A 4GFXA 5IROA 2V5YA 3ORJA 1SM3L 3O0LA 3QAQA 3EHBD 1U3HB 4BQCA 5KSBB 4P9HL 4CU7A 1CDGA 3ZUCA 3PDOA 4FMVA 5FCSH 3T2NL 3JV6B 3VFOA 2EIZA 3APDA 4K5LA 3BFWA 1QRNA 4J39A 1L5GA 4JBSA 2VKWA 1X9QA 3B1UA 2V4LA 4U1GC 1E27B 5DURD 5J4MA 2WVVB 3EO1B 2NUPA 3JWOC 4DTGL 4HUKB 4M1GH 4BFEA 3N43F 1D5XA 4KJQC 4K9EL 3HPJB 5JNYB 2C9UA 3T6XA 1HILB 1KBGH 1B4JH 1HS6A 2IDQA 3OGCB 1YY8B 2J8OA 1LD9A 4IU3A 3TV3L 1KJVA 4YEEA 4JDTH 2JB5L 2ED6A 4HGWA 1H6TA 3MO1B 3VXQA 5D2NA 5DJ6B 1HHHB 2WQ8A 1RZJC 4ZPTA 1G9HA 4GQ9L 2W07A 5HHNA 4ZBJA 3OPZH 3PHSA 3W57A 1K6QL 2EE2A 4HPHA 5DZPA 2C26A 2A3TA 2CWRA 1U8QA 3GKWH 4PWFA 2CBMA 2GIXA 2WN2A 1I7TA 3A47A 5B7FA 4LE8A 3FUFA 2HJLA 1BVNP 5KW9H 4XZUA 4IMKC 4OFIA 4Z95L 4A67A 1MAKA 4TUKH 4FHKA 1E43A 3HE7B 4MQTB 4J3TA 2WMPA 2JTDA 3FCUB 2DQFA 2D3LA 2Q3AA 5DHEA 2DQTL 4WI2A 2BRQA 1G4RA 1MCIA 4P5KA 3F64A 4Z7WF 4EDXB 4TPRH 4KNQA 3GGWA 5A7BA 3P9WB 2DYPB 3LOWA 1ADQL 4FQHB 5KN5A 3UAJA 1DLFL 4C59B 2AJZB 4JPKH 2EDMA 2ZCKH 5IOPB 2VRKA 3C6LB 2YJQA 4QD2E 2K7QA 3OZ9L 4X9GA 4DK6A 2QQKH 2VDOH 5D7LE 1FGNL 2E6PA 4UT9H 1VFAB 1MJ8L 4FADA 4WTZG 5D1QD 3OLIA 5SWQA 5EU6B 1E28B 4CU8A 5IP4A 4NWTL 1JP5A 5J6HB 1KY7A 1OGPA 4FQXD 4KJQD 1LK3L 3BWAB 3SPHA 4JJOA 2FECI 2E7DA 4MRCA 1S3KL 2BNQB 3UO1L 3FB6A 5IHZA 43C9B 1QNIA 4HJ0D 4WFGD 5CN1A 5E6ZA 2N56A 1IVLA 3X1GA 4JO1H 4MNGE 4QRUA 4DZ8B 1R24B 5D4QA 3TIDA 4M7KH 5FUZL 2ZCZA 3J27A 4YHIB 1BYPA 2JK5B 4QRTA 5CD5C 1YY9C 1RMFL 4R7VA 3ZHFA 2BVUA 2H8PA 4G70B 4E9SA 3QUXB 4Z7AA 5IESH 3RILA 4I77H 1NIFA 2R59A 3C5JA 5T1MB 4DH2A 5A3IC 3MRQA 2APWA 4R5TA 2I7SA 4OCXH 2YHGA 3OQ3B 1SVZA 3OC8A 3HI6H 1RVFH 4D9RD 1AGEB 3OKYA 4UZUA 4WW1B 5KVMC 1HTYA 3WTWA 3L9EA 5D1XA 2ZUWA 1NGZB 2O30A 3E8UH 2ZX8A 1YYML 4N0CC 3R19A 4GIAA 3CZKA 4HA1A 3SYQA 4PJ9C 1ZPLA 2F53D 1FZKB 2O5YH 4ZUWA 4PM1A 1T22A 1RIVH 1CFSA 3EGDB 2BK8A 2H1LM 2ZXCA 4YGVB 1DLHA 4WNSA 2XN9D 3BX7C 4JMNA 3THML 1KEMH 1OP9A 4R84A 1LMIA 5BRZE 5TDOA 4NT6A 2V17H 1QBLL 3GM8A 5I0YA 1EMTH 3MCKB 1P2CA 1A6VH 1XR8B 5E7BA 2AF2A 5E0QA 2PYEA 4HWBH 2VDNB 3FOLB 4ELDA 1PSKH 3UTQA 3FO9B 5ENWB 1DVSA 3HZMB 4UTBA 1MCWM 4XXCA 4BZ2L 2YN3A 2HWZH 3GEWB 4JFQB 4K5MA 1EX0A 2Y0SA 2FK9A 3M17A 2WQRA 1L9TA 3NFPA 8FABA 3LPFA 3SYCA 4EQ2A 1OOAA 4JGJA 3RIAK 2OTPA 4JFYA 4NO0B 3KH4A 3LKPB 4WWKA 5F9WB 3PGDB 1ETZB 1TYJA 4N0YL 4G7SB 4O4YH 2OMXA 3BUQA 3FT3A 1H15A 1N68A 4U0RB 1YY9D 3TZVC 2VKXA 4B9PA 2QADB 1E6JL 4YC2B 5ANMA 3U1PA 1GZHA 5HGBB 5C08B 3LKNB 4M9OA 4JCWA 2CBQA 3IJ7A 5A3ID 4NZFA 3X1BA 4DHLA 1S9VA 3ULUH 1IVTA 3P30L 1HXKA 2FD6H 2FH8A 4XN7A 1EJ6A 4Y4FA 2QHRL 1IIIA 4JM2C 1QPPA 4POZD 1YNTB 3MOQA 4PRPE 2DAVA 4HFWB 1LO2L 4LSTH 3NP4A 3TBVB 4LCWB 4N0CD 4PJDA 4K3EH 3QIBB 5TDPB 1DL7L 4MA7L 1JTOA 3BAEH 2IH9A 4PJ9D 2RB8A 2BOBB 1KYFA 4IU2B 4XNXH 3BKML 1CK0L 3BEVA 4HWUA 3HNTL 4G8FA 2VIRB 1E9PA 5IFAH 2FVNA 3BQUA 3QA3B 1NPUA 3T0EB 2D31B 5F88B 1J8HD 2H0PA 5LQBH 3GMLB 2ZOLA 2F6AA 1NANI 3VU1A 2CBOA 4KPHH 5DZVA 3ZK0A 1NOLA 4C58B 1FLTX 3HUJA 4RLDA 1YMMB 4Y16D 5A2JH 3J07A 2CLZA 1XCWA 2UXVA 4PLJD 2C3VB 2EO1A 3BSZH 2IFGA 4JG0L 3ZYZA 4LPWA 1G9EA 4KRNA 2JJTC 4QEGA 2ENJA 4W4OA 4D9LH 1R9FA 5DZLA 3RY6C 1KJ2B 2FLBT 3FUMA 3PL6B 1VFBB 4MQ7A 5ABZA 4WK2B 5DT1L 4DOHB 1PGRB 1G7IA 3TA3C 1DO5A 4QYOA 3SQBB 5CN3A 2Y7OA 3Q2LA 5JQIB 3HZKA 5I8EB 5H2BA 5LHDA 4LSSH 1FG2B 2XACC 3C5ZA 3FSZA 4XMWA 3TZVD 2KPWA 1HXMA 1C5CL 3J2PA 2X7LB 4MXVF 3ZPDA 4JHAH 3P3TA 4C55A 4NKMA 4CA4A 1KCWA 3NAAH 3O45B 2OMBA 4MXQC 4Y1AE 2ZX6A 4H20H 1NCBH 2IWEA 3BPCA 3NFNB 2MTPA 4FFYL 4RCAA 5IFHH 3VRJA 1MG2C 4PIRF 3PGCA 1TXKA 4Q4IA 4CVXB 4BH7A 3O4LD 4JM2D 4F7MB 1I3RB 1I8IB 1ZJBA 4NZTH 4UDTB 5L4IA 2GITB 1B2WH 4U1MB 4CNIA 3WIIL 1CGSL 3S3JA 1G6RL 4PWEA 3MBWA 2R51A 4JRYE 4PJ7A 2OMUA 4APXA 3LXBA 1CL7I 3H53A 4P8QA 3IS0X 4JQVA 5C2BL 5ETUB 1WAEA 3REWB 4I1NB 2R29H 5CM1A 4OLZL 3DGCR 3NCYS 4FQ1L 2CJTA 4IOSD 4XOBA 1HCYA 3L2LA 4L4TE 1U36A 3E9TA 3EJZD 5C0CD 5I1LA 5I75B 1C9SA 3ZE2F 3GMRB 1KIPB 4HMDA 2EVGA 3D87B 1PKQA 4GUQA 3FTXA 5DRXB 1LEGB 2FX9L 4AGLA 4NOBA 1VSCA 3B2UC 3L3KB 5CMAA 4MD4A 4LHUA 2LV4A 3JTSB 4OZIA 4GAFB 4PBVC 3CVHA 3B2VL 1YG9A 1Z5LB 5DHYB 3IS1X 1SJXA 3AXIA 2X4NA 3GMOA 3TA3D 5LGKA 2VXQH 1C16A 5CHNA 1HZHL 1A7QL 3RVXC 2JB6A 5T33H 4JGUA 4X9HA 1SFDA 3OJDB 4PGCA 4W93A 2Q87A 3BESR 4J3OF 4P06A 1V05A 1E5CA 1J9TA 2WZ6A 3DVIA 4XMVA 3LNEA 2GIYA 3EGSB 3U0WH 1NDTA 2YD5A 2Y7QB 3QDJA 4IDJL 4X6EB 5DD0H 2YEVB 3IFLH 4HWNA 1QD0A 5CKGA 2ROYA 3WE1A 4JREC 1OSEA 1I53A 1KXVC 4MXQD 5E94B 1OD7A 4PRID 1E6OL 5KYUA 4XWGH 2G3NA 3C6EA 3WOVA 3FTGB 1ZT1A 1XGRB 4PBWD 4PY8I 1IGFL 1ZT4B 1BZEA 1AD0A 4BK4A 4P2RD 1A7NL 4WEBL 1NEPA 4LLVB 2NOYA 1G87A 4PSPA 1KGJA 5E2VH 4UAOB 3F58H 4R8WH 3NIGE 3CZNA 4GRWB 1RK1B 2Z31A 3ZHNA 1NZRA 1MI5A 1DVUA 4GMTL 2J8UA 3VFSB 4GKSB 5GS0H 2CGRH 3K6SB 4WDIA 1QSEA 5IZ7A 4G9FB 3DTXA 3N06B 3ZDXF 3MA9H 3P4NB 4HGMA 5HXMA 4UDUA 2XETA 1RV6X 1IGJB 2DQCL 1NDMB 1E50A 3UTSE 1VAHA 3FK3A 2PXYC 2ZSVB 2DV6A 2FJHB 4ZW7A 2BERA 4NHUB 1SBBA 3O6KL 2B77A 3WFDH 4NLHA 5DC4B 1F3JA 4LASH 2VXTH 4A2GA 3B2UD 2GCYA 1FNGA 4R2GB 4AENA 6TAAA 5F7UA 1AXSA 4RAVB 4ELKB 1BJ8A 2WXOA 2RALA 3TBWA 5KSBF 3ARPA 2YN5A 3KAAA 4NO5B 4XO3A 1AS7A 2NNAA 3DLQR 4QXGH 1MFEH 5IVXE 3RVXD 1H0DB 2HKFH 5F6IC 4DVRL 3WTVA 4RMTA 1FFNB 1ZGLM 4NENA 1OAQH 3IE4A 3QZBA 4Z6AT 1CFTB 1SF5A 2LGNA 4OI7A 2EO7A 1WD9A 3HW7A 3VFVA 4PWGA 1HE8A 4G7VH 4YFLF 2OJEB 4RMQA 1EZLA 4HS6B 4NOFA 5DU7A 2QKSA 3MLPA 5I1GH 2VC2H 3RRQA 4YZFF 3KPSA 4W1TA 4FFTA 1CLCA 1JGLL 2W65A 1QWUA 1D5MA 3QFDA 4HC1L 2ARJA 2IBZX 1P1VA 3QI9D 1KGIA 5CJQL 2VO5A 2AQRA 1CDCA 4PRHD 2ARWA 3PG2A 4ALAH 1XF4A 1HVXA 1R4XA 2R39A 3GBNL 3KYMB 4N28A 2WAQA 2A9MH 4YHPB 5EWIH 2Z65C 1AR1C 1X9LA 2EE9A 5I0DA 4PI2A 5J12C 1F11A 2PYFB 3SE9L 4ODHL 5LGJB 1NFDB 3EO0B 1P5VA 4ZX5A 2X4SA 1ZDQA 5DJXB 2PLTA 7TAAA 5C7XH 3Q2CA 5F89A 4FQIL 4CN4A 2CIIB 4FG6C 4M6AA 1M56B 3FN9A 4U6YB 2WQVA 4KZDH 2R7EB 3EYUH 1MCPL 2PXYD 4JG1H 4BFIB 3W5NA 1A5FL 1Q0XH 3NH7L 1PFCA 4RA0C 3V8CA 4XXWC 3ARZA 3N2JA 2XKSA 4GAJL 4FXGA 3UC0H 4GW4A 4ABUA 2CK2A 4YXKH 2E47A 5F6HJ 2WP3O 3WIFB 4ZW5A 3T8XA 1TVBA 1V3LA 3UPAA 4XCYB 1MZZA 2Y24A 5T5NF 5IM7B 3QQ9C 1X7QA 1Z5YD 3BXNB 2YKLL 3O3DB 4YSDA 3SKOA 5ID0A 5IV2A 3VFWB 3P4MA 4NJ9L 3X1EA 3ARBC 4XB8A 2ORBL 2H2SC 3CAFA 4ANWA 4OFDA 2DYRB 4LPYA 4Y2DC 1KTDB 5AL8A 4L3EE 3PWNA 3RWFA 1MFAH 3FO2B 5IY5B 1MPAL 3KBHE 4PJBA 5E9DA 3VRIB 2PABA 5LAPA 2JI1A 5DJ0A 3REVA 2JXMA 4HLZH 1OXYA 3RFZA 3G5YA 5ESAA 3BVDB 5K59E 2WBXA 1TJMA 5DDHA 1QYGH 2HVJB 1G7LB 1KPVA 1KGUA 1H9VA 1JHKL 4KQ4L 4TQEH 1P4IH 2OTUA 4FNRA 3O9WB 4TQHA 4OQTH 4DP0X 3ARFB 4M93B 1NA8A 5D5MF 4MJ4A 3KW8A 15C8L 1F1GA 3CLEL 2HG0A 3G04A 3LZQA 4I1RA 4QRBA 5C0BE 1EHAA 2MQ0A 1HH9B 2QBWA 3WLBB 3CCHA 1AXIB 4JM0A 4PFEA 3GNMH 4G8GE 4Z7QE 2A83A 1U21A 4HFUL 1ZV5A 3MJ9A 3T4AC 1XGPB 1QQDB 2BIQA 4FG6D 3FTZA 4RFNC 5TE7H 1V3KA 5JYLA 1F4YH 1C5BH 1TDQA 3RUGB 5ISZB 5I18H 2CMRL 2P42B 3RGVA 3ZYJA 1I8AA 1K8IB 3FFCD 4HJTA 1BPLB 4G6KH 3TN0D 3X11A 3QO1A 4OLVL 2L04A 1OAYL 4Z0XB 3W2DL 1F41A 1T5XB 3EOBA 4R0LA 2WJ7A 5FGCE 1MH5B 4LEOB 1ED3B 3QUZC 3QXAB 2XPZA 1N3NB 3SPCA 2E7BA 4FYTA 4MMZB 5DJCA 4YHKH 5J1TC 3UPRA 4K15A 1QFHA 4J3OC 3TYFA 3ARBD 3L2NA 4OW6A 4QXUH 2H2SD 4N5EC 1FP5A 5I30L 2YUWA 4Y2DD 3MLUH 3VXMD 4HIHB 3VACA 2Y9RT 1T66C 2EIEA 2ZOWA 5JPNC 5T1LA 4BFOA 5LWYH 4KKPA 5CIPB 3QXWA 1UGKA 4MA8L 1DSFL 5TQ0L 3RDTD 4XPGH 2ODIA 4NNYB 4N87A 1NGWA 1XHHA 4A6YH 4F37K 5DMYA 3S5LB 3AU0A 1IGTB 1QR1B 1D9KA 1A7RH 2DKUA 3IK2A 4O58H 4PH8A 3IYLW 4I1PA 3HE6B 3UDWA 2IH1B 3EADA 3PQYA 4ZAKA 2L0DA 4NUJA 2F54A 1S7VB 4YQXH 2F0CA 2G5UA 3I02B 5PCYA 3KWXA 1GGIH 2EYSA 4NQCA 4A2DA 4XO5A 1ZPUA 2YIHA 4O9HH 1S9WA 3IE9A 3UBXI 1YNTF 1IU1A 3N55A 4DFHA 1WISA 4Z7VA 2YZ1A 3B34A 3CVCA 5DO2C 3RZCA 4X80L 2OX5B 1I4FB 4AK1A 3WAJA