1SF3A

Structure of the reduced form of the p94a mutant of amicyanin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTAHPFMRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Studies of Two Mutants of Amicyanin from Paracoccus denitrificans That Stabilize the Reduced State of the Copper.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
molecule keywords Amicyanin
total genus 27
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2004-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1sf3A00
4DP6X 3WG7B 2UXVA 1VLXA 3AZUA 1OE3A 1KGYE 3SBRA 2J57A 2P80A 2IH8A 3FU7A 4DP5X 1L9TA 2X88A 3NJLA 2XXFA 5I6NA 3UACA 1A4CA 3S3BB 2AVFA 2XV3A 3SBPA 3N2JA 1E67A 1GS8A 1GSKA 2UX7A 1ET7A 3CZUB 3NSFA 3MBWB 4GY4A 3CVCA 1BAWA 1MG2C 3WI9A 1A65A 2FQEA 2EIMB 2VW4A 4DP4X 4DPBX 1AQ8A 2BHFA 1NICA 1WS8A 2EILB 1X9UA 2XX1A 3CG8A 1SF3A 3CVBA 3T9WA 1OE2A 1SDDB 1V10A 4G7SB 4L0PB 1RZQA 1IUZA 1FWXA 4BDVA 4F2EA 1JZHA 2YQBA 2HLEB 2PPEA 1GY1A 3EH5B 1PNCA 2UXFA 3NSDA 1OF0A 1IBYA 1CYWA 4ZK8A 1XB6A 1SFHA 4KNTA 1ASOA 4GP5B 2HRGA 1SJMA 4KO6A 2IDUA 2GIMA 4ENZA 4BK5C 3QQXA 2FT6A 3QJSB 3T71A 1TKWA 1NIAA 3NP3A 1QNIA 4TXVB 1F56A 5FC9A 2GC7C 1J5CA 4YSUA 1BQRA 3S3DB 1L9RA 2HX7A 2PCFA 1AZRA 1T5KA 4DP8X 1WA2X 1I53A 2BP0B 5B1BB 1TU2A 1BYPA 4UANA 5ANHA 2PP8A 4BWWA 4YSAA 1JVLA 3NSYA 3X1NA 1M9WA 2R7EB 3PLYA 4DP7X 3X2QB 5F7BA 3IBOA 3PAZA 2FT7A 4HIPA 2PPDA 4E9VA 4GYBA 2GB2A 5I6LA 4WKXA 1MZZA 1J9RA 4UAHA 3FSVA 4HCIA 2YAHA 2Y1AA 4BDVB 1L9SA 4BXSV 1OCOB 5B1JA 2PPAA 3OM3B 1MG3C 3UAAA 1YLBB 4KO7A 4DP1X 1AS8A 3ABGA 3H4HA 1URIA 2BZCA 4A67A 3D12B 1BXAA 3ZX1A 4YSEA 7PCYA 2EIKB 4BWUA 1GY2A 4E9TA 2QPDB 1PLAA 4JHVA 1BQKA 1KCWA 1WS7A 2BO0A 2PPFA 3WIAA 3T6VA 3NP4A 1JZGA 3AG2B 3N55A 2XWZA 1NZRA 3OMAB 1DZ0A 2BZ7A 3OD3A 4YSQA 3NYKA 3OQRA 3BVDB 2GBAA 4X4KA 5TK2A 2XXGA 1PZAA 2DWTA 3MX0B 4M4RB 2I85A 1OV8A 2CCWA 2X87A 3ABKB 1QLEB 1CURA 2FJSA 2VM4A 5B7FA 5I6MA 2IWKA 1GYCA 1JZJA 2ZXWB 3FQ2A 3OMIB 1AR1B 1AG0A 1JOIA 1HAWA 1NPJA 1EZLA 4QKTA 1HAUA 4CSPA 1AIZA 1AS6A 1ZIBA 3FSZA 1E5ZA 2Q5BA 1JERA 2CJ3A 4A2FA 3PAVA 4YL4A 4Q89A 4F2FA 2JFCA 5AFAA 1JXFA 5I5JA 3GDCA 4HAKA 2BW4A 3U25A 2QDWA 4W1TA 2IWFA 3NJFA 1A8ZA 3GXUB 2HX8A 1AOZA 4KO9A 3SBQA 2YAPA 2CUAA 1PNDA 1W6LA 2JKWA 4N4YB 2J5WA 4JHUA 1V55B 3L45A 1ASQA 2EINB 3CDZA 1TEGA 3EH4B 3FSWA 5PAZA 1B3IA 4YSSA 1ZDQA 2E86A 1KYAA 4G71B 3ABMB 5B1JC 3UAEA 2I7SA 2CAKA 3ASNB 4HHGA 3T6XA 3PXLA 4A2EA 2HZHA 4P5SA 1NWPA 2DY2A 5D4HA 3UADA 1WA1X 2QDVA 2GHZA 2CBPA 5I6OA 2PPCA 1AG6A 2BWDA 2VN3A 3GYRA 3NJNA 4DP9X 1PLBA 1IC0A 1L9PA 3DIVA 3AG1B 2OJ1A 2XV2A 3FPYA 3ASOB 3NJIA 6PCYA 4AI7A 1KDJA 3QJQB 2YAEA 3QJRB 1PZBA 4E9RA 2OCCB 3FU9A 4BXVA 2BW5A 2IDTA 5I5MA 1AANA 2VW7A 3X1BA 4P5RA 4YSTA 1XB3A 3SQRA 5AKRA 2Y69B 3WNIA 1J5DA 4YSCA 2PP9A 4YSRA 1N70A 2DYSB 7PAZA 1E5YA 2BP8B 2HXAA 4DP0X 1PF3A 3H4FA 1A4AA 1ID2A 3EH3B 1ZDSA 1SHWA 5PCYA 3OMNB 3X1FA 3DTUB 4HCGA 2YXWA 3CVDA 1NDTA 2WO3B 3TA4D 2PP7A 3FT0A 1A3ZA 3FYIB 3TU6A 4A68A 2MRYA 1BEXA 2XUWA 1CYXA 3PCYA 4YVUA 5D4JA 1ILSA 4EF3A 4YSDA 3X1GA 2RACA 2I7OA 4GXFA 1TEFA 1FA4A 4W9ZA 1A4BA 2HX9A 1ASPA 3FYEB 2ZWNA 4AX3A 2YAOA 1BYOA 1J9TA 2VW6A 3FQYA 4YVNA 2YARA 1E65A 1WAEA 2WO2B 3S3CB 4E9QA 1NIDA 2H5UA 2XX0A 1BXUA 3JTBA 4GP8B 1AZNA 1OCRB 4PCYA 3WKPA 3UGEA 1JZFA 3ERXA 4M3HA 2DYRB 3G5WA 4KO5A 2LLNA 1GS6X 4E9YA 2IH9A 2FTAA 2XLLA 4NERA 4YSPA 1RCYA 3FQ1A 5LDUA 1GR7A 4PAZA 2TSBA 4FA7B 4A2HA 1AZCA 2JXMA 3X1EA 2P80D 2NRDA 3AG4B 3NJGA 3WKQA 3HB3B 2AZUA 1HFUA 2AZAA 5I6PA 2XVBA 5B7MA 3PPSA 4G70B 1NTDA 3QJVB 4E9SA 1EHKB 3C75A 3JT2A 3IE9A 1ZIAA 2FQFA 3QPKA 4E9WA 2DWSA 3RYMA 1KBVA 2WSDA 1XMEB 4GP4B 1ADWA 5I26A 3NJHA 2FQDA 1OCCB 4QLWA 2H47C 4K9JA 3TASA 1CUOA 2UXTA 1NINA 3V9CA 1SHXA 2UXGA 2B08A 4A66A 3NSCA 3IN0A 3PAUA 1W8EA 4MFHA 3FSAA 1MDAA 2J55A 3ZDWA 1ET8A 1KCBA 3AY2A 2UX6A 5F7AA 3NJJA 2VMJA 3V9EA 1FFTB 1ETJA 1XB8A 1ZV2A 2H3XC 3NT0A 1ILUA 4E9XA 3FU7B 2IAAC 4G7RB 3DKHA 1NIFA 1NIBA 1L9QA 8PAZA 5I5IA 4F7KA 4NAJA 3CDZB 2YXVA 1ET5A 3IEAA 1JXDA 2PLTA 2TSAA 5I6KA 3NJMA 1RZPA 2XU9A 1PMYA 3S8GB 1ZPUA 2GI0A 2AFNA 2XV0A 4YSOA 3S8FB 3IN2A 1MZYA 1PAZA 3H56A 3EF4A 3AG3B 1NIEA 1UATA 1OOWA 5D4IA 4UF7C 2ZONA 3QJUB 3KW7A 1KDIA 5AZUA 3T6ZA 4AKPA 4HALA 4AZUA 4HZ1A 2MTAA 1SFDA 4DPAX 1AZBA 2J56A 4G72B 1AZUA 1BQ5A 3NJKA 5E9NA 2YAMA 3UABA 1OE1A 4KOCA 3EHBB 1PLCA 1IKOP 1W6WA 4CSZA 3TBCA 1SF5A 2BP0A 2IDQA 2Q9OA 1PZCA 4KOBA 1JVOA 3KW8A 4KNSA 2N0MA 2IDSA 4WTQA 3FPXA 1AAJA 2PCYA 1R1CA 2AANA 2FNWA 2BWIA 5B7EA 3TBBA 3FS9A 1JZIA 2IWEA 4Q8BA 2VSKB 2YAFA 1JXGA 4G7QB 2W88A 6PAZA 2BP8A 5B1AB 1IBZA 1AS7A 1NPNA 2W8CA 5IY5B 1DYZA 3HEIB 3BQVA 1NWOA 1QHQA 1KBWA 3ABLB 5B1KA 1E30A 2IDFA 2XYBA 4HCFA 1JZEA 1CC3A 1M56B 1X9RA 2FT8A 5B3SB 1SNRA 4NB7A 5TK4A 4DP2X 1AACA 2GC4C 2HRHA 2QPEB 2ZOOA 1J9SA 9PCYA 2FWLB 2CALA 2YAQA 4N8UA 1OCZB 3T6WA 1V54B 4KNUA 2A3TA 2VSMB 4AKQA 3WNJA 1N68A 2QT6A 4FAAB 1GS7A 1GW0A 2B3IA 1PY0A 2DV6A 2GSMB 4RH4A 2R7EA 1L9OA 4HHWA 4A2GA 4A2DA 1J9QA 3ZBMA 1KV7A 1RKRA 1SDDA 2FQGA 2VM3A 3AW5A 5I28A 3QJTB 1WA0X 3FU8A 1PCSA 3ZIYA 4DPCX 5EHFA 1BXVA 4AKOA 5A7EA 1M57B 4BWTA 2OV0A 2EIJB 4JKNA
chains in the Genus database with same CATH superfamily
5LJYH 3GMQA 1JI2A 4FQLL 1KCVH 4AG4H 1IT9H 4JDVB 4Q6KA 2HLAA 4Z7UF 5LB1A 3P77A 5C0JA 1KCVL 3UC2A 2BXZA 2EDKA 1DJSA 1CLYL 1QQDA 1X5XA 4HZLB 3H9HB 3ME0A 3DWTA 4JGJA 5D7IF 1IM9B 3GPSA 4JO3H 1GC1C 1X7TA 3ARED 3ZUNC 4U05A 5IUCA 1FZOA 1QRNB 2X0VA 4XCYB 2DQ6A 2X4NA 2J6EL 3DETD 2EDLA 3SGEI 2UY7B 3DUHA 1AHKA 2BX5A 5EU6A 2FEEI 3F5WA 3QS3A 4A38A 1ZA6A 2GBVA 2UY6A 5MEPB 1SDDB 2D9QB 1HNYA 4ZQTA 3M86A 5EU3B 1E5CA 4HJIA 2K7QA 1T5WA 1RHHA 4JPQA 3RTQD 5M94B 2CGZA 2BDNH 3HJEA 3GI9H 1JZHA 1Z5LB 4ZMOA 5E1AA 2IO5A 3D48R 4R4FH 2XFGB 2XXMB 4P4RB 3RL1A 3GMPA 1NCWH 1UUNA 3ZSTA 1P7HL 1UFUA 4IBSA 4QAMB 4X0KA 4B9IA 3IF1A 1NAKL 5CSGA 2R2HB 4HETA 3DVNA 5DJ2B 1FFNA 1AQMA 3MNVB 4RISH 4RFEA 35C8H 3FN9A 4N90E 5E8DH 1CL7L 1H9VA 4NSKB 1ZLVK 4KZEL 2WWMD 2I9LA 3C5ZD 4P5KA 5IQLA 4XMZA 2CRZA 5TJWK 3WXWL 1A64A 5ETUB 3KWUA 1T5KA 1IFGA 3QI9A 4X9YA 4DP8X 5A2JH 3NCCB 4PY7A 1LMKA 3ASWA 4GKNA 4OV5A 4GB9A 4PJ9C 3OZKA 2AAVA 2LVEA 4GAGH 4U4IA 2Q0ZX 5LHDA 5MENA 1M9WA 2LHAA 5KJ7E 1EANA 1XAKA 1FH5L 3MOAH 3WTTA 1Q72H 5FKAB 2FX7H 5F6IC 5F96L 2CKNA 4FKKA 5G5DA 1IQWH 4ODUA 3AB0C 4H0IA 1YEEH 1BIHA 4M8UA 5DU7A 5CM1A 4XPFL 3BW9A 3MA7B 2EVJA 3OZ9L 4H26B 4S1RL 5EC2A 3VGBA 4D0CB 5L4JA 1KYOK 4NPJA 5CJBA 5DLLA 2VQTA 3L7EA 1S7RB 5HI3C 3QHTC 4AH2A 2Z7ZA 1OCOB 1AXTH 5DUBA 1MIMH 1IE4A 4TL5A 5ISZA 3Q8CA 4K94L 2BVUA 3G5XA 2DQDL 2WBKA 32C2B 4NQEB 3DRTB 1ACYL 2VLMD 4OCYL 4X7EC 4Y16A 5C0AA 4IRZL 1ADQH 1VF5C 3TJEL 2P8PA 1BBJB 2AKRB 3H7BB 1SY6A 3BE1H 4HIEA 3MRGB 3B9KD 4Z0XB 1EPFA 2LABA 2B14A 2J21A 3L95B 4QPEA 1WO2A 4NP9A 3BZFA 1JZGA 1HI6B 1N8OE 1N59A 4OQTA 5C0NC 4PJXF 3RWHA 5IEKA 3Q6FA 1KXTA 3ULUC 2DLHA 4JFVA 1I1AD 2GBAA 3TA3B 3VXRE 4JFPA 2MKLC 2V5SA 3FQRA 4G3YL 3HIZA 2DIJA 1UURA 2VM4A 2FSEB 3OC5A 3C6SA 4YDLB 5B7FA 1JZJA 2AAAA 2BNUA 2HLFD 3DGDA 2Z31C 3NZ8A 4ACTA 5JXEA 1HSBA 1VKXA 3OMIB 4QF1A 5K39A 4I3RL 1YEJH 3CZLA 2J43A 3RI5K 5I1LB 3VTAA 1DQML 1FL3A 4F33A 2IJ0C 1QO3A 1YY8B 3KCPA 4AK1A 3LKPB 3DMMD 5DJZB 3J27A 1AHWC 4KK6C 4EJ1C 4P2OD 2HKHH 1O6VA 4FYRA 4Z9KB 3OL2A 5E9DA 4KNQA 2FJFB 3PJNA 4U1GB 2APSA 4PGBB 1E90A 1G6VK 1ZT1B 1J5OH 1MXDA 3GZPA 5ISZD 2DQHH 4ES8A 5EEVA 1J0IA 4JO8A 1ONQA 4X80H 1JNLL 4IOFC 3MO1A 1G43A 2F53B 4K3JH 1H15A 2HG5A 2Z91B 5HGAA 3D25B 4CRPA 1TZIA 3U1SH 1Q8MA 1S78D 2V7HB 3MLSL 5T1LB 5PAZA 2QV2A 3VSUA 4FJ6A 3HRZC 1AGBB 1BFVH 5H37G 3HG1E 2ZSWB 3ZTCC 2V2WB 4XBGA 3L81A 4MX7A 3IT8D 5DQ9B 5B39G 3FCUB 1BJ8A 3WU1A 4FI7A 1DSFH 2H1XA 3NIGF 2L04A 4FN0A 3T04D 3TL5A 1F1GA 5JTWA 1IFHH 1JFQL 2UZXB 3RFZA 4LLUB 1WA1X 5CN1A 1T04A 5AD0A 3N04A 5J8OA 3VQLA 5IJBC 2H3KA 3GSQB 3LN4B 3WJMA 5DUML 2YQ3A 2VR4A 3QWNA 5E2VL 2B2XH 2F68X 1G0DA 3AG1B 3RWCA 4JPKH 4PB9L 1TQBB 3FH8A 5HHNA 2J88L 5DLMH 2JCCF 3CXDH 2AXJA 4KU1A 3GHPA 3QJRB 4ISVA 1SZNA 3MUY1 3TGXA 1WAAA 2VLKA 3F6JA 2JCCE 3RY5A 4UQ9A 3QQ3B 3SE4A 1ZLSH 3SJVB 4LQFL 2OK0H 3RGVD 3IAGC 1MREL 1XEDA 2NY2C 1KB9J 3MUHL 5DS1A 1AANA 5LWYH 2DD8L 4TLKA 4PRIE 3MRLB 5JXAH 2EDXA 2XN9E 4KRLB 2VUKA 3MBED 3MCKB 4Y5YB 1XB3A 5IB4B 3QNXB 4EI5A 3GBEA 3EDDA 1E5YA 3MLXL 5EEYA 1FGVL 2OJEA 4JPVH 3RWEB 4JO1H 4DP0X 2EO9A 3V95A 2BHUA 2Z4QB 1XEUA 4CKQA 2YBGA 4G6JH 4R8WH 1SHWA 2VZ1A 2BZDA 2HJKA 4LPCA 3OC8A 4X6CB 4YFLF 4UV4H 2WO3B 4NP4H 5D96C 5LAPA 4R84A 1A3ZA 3EDFA 4CMHB 3R4RA 5H37H 5D96B 4B6ZA 1TPXB 5D4JA 2Q6WA 2EADA 1NFKA 1FRGL 5ID0B 3EF7A 5KVEE 1U95A 1BIIA 2VQUA 4JCMA 5CCKH 4BH8B 5HYFA 4AEIH 1DSYA 3KGRA 5CF3A 1IEAB 4KZDL 1A7QH 4A6YL 3DX3A 4G80A 1NBYA 3WIHA 3ZDZB 1NIDA 1XHHA 2AXWA 2ZWSA 5F88A 2NZ9C 4LRNH 5DQJB 4HCRH 4ENED 4LRNL 4PJGB 4XWGL 5TQ2H 5CEYB 2K6YA 1NOLA 1YPZA 3TZVC 1RCYA 4OLZH 1CICA 3WKNA 2SEBA 1U3HC 3AG4B 2OMZB 3OGCB 2BNQA 2OQJB 1WITA 2QJDA 2VXSH 3UYRL 2E8YA 4FQPA 2Z35B 4XCCL 5EB9A 4HOXA 5A16A 1A7BA 4PY8I 1Q4NX 1TG8A 1IILE 1T5XA 3QJVB 4XMPL 1ZHNA 4KDTA 4EUPG 5I66B 3K74B 2XQ0A 4HWEL 2JCWA 4LSPL 1ZIAA 3D0LA 4JUTA 1MFEL 5ADPH 5MENE 1WZLA 5DZAA 4RAVB 4GI9A 3V6OC 3WFEL 4DEUA 3VD2A 4KTDL 1T7YA 4FQJH 2FQDA 2EZ0C 2XQYG 2ZUQB 5E5MB 4AJVA 3EJQA 3BAKA 3WMSA 5F0LB 3IDJB 4ZZFA 4LSQH 4YPGA 2Z64C 1YVLA 5HI4D 4PHXA 4PWJA 3PV7A 5FYJE 1H6FA 3MLWL 1LO2H 2OMVA 1SDYA 4LBEA 3KM2A 5F89B 1S9KC 2DQTH 1QEWB 1RMFH 3RL1B 1NCBL 1UKQA 4GMSH 3CVHB 2YZ1A 5E1HB 3VFOA 4X5WB 4GW1A 4H8QA 2FJFA 4IRJA 3SGJC 1OTSC 3FQWB 3G04A 5DRXA 4GIAA 4U6VH 1ZT1A 5C6TH 2IAAC 3ML9A 3P11L 3JXAA 4AJYV 1FV1A 5C6PB 4R3SA 1E5BA 5DFVD 4ZD3L 4P9HC 4KKBD 3KGTA 1MCWW 2IQAA 2AJXL 2AS5M 3KBHE 4OY9A 1YJDH 1ET5A 1JVKA 3VFNB 2PW1B 2FLRT 3CC1A 1U8OA 3BWZA 1MFMA 1LEIB 1RZPA 2BNRE 4UQCA 4J3OH 4KJYA 1XTMA 2A9NH 4JVWA 5T3ZH 1XSJA 2AQRA 5CINH 3RPIB 3D9AL 3NQIA 1P5VB 4EZLA 5IZ7A 1OOWA 3VG0L 4DN4H 3IWVA 1E28B 1EAJA 2FRGP 5CLTA 2ZOLA 2QADD 1FFPB 5CR8A 2HVKB 4L8SB 1J8HB 4L4VA 1QSEA 3GHBL 1IAIH 4UTCA 5C6WH 2X12A 2KBGA 1MQ8A 3BEVA 1MFCL 3TLRA 2XWJB 2WQXA 3DRTA 3KL5A 4F3FA 2ZUXA 4NQDA 3TBCA 5C1MB 1SJHA 4FJZA 4FG0A 2Z8WC 2P7TA 3BKYL 3HW7A 3RTLA 1S7WA 5K69A 3IU4H 5C07A 1FLRH 4BEIA 4C55A 2WWKT 1JYXA 1SHMA 1J1XL 1GOGA 4YUEL 4FQ2H 1WCBB 4RFNC 3VDCA 3RWGA 4G83A 1RZGA 4P48A 3EKCA 2PCYA 1FORH 1KV3A 4C54A 1UACL 1G7HB 3NDZE 1A7RL 3N6YA 4IGBA 5F8RC 5LBSA 2VDRB 1ZHKA 2IH1A 4HJJH 4WHTA 4JDVA 1OAQL 1KBWA 1A4JB 1ORQA 1CFTB 2JKXA 3QDMA 2DLIA 3FFCA 3N41B 3WL9A 2AJZB 3WFDL 4ZFGH 3MRCB 5I23A 4LVOB 3R1GH 4ZDHB 1MF2H 1MHPH 3C08H 1CC3A 4B9GA 3O81A 1SJVA 4M8RA 1PZ5A 2CALA 2FHCA 3HNTL 3K6IA 4AKQA 5D8JL 5C8JB 2Q7NA 2UY7A 2A6IA 3GXPA 1ACYH 4OCWL 3E80A 3C2AL 4LFHD 4B95C 5A40E 4ZZKA 2OTUA 2VDOB 1NBYB 1D6VH 4CADB 1T03L 5BW7A 3QB7C 4NUPA 5IK3B 3W0WE 3FTUA 4KWUA 5F21B 2DMGA 5HVFB 1A3LL 1FFQA 3S34L 1YMMD 4UCFA 1TDQA 3NRQA 1JXJA 1TCRA 2A83B 4F9PC 4YQXL 1QW8A 4X5LA 1PG7L 1XIWD 2D03H 3BAWA 3WE6A 4CVWA 5DD5H 5KJ4A 3H2QA 1IGJB 3SDAD 1KTJA 1QSFD 2DYPD 4G1MA 4LLMB 4DP6X 5IW3A 2VIRA 4ZFZA 1KPVA 3BYTA 3P3TA 1VLXA 2NXYC 1IGTB 3GMNB 2YN5A 2NT0A 4ONFH 1UYWL 1HTYA 2UWEE 1L3WA 3OBAA 4QJ4B 4Z7UB 1LWRA 4DQOH 3S48A 1CXKA 1MIEH 3CN1A 5TH2A 5D9SB 1EO8L 4Z7WA 3QIWC 5HI5D 1YQ2A 5DJCA 3U1PA 4RA0C 4FG6C 1DTUA 3ECBA 1OAUH 1JMZA 35C8L 1H3XA 3MRNB 3LKNA 2UX7A 3TNNA 5HHOA 4HT1L 1N10A 3QIUA 3VVWA 1S7XB 4NZUH 2CE6A 2F54D 3LQAL 1N7MH 2AK4E 4Z3JA 3DA0A 4EXPX 4NOBA 3JUZA 3SDCD 4ZRGA 2J6WA 4OZHB 4J3BA 4KPHL 3FO9A 3LRLA 3O41B 4X42A 5ITBH 1YDPB 5E7FA 3PDOB 4BDVA 1USZA 1UM4H 1JE6A 1CXHA 3LXCA 3QNXA 5T5FA 4HEPG 1NEZB 5MEQB 4AEFA 5KSBF 1FE8L 1FHNA 4R7NB 3DTXB 4WI8A 4K8RD 1XF5B 1U8QB 4S1QH 1S3KL 3TYFA 4H44C 1QNIA 4G6KL 2P5WA 3ARDC 5KYUB 3S96B 3VXMB 2CJUL 2WBJD 1L9RA 5JDSB 4PRBB 4TVPL 2WKOF 3CNKA 3REWB 2EO7A 3RKDC 4NBYB 3K46A 3L3DB 3OZLA 3P3SA 1CIDA 1XGRA 2VDOH 4IS6B 4BWWA 4FABH 2NY1B 5JYLA 2ZQKA 3IBOA 4M56A 3H1ZA 4GRMB 1CLZH 3V0WH 3POHA 3RPIA 1R46A 2X2HA 3KH4A 1B2WL 4WKXA 1MZZA 5HGDA 1P7BA 2YD5A 1FO0A 1BD2E 1RJLA 1Y0LA 1KYUA 2WOYA 3ALWA 3DUUB 5E7BA 5L4FA 3N5AA 5TFSL 3B43A 4BXSV 2WXFA 1KXQA 4WEEA 5FGSA 4JQIH 2Z34A 4XBEL 4JGMA 2YSSA 2UV3A 1E9OB 3B2DC 1C5CH 1LD9B 3KYMA 1MFUA 1XH2A 2NSXA 1AKJA 1Q9OB 3F2LA 3OLIA 2WK2A 1OSPL 2ZX7A 3GWJA 3QXWA 3ZT6A 3QJOA 3C5ZA 4N2NA 2M1KA 2PTTB 5ITBL 2EH8L 1C08B 3F7LA 4RDBA 1UH3A 4N2AA 2BO0A 1KY6A 4A37A 3T0DA 3NP4A 3RWGB 3VFWB 2NX5A 3B9DA 3DXAA 3A67L 2A5UA 3NYKA 3S37H 2VRKA 4AOFA 5ALBH 1D5BB 3ULVF 5JPNC 4F9LC 2DWTA 3DJTA 1MOEA 3WD5H 8FABA 3V0EA 2JIXB 2OXGB 5I1HL 4B7IA 3M7OA 2O4EA 3DHPA 4R0LB 3SE3C 4YJZL 3U83A 1ZRUA 2DPKA 1IAIM 3HE7D 4Y2DC 3MRCA 4QKTA 2HTLC 2VLJB 3CH1A 4GG8B 1V3MA 3E3QE 3QXAA 5KYXB 2X1XR 1CS6A 2XBTA 3NJXA 1YNTA 1S8DA 3PGCB 2NUPA 3AADB 3GDCA 2VXQL 2GY5A 2YUWA 3VFMA 3CVIL 1MUJA 3BOVA 1MJJA 4KY2A 1RVFL 5LXGL 5D7JC 1RZKL 1SEQL 2VLKB 2B59A 1IBGL 4YPJA 1A9VA 2VDNL 5DZVA 4I13B 1TFHA 5MI0B 1NCAH 1OSZB 2EINB 4G6AC 2AQ1A 1FPTL 3BLBA 4CDGC 5FO9B 1IV8A 1CDBA 1H5BB 3KPTA 3VFNA 3K91A 3VFSA 4Y4FB 1AYOA 5EPMA 1FHGA 4ZXBB 4P9HH 1DBKH 1I1YB 1AGFB 3IXTA 5KZCB 5L2KB 3FUEA 3KWTA 2AP2A 2V4LA 2EEDA 3HE6A 2OZ4A 4S1DD 3HVNA 2MPVA 4GW5A 5KS9E 2GJJA 4OZIF 4TUKH 2OW7A 3C08L 5I9QC 2FBOJ 4LCYB 2WZ6A 1BX2A 1FZMB 2ZOLB 3WFDH 3UBFA 2PPCA 2E3VA 2UWEF 2GJ6B 5CHNB 4OD2B 1B4RA 2ZXBA 5TH2B 4Q9RH 2A6KA 1IC0A 5D1XE 4R7LA 4UM9B 5GZNA 1L9PA 3CMOL 3DIVA 4FCAA 2OJ1A 2BFVL 1R24B 1JHLH 3NPZB 2DWEA 1F3JA 1I7TA 1YY9C 3IMSA 1A2YA 4LASL 1UACH 4S0HA 4QRTA 1DBMH 4UM8B 3OX8B 2X4QA 4FQXC 4N8VB 3UTSA 3VSVA 4HDIB 1X5MA 4HGKC 4YNYA 4ZTOL 4KI5E 5EBMB 4Y1TA 1MAKA 3IU4L 3Q8AA 5D5MA 4EPSA 1BEYL 1TZAA 2UVEA 3HFML 3HRPA 3QZLA 1AHWB 1BG1A 2IFFH 5TPWH 2WJ5A 4XVJL 4D9RD 2K45A 1KZYA 4NENB 5L4MA 1XCTA 1WFNA 4ZAKB 2E7CA 2YUZA 4PJAB 4PMEA 3SO3B 4ZMNA 1F3RB 4W9DC 4OIIL 5FYLD 3JWDL 2I69A 2CLVB 5CBEB 3AVEA 1H6UA 3MDJA 5HDRA 1FIGL 2IXQA 2DQFB 2X1WL 4PCSA 3ECWA 3M46A 1YN6A 1S5HA 1MCNA 5JDSA 3TA4D 1A6UL 3KPOA 6FABH 3T6QC 5EEUA 2NTSP 2FWOB 2A9NL 2EECA 2K6ZA 5D2LE 5T3ZL 3SJVD 1RUKH 4NI6A 3CLFH 3PWUA 5CIPH 4ES9A 3HAEG 3PP4L 5IEKB 1A6WL 4KKZA 4AK2A 2EO1A 1Z5HA 3CFBA 4QR7A 4H1LB 3I2CH 3PDDA 5HPMB 5ESAB 4Y16D 5E8OB 1A3QA 2AXGA 4B0MB 1PL3A 1ZVNA 4FERA 3VI3F 4KHXH 4V2CB 2DQGL 3ERXA 1QEWA 3WJJC 2EKSA 3MACH 2FVNA 4MKMA 4MB4A 5FUZH 4QOKB 3WTYA 1BZ8A 3V6ZA 1EGJL 4YC2C 1G9NC 1FVCA 1LP9F 4FFYL 3WUWA 4FA7B 3X1EA 1DUZA 2RH0A 2C9PA 1UVQB 3NJGA 1YC8A 4PS4H 1GMEA 3HB3B 4AGNA 4NNXB 3TJHC 3SBWA 1QBBA 1LO2L 1KJMA 4O4YL 1GGBH 1W8OA 3BEWA 5CSBA 3ZRSA 2QLYA 5IOPB 5TQ0L 1RZ7H 5D9SA 5B38G 4MLSA 2NX5B 4O02L 4IHOA 4PJCB 2DEYX 4GPVA 4S1SL 1Q94B 4N0CD 2XTLA 2ED6A 4FQJL 4KTEL 3PP3K 4XO4A 5A6LA 3F7YB 4AXWB 3VWJD 3ROLA 5HHOE 5ABAA 5CLWA 4UT9A 4J5VA 5EBWB 3EGSB 1RZJC 4QLWA 4GRWF 5JOFA 3Q8FA 1HHGA 1X5KA 4K9JA 3SZKC 4U4BA 4IMKC 4N9GB 3RIKA 3O6LH 5CMAB 4L3CB 2UXGA 1RXLA 2XG4B 4LFHG 4O2CB 4XR8C 4FZEL 3TBWA 2Z8RA 3HA0A 1S9XB 2WYTA 1I75A 1LEGB 2EDEA 1ZD6A 5GGRA 4NQVB 5B3JF 4ONHA 3ZQWA 5HJDA 1NEZA 4OM1L 1BZQK 2UX6A 1T4WA 2I60L 3AXHA 1ETJA 3BX7C 1H0DA 3K2KA 1TYRA 3KMDA 3BSZH 2IGTA 2BVOB 3U9PH 3KLAA 1V27A 7CGTA 3LXBA 3U0TA 4K2UL 5EOCJ 3EFDH 3RUGB 2JVUA 3LZPA 3PWNB 4H8WH 4OSUH 5D70L 3VXRD 1HX0A 2VZTA 4XC3L 5J89A 3HMWL 1NAMB 3FCSB 2YGOA 4ANVA 2XIDA 1WC7A 5IOKA 1ETB1 1V7NL 3WEAA 3OAYK 4FLOA 2NZIA 5HY9A 4P8QA 4W9FC 1T1ZB 3PE9A 1T1WA 2CBOA 2VQ1B 4WTXA 3GLDA 4JDZB 4D8OA 5F8QC 2AFNA 3HC3L 3Q6GH 2GTWB 5DTFB 3EBGA 3FULA 3IN2A 3RPKA 4N2OA 2FUTA 2XOTA 4GW5B 5E2WH 3VMOA 5FV2A 4Z95L 5AOIA 3ESMA 1HJBC 4L2LA 4ETYA 2WCGA 2ZONA 3D52A 1SXCA 4ZSOE 4DQAA 5CHNA 4HZ1A 5DRWB 2WKGA 3QDME 3QH3A 1ZK5A 3ZE2F 5DD0H 1E50A 1GCFA 1R0AH 2WINB 3LMJL 3T3PB 1PLCA 3GM0A 3R0MA 3VYPA 1BVLB 1A9BA 2L7EA 3QSKB 3V4VH 3WSQL 1SF5A 1TPXC 3U2IA 3VX1A 4FFWD 4Y1AE 1JNNH 2FX8H 3AS3A 3VFWA 4JRFA 3SKMB 3VJ6A 3QORD 3VD7A 3OAYH 3VFGL 1D5BA 3AS2A 3P2BA 4JANB 3DX0A 3L8QA 4NENA 4FKEA 4GKSB 3V4PA 4E5XG 5JHDA 3FL7A 2OS7A 3O3BB 2PR4L 2WB1A 2YD6A 5I1KL 2A9AA 3FUKA 1ITCA 2IPUG 4L4VE 4Z0BL 1QHOA 3G5YA 2F8IA 2V8LA 1MFDH 4I18B 2X40A 1XR8B 2VLJA 4FFZH 1UXMA 2V8MA 4GG8A 1BWWA 4GUCA 4D0DB 4I7ZC 1N3NB 1VFOA 1FZKA 3DYMA 1EEYB 1GGYA 5IW6B 4MDJB 3RWDB 1QRNA 4WUKL 5DHMC 1MCLA 1R0AL 4FYTA 4KX7A 2DMCA 4JAMA 4QRPA 5DD0L 2CHZA 5TDPB 4PRID 3VDAA 5BS0A 3AU1A 5CEZD 2FB4L 4HFWA 2DM4A 1O7SA 3S35L 2GK0A 4QXUL 1QUPA 3B2VL 3KH3A 4OZHA 3ECUA 3PNWB 3LXAA 1JNLH 3COOA 4Y5VC 1DVYA 3QFDA 4YXLL 4GRWE 4PTTA 1JI1A 1MDTA 3EYQC 1WA0X 3H0TB 1T7WA 1NC4D 4OFYD 3H3PL 3GB7A 3V5KA 1I1AB 4LPUA 4MMXB 4G5ZH 4QOKA 4FTVB 1TYEB 3DPDA 5F9JA 1E6OH 2Y7MA 1PY4A 4OD3H 4X7TA 4JFDB 3IF1B 3JUYA 3A4EA 1FFNB 3S88H 2P46B 5G4NA 1XR9A 1OE3A 2MHAB 3MJ9H 2O6DA 4NZTH 4YOKA 3UJTH 3SOTA 3CSGA 3EBIA 3ARBD 5D7JA 2R1YB 3UAFA 5FO8A 2P52A 3RHWF 1X3DA 4NKDB 4TSBL 3S7GA 1M9SA 3DMMC 4OD2A 4JFFA 5IFAH 4LCCC 1QTYT 3A47A 1A4CA 4PRAA 3CXHK 3HZVA 2IANE 2EE3A 4IKKA 3CZUB 4ANWA 4WFFE 2DWXA 4FL4B 2YC1B 1IJNA 1N0XH 3GMLB 3QUMH 4LP5A 4LNVA 4BGLA 1E4JA 1QBLH 2X4QB 4WO4B 4JFSA 2X4SA 2KT6A 4M4RA 3BKCH 2XTJE 3S3SA 4HLJA 2W95A 4IBVA 3QDGE 1AQHA 2NNAB 2W80C 3FK3A 3X14A 1PG7W 3NPSB 3P9LB 3LH9A 1U91A 4F15B 4Z23A 1A4KB 2EUXA 1MY5A 3ARVA 3FTVA 1TZHB 1FI8C 3JWOL 4L8BB 4U1LB 2B1AL 1OF0A 1PSKL 3ARDD 4ZPVA 5MERA 3PJSA 4PD4J 1I9JL 5E99H 4H8VA 2N0KA 3MRHA 4WHCA 4BK5C 5E8PA 3C5ZB 1K3ZA 2VR3A 5IBTH 4R83A 5C0FA 4CW1A 3C5ZC 2WWMC 1GGBL 4NQDB 4JQXA 4P46C 1JIBA 2VDLB 3OZ9H 3L4TA 5JW4R 2BP0B 4GFTB 1CFBA 3P4LA 1A47A 4XOBA 4FXKC 3LY6A 4MWFA 2NDFA 5HP5A 4XCYA 4XBPB 1FH5H 3DHUA 3MOAL 2X4NB 4YLBA 3NSYA 1EXHA 3KCWA 3F6LA 1LDPH 2A0LD 3SDCC 4M02A 1RZKC 2G5RA 3ARBA 1ETA1 1IVLA 1CMOA 1ECZA 1VFBA 1JCVA 4FG6D 1HHIB 1EGJA 1DVQA 1VRSA 4MA1C 5E00B 3WXWH 3GQFA 1ZS2A 2RMNA 4X8GA 1T5WB 4KZEH 2W81C 1Z1WA 3CDGA 4WW2F 3TO2B 1A1NB 4HUUA 5E1AB 1TQWA 1RIHL 2I25N 4ZDHA 4V1DA 4JFEA 4B9KC 1QNZL 1JWUB 1EZVX 3VFMB 3CZFA 3EHBC 1NCWL 1UWGH 5KYNA 4A6YB 5D7JD 1PKQB 5LO7A 3D12B 1BXAA 3JQOB 2EYRA 3VI4B 1BXXA 1YPZF 4HUXB 4C83A 5GS1C 1W91A 4YDMA 4EN3C 4U1HB 4UNVA 1DCEA 4I87A 4NSKA 2DJSA 3F04A 4EN3B 1NUNB 2OULB 5HBBA 4U3SA 3MNWB 3PS6A 4KXBA 5IOPA 5KS9F 3W82A 3N55A 3KYNA 2XWZA 3OWEA 1DZ0A 4ZPTB 4CADA 4XWOC 2Q8AL 2FUQA 4JY4B 1MRDL 4N0YH 3BVDB 2Z93B 4TQEH 4UQIM 3P0YL 1NFDE 4Z77B 1RJYB 2PR9A 3WY1A 1FZJB 4HKJA 2VMDA 3RHWK 2I26N 4P3CH 5DFAA 1NOFA 3D3VE 4CC0A 1OAKH 3UP6A 1X7QA 2IWKA 1XGQA 3N91A 3B2XA 1JGIA 2IFFL 3O2WH 4QRBA 2APTA 2XTJD 3W3BA 1CBVH 4GBXB 3G5YB 1YN7B 4UTAA 3DX2A 4AYEC 4FYSA 3VU1A 4ZFZB 3U0PA 4ZTOH 2EP6A 2L0DA 1BJMA 1WFIA 1BECA 3IDXH 2YWYA 4U31A 1UFGA 1MCHA 4D9RE 2ZYRA 3AAZA 4YFDB 2XZCL 2WANA 2VDMH 5C3LD 2GK2A 5K9JH 3RKPA 1AZZC 3QUYB 1NCTA 1M2VB 3NSXA 2DIBA 2A2QT 3KJ4C 3QEUB 4G59C 4BCZA 2JKWA 3L95A 4G43B 4YHNA 3I50L 3PQYB 3CDZA 4W9JC 3LKRB 3MV8E 2Y6SD 5D93B 3BPNC 4J7RA 3IDMB 3BGMB 3L1GA 1YEGH 3FT4A 3O3AB 4N8VG 5B1JC 5DA0B 1F8TL 2ZE0A 3FC8A 1TLMA 2JF1A 4QTHB 3T77A 2FSEA 3HC0A 3V55A 1WISA 5DUPH 3GHEH 1INDL 1GH7A 4OLXL 2DY2A 2CSPA 3H85A 1U8QA 5E0QA 5HHQB 5JPNB 3MFGB 2MPAL 5LAXA 1DJZA 4ZFFB 4WEUD 1SEQH 3ULVE 5D7SL 1K4CB 2HH0L 3D87B 3QNZB 4QEGA 4HGMA 4ZW3A 3DYPA 1LQBC 5IG7B 3ASOB 5DO2C 4MQXD 3W0WD 3DO7A 5LN4A 3L3DA 3LEXB 4OD1H 5J6HA 2YAEA 5ESVA 1PZBA 3NEXA 5KZCD 3BKMH 5HHXL 4E9RA 5L2KD 3VD4A 2OMTA 2G5BB 1U4FA 3MHZA 4KQ0A 1XF3A 2GKIA 4NLHA 1USQA 3CJJA 1J88A 2VW7A 3LIZL 2CO3A 2BERA 1DBBH 3I3BA 4GQPH 2FR4B 3C5JB 1UA6L 1S9YB 5DJDB 1VFUA 5CJXA 5IHZB 3FRUA 2CG9X 3B56A 4MJ2A 2Y69B 5F0PB 4E0RA 1MRFH 5CJOL 5D7SH 1RZJL 2NR6A 4ZPVB 4J6IA 2R59A 2P5WD 3G7TA 4TMPA 4Y2OB 4EIBA 3WMQA 4YN3A 5C97A 4DEPC 1SUJA 3ZY7A 4L0ZA 4NQCD 1ZLDA 4IBYA 3QQ4B 4EN2A 1MJ8L 3VI3A 3LNGA 2LW3A 1ETZB 1EWHA 3TU6A 3LN4A 3WJMB 3OLGA 3BCFA 3RU8H 2D0FA 2EZ0D 1YUHA 2G75A 5DQDH 4DK6A 1L7TH 3FYEB 4AX3A 5K1VA 5BS0B 1RZIB 3NA9H 5FDWB 1WBZB 4OCSL 4CDHA 2C7UB 5F97E 5JQIB 5DURB 1BF2A 5DD6B 2BSEA 5AWNL 1HH6A 2XG4A 2Y07H 5IMLA 4ONGL 2E8ZA 5F7YC 5I8OH 1LEGA 1KWKA 1HZKA 3WTSA 1CLZL 3OHXC 1L7IL 1GHFH 5F1KC 4XB7A 5H35B 2WW8A 3Q05A 3C09B 2Z8VC 2H26B 1EFXA 3FHQA 4XAWL 2BCKA 4BINA 2IBZX 1V05A 2R39A 1OGSA 2ESVE 5DD1H 5C0RL 4PJ9B 3PWNA 8CGTA 1HXMB 1PZSA 1GTFA 3VXUE 5BJTB 1MFBL 5ANMA 3VXSE 4E9SA 4AYFB 3H3BC 5DGRA 5FA4B 4R4BA 2DWSA 5INDA 3X12A 1DVFC 2ADJA 4TQEL 4JO2H 1QR1A 3RBGA 5HDQL 2QPFA 1W72H 1BIIB 4ZFQA 3NJHA 5J5EA 4PJHE 1TQCB 2X6BA 5F7WC 3CN4A 3CQFA 3U2SB 1N8ZA 5DTFA 1RJZB 4ZXBA 3T3MB 3RX5A 2GPZA 4JNXA 2CLRA 4APQC 3IYLW 2XWCA 1YN7A 4ZXBC 1LO4H 1N6UA 1I7UB 1S7QA 3RLSA 1CGUA 2BIIA 3KR3H 5E2JA 2O6PA 2NLJA 3FQ4A 2WM0A 2H41A 5J57B 4L8SA 1U8CB 4AYGA 1ZV5A 4G7YL 5FKPB 5T3XL 4WWPA 5IW1B 4KDTC 3ARGA 1PVHA 4YDKL 3HCVA 3NGBC 4C56A 3ELQA 3NESA 5K5YA 1A14L 1NC2A 5ALCL 4GQZA 3SDXA 2ZCHH 5CXPA 4NZJA 4NKOB 1ADQA 1UYWH 4LQ1A 4NPKA 2V3EA 3MYJB 3QG6A 1L9NA 1VGKA 2FEEL 3B9KA 2CRYA 1UZ6E 5GGQH 3EOBA 5IQNA 1OSEA 3QO0A 3QRGH 2YD1A 4HISA 1KTRL 2O1AA 2QPSA 1HHIA 2QV4A 3K3QA 3QNYA 2QKIA 4MSWA 5JQ6L 4WNJA 2VSDA 4PRPA 1KBKA 4D94A 2Q3XA 3T6ZA 2DLTA 4C58B 2VITB 1NA8A 4Y2LA 1I9JH 2VGLM 5E99L 3W11D 2ZP0T 4KXDA 1FZKB 3IS0X 5TE6H 1AZUA 5E6ZA 1B0WA 3Q43A 3W39A 1OE1A 4OJEH 1BFTA 1IKOP 2CH8A 2GSIB 2H6OA 3EYFA 3H42L 3ULAB 3NIFE 2ITCB 2KLSA 4MZ2A 4TSCH 4I0PA 1JGEB 5D4QA 3ARQA 3ELAT 1G7IA 3LZOA 4JY5L 5HHME 3MJWA 3ZYZA 4QUOA 4MHHI 3BGFC 1N0XL 3QUML 4X4MA 3BZ4B 4NRYA 4WJ5A 2NR6C 1Q9KB 4GXVL 5B7EA 3TBBA 4BKLB 5EU3A 4Q97A 2AXGB 4CNIA 1S7VA 2J72A 2X28A 2F7QA 3FO0H 3FCGA 4G1MB 4JFWA 4LLMA 3EOAB 4LEOA 3IRCA 3W1ZA 4IMLA 4AQZA 3BQVA 1SYVA 1LJMA 5CFAA 3V6ZB 1FORL 4YE4H 3QDGD 3UDWA 5ID1B 3P4OA 1E27B 4I48A 5C2BL 3IETB 4HKZA 3C8DA 4RRPM 1EEUA 3NIGB 1OANA 2ICWB 3MXVL 4BFRA 1J9SA 4PYGA 4DJMA 4PRAB 3GSNL 5DK0A 5KUKA 5K59F 3MUGB 1B4TA 1MJUL 2BP5M 1N68A 4QT5B 3EADA 2AERT 4KX9A 2R1WB 4M7JL 3RA7L 3TO4D 2DV6A 4ZJ9A 4HUNB 1J7VR 1PJWA 2IC2A 2ZXEB 1BAFH 1JF1B 4HHWA 3K0YA 4NJAL 4ODUB 3MLYL 3A6BH 3OR6B 1IEBA 3WXVH 2P43B 1GPOL 2GQHA 2MMXA 4JKLA 3C5SB 3SDXE 1EAPB 4OJFL 3QAQA 3LKRA 1MRCH 3GBNH 4HCRA 5CINL 3LSOB 4IK7A 1E42A 4O2CA 4C56E 1AQKL 2LOEA 1S9XA 4UQAA 4AKOA 5I6XC 5DD3H 3LD8B 4IRSC 2A9BA 2UZIH 1OTTC 3BWUC 4XPGL 5CGMA 2GSGB 3V79C 1OTSD 2XN9D 3RDTD 3TEZA 3ULUH 2ZG3A 3SKJL 5E8PB 4JLRB 1KGYE 3QHZH 5I16B 2CDEA 3ZYJA 4APXB 3KLAB 3VRLF 3UTPD 5F7FA 4AMKH 4J4PD 4DP5X 5C9JB 1GYUA 5KN5A 4LLVA 2DZEA 4FQ1H 4K3DL 3VWJA 5A2KH 5I6NA 3P11H 3VSTA 2NY6B 2NYYC 3TPKA 1BHGA 4FQ1L 1NGYB 1XGRB 4U2YA 1IGYA 5J06A 1ZGLA 2XZQL 1HI6A 1YYLL 4MAUH 2VDKB 5E94B 5CEXA 4QXVA 1F11B 1U3NA 2AQ2A 1YYLH 4UMGA 3ZZ1A 1LVEA 2XX1A 3O6FB 4JRWA 4GSRA 4NPYA 4LIQE 2BS8A 4OZ4A 1NLBH 1Y0LB 3DUUA 3FB5A 1VKXB 3TN0A 5T5NF 4EI0A 5IGXH 5EOTA 2PPEA 2WD0A 1FAKT 4PGZA 4QRRE 5BZDA 5B8CA 3CCHB 1F2XK 1XH3A 4YR6B 2WIIA 3ZO0A 4P2RE 4UTAL 1FIEA 4ENZA 1DN2A 3QJSB 5E9DB 1AKPA 4QY8B 1F56A 4FCHA 3RA7H 4XMPH 3GBNL 4EN3A 4OFDA 1BQRA 4QRUB 3Q2VA 3L3GA 3LN9A 4Y16C 3Q48A 4HYTB 4PSPA 5DZNA 4AMXA 5B1BB 4RIRA 1ND0B 2YEQA 3ECBB 3B9KB 2CHXA 3PWPA 4X6BA 2XJLA 1JVLA 3D25A 1MEXH 3FTYA 2HFFB 5L7XL 4O2FA 1C5BL 1QYGH 3PAZA 4HKJB 4UILL 4HIJA 3VFTB 1JNHA 4LCWD 4U33A 1TJGL 1WBZA 2PPDA 3ZKND 4E9VA 2JIXA 2OXGA 2PO6D 4PRHD 5DK2A 5MEND 1RULH 4QRSA 2WXNA 1AXSB 2C4XA 4O9HL 5E8NA 3MCLL 5DVNA 1HHKA 2W91A 3EFDL 3MXVH 4UOQA 1X5HA 4GQRA 1S5IH 4HCIA 4X4XB 4XXCC 3M8OL 2NSQA 1D5ZA 1TTGA 5M95B 4OFIA 1LILA 3PDOA 3ZDYF 4BDVB 4K5MA 2GBTA 2LVCA 2E6JA 3O2VL 3RFZB 1BMGA 2PPAA 3QEQB 3T2NH 5BPPA 4L23A 3LCYA 1WIUA 4LL4A 4OM1H 4FXGA 1XH0A 2W0FB 3ABGA 5EO0B 5J0BA 3IDIA 1FRGH 1E2WA 2BZCA 2DQMA 3QORA 1UZ6F 2R69H 4WO4C 3MRBB 4FZEH 2D7QA 2JMRA 4KXAA 3QUZA 4TSCL 1XGTB 4XAKE 1P2CA 5LNDA 3Q3GA 2X53A 4Q2ZB 4UQ3B 3IGUA 2LU4A 1YAZA 3L4ZA 4TVSa 3QWQB 4K4KA 4PRBA 2MQGA 3C6LC 2DYPA 1EZUA 4HPHA 3DV4A 1N12A 4YO0B 3OKOA 5BOZG 4W9LC 4LIQL 1OF2A 2C9SA 3ULVD 4ODBD 1U8IA 1JSYA 5EFIA 4YXHL 5K93A 4X9BA 4XBMA 3MCG1 5CP3A 3QC5X 4N2KA 1A7PH 3KM1A 3K2UL 4R97C 1DO6A 2Y5QA 3BP5B 3HE6B 1I1AA 3RVWC 4QOKD 4YHML 2NYKA 4LAJH 4U0RB 3RWFA 2B4CH 1AG0A 1BVKB 3WKMH 2DEXX 3D2UA 3OJMB 4PS4L 4H5SB 3O6MH 4P2QE 3GZQA 1MREH 4GO8A 3DJSA 3GJFH 4HQQL 4YBQC 5DC2A 5IQOA 2L7UA 3KPRA 1G87A 3QIUD 3FRPB 2YN3A 1YNKH 4F7MA 4G9FD 3F83A 2BW4A 3B4NA 4LVHC 4PUBL 5KVFE 5HHPA 5A2CA 3DBXB 1U8NB 1P5UA 1H9DA 1CGVA 1I9RL 5EA0H 3EYOA 3DIFB 4UZSA 1HC1A 2C8NA 3BYYA 1JS4A 3AREB 2W65A 5F44A 2WLNA 5HJBA 4CU8A 4R7VA 5D7IB 2A74A 3LRKA 1OXYA 2B5IC 3L4CA 1MPAL 4WO4A 2DAVA 1HXYB 3LDBB 2VSCA 1KBGL 5AENA 5HXMA 2X3AA 2FR4A 4NM4H 1S46A 1YEHL 3NFNB 3UTQB 1E3FA 5FO2A 3KJ6L 4FXLA 4LPVA 4XMXA 4YHOH 4G71B 3ABMB 6FABL 1LO4L 3FN0H 4XP4H 1BFVL 1DZBA 4KJQD 3ZDZF 4D7BA 5IB2A 3OHMB 3UIZA 3ASNB 3D6GA 1MW1A 2HVBA 3H6AA 4ZX5A 4ZX4A 3O8XB 1C5DA 1FIGH 1A6TB 5IQ7L 2AW2A 1WFJA 1SJXA 1Z3GH 2OI9B 4XX1E 3KR3L 4LESA 1WAPA 3R4DA 4X80L 2EYTA 3ZE1E 3NJNA 4DP9X 2NUPB 1E9QA 3BUPA 1IAOB 3QJFB 5FS5A 3M1OA 4ZYKA 3LHPH 1JZ5A 1MUJB 5LCVA 2IALB 1YUHB 4N2IA 5TPWL 1PYWB 1BZ7A 1KDJA 3PHOA 4P46B 3WKYA 3SCMA 1WIPA 4PCKA 4PLKC 5ECGA 1VADA 4EDXB 1G5GA 2UY6B 5MEPA 1DQMH 2XWEA 2EDNA 4AYMC 2JWYA 4RAUB 1AKJD 1OSZA 1GHFL 3AM8A 1JHLL 3ORJA 5FM5M 4PGCA 5KVDL 3VRIA 4BQCA 2FEDC 1I8KB 2NZ1A 4YH6A 3US1A 4YSCA 4TQPA 5IBUB 7PAZA 2HRPL 4G6MH 2FYVA 4A7UA 4DUVA 3C6LA 2HTKC 1I8MA 1P9MC 2E56A 3W9DB 1N6QH 4V1DE 3IJYA 4NUQA 1J1OL 4LLDB 5EC1B 4FEMA 2WNKA 2X70A 2VUYA 3KPQA 3P4OB 3I9AA 4I48B 4NNYB 2EYRB 3DC0A 1NDTA 1R3HB 3GIZL 5C0DA 3GKWL 2JNZA 3G9AB 4R3SB 1MKFA 3QIUC 3ZTNL 5D5MF 2IPKA 5IFJA 3B5TA 3HMXL 4P9HL 2C4FT 1KACB 2IQAB 4XNBA 4XP9L 3A3YB 5E4IA 4K94H 1L7TL 1MIML 4E41A 1BYOA 3GNML 4OZGF 2Z93A 4XXCA 3B6SA 5DQDL 4WSGA 1BYNA 5SWZE 1IVTA 5DS8B 1HK6A 3N43F 2D3VA 1EEZB 1FF5A 1W0WA 4PCYA 5EBMA 5JO5B 3OXSB 3RURA 3UTTB 4EEEA 5JOEA 2HVJA 5IJKC 2P4AB 4H2AA 1TVDA 2HWZL 1JZFA 2EDTA 4LGSB 1QSFA 1UXSA 2AI0H 5D1XC 3RFRA 1EQWA 3U0PB 1GS6X 2CGRL 4NERA 2XLLA 1CYGA 2P5EA 4B27A 4ALAL 4PAZA 3WS6C 4OU3A 2DRUA 32C2A 2XQBL 4NQEA 4XB8A 5EO0A 4PJFF 1QSEB 1CDCA 2HT4D 3HCVB 1I8AA 4G8GA 2YD7A 2APXA 1X44A 1IIKA 4G6FB 3U0TB 2ATPB 2WZAA 1CFVL 2XWJA 5EORL 4F3FB 4APXA 2ARJQ 1UA6H 2AI0L 4PG2A 4WHDA 1QATA 1D5XB 5EORH 3U6RB 2FJGA 4DK3A 4KKBC 4OLYH 1OF2B 2V17H 2C1PB 1MVUB 4FNUA 5IQ9A 1NAKH 4DGWC 4CAGA 2WGNB 1BDYA 3BVWA 5F9OL 1WBXA 4M6OL 4NKQB 2IANA 4R4FL 5CD3B 3EJYD 2BVPA 3TASA 3IJEB 3DROB 1NINA 3D85A 5CJQL 4QO1A 4LPXA 1OHZA 3IN0A 4CN4A 2VITA 2A1WL 2HFGH 1CFTA 3O4LA 1N4XH 1XCXA 3ZL4H 1A02N 3FHAA 1LK3H 4XCEA 4WFHE 4YHIA 1OVZA 2DM7A 3KGUA 4F7EA 4Z76B 3HC4H 3V9EA 1RSYA 3KS0J 2J12B 3N9GL 4POZD 2RGSA 3FU7B 1BQUA 3BGAA 2QTEA 2YHGA 1BQHA 1ZHBB 2Y0SA 3EYOB 1J8RA 1GZQA 4G7RB 1IMHC 4XZUB 5C8JA 2NMSA 4K3HA 4PJXB 1F58L 4GRWH 4B9CA 2K78A 5ESVB 1MH5B 3KBPA 4M5TA 5ESQA 2YXVA 1UHVA 5IT2L 2CUMA 4YAQA 4FQLH 2VDOL 4FABL 2PYED 5DVLA 4Z3TA 2HRPH 5BUAA 4XE5B 4MKTA 2RB8A 4X8XA 3MV7E 2YA1A 5CLZA 1VHPA 5F6IB 3DI3B 4DPRA 3CD4A 3RVTD 5C71A 1UATA 2GJZB 1U42A 3KL0A 4UF7C 3VXUD 1DVFB 4G1EB 1G7QA 3FQTB 1OP9A 3KPSE 3TBWB 1KDIA 4JL2A 2ZX6A 3NCFB 3P0YH 4QHLA 1T0MB 3AB0B 4XO5A 2DEWX 2EDFA 2H32A 1AZBA 2XQYK 3J7HA 2D4DA 4NQVA 1OALA 5T1DL 3VI3B 1CI5A 3HS0C 1OB1B 2R2BA 1KGJA 1YECL 5HHNB 3QZPA 5TE4H 4GLRI 4KI1A 2EDOA 1KCSL 3UDWC 4HG4J 1GVIA 3HN3A 4HUMB 1GCYA 1XBRA 4BM7A 2Q9OA 1Z3GL 1Q1PA 3WFHB 3MLRH 3HUJE 3VE0B 4PGEA 3NCJL 3B9VA 4DK5A 5IQ7H 3BZFB 3PNWA 3RX9A 3QQNA 1MPAH 4UNIA 3MRLA 1ZSDB 4XPAH 3D4GA 3RWHB 2D7TH 2WO4A 4GS7B 5AAWA 1DLHB 4S0TD 1NGPH 4Y5YA 5IB4A 1SLWA 3FN0L 1RUPL 5DRNB 3PFQA 5I9QB 2WMPA 1MCCA 4PGDA 2IPTL 2YKKA 4P9ML 5DMGD 3SY0B 1QNZH 4NBXB 3ULSA 1HSBB 3NOIA 4WTZG 2DJUA 1BFOA 4AL8L 4C8XA 3V52H 4GRLB 2HRLA 4HOMA 2GC4C 4DO4A 1B4LA 4MQSB 2G4GA 3KVQA 4WUUB 1HQ4B 4QJ3B 3ECQA 3TYGH 5E6UB 1VENA 4N85A 4PUBH 4AYFA 3WNJA 5GRJL 4CSSA 1NMCB 3LZFH 4UU9A 4R4BB 5ES4B 1QWHA 3IDNB 5I1CL 5J11B 2F1EA 2WLIB 4PP2B 3ZYOA 2X4RA 4EQ3A 1JDDA 3ZQXA 4A2GA 1JRHH 4AGQA 3MI6A 3X11B 4BSVB 3O6ML 1U8HB 3MRIB 3E6HB 5FOBB 1JPFA 1VA9A 2VXVH 3B9AA 2JH2A 3KDPB 4G8EB 4OZ4B 4QCIB 4YHPA 3SE6A 4H20L 3ILPB 4AMWA 2VKXA 4OVUA 1BVOA 1AGBA 4KKLD 4RMSA 4XNMB 5DZLA 4LF3A 3OHXA 4MXQC 2I32A 2AQTA 3BGFB 3MRHB 4MXWH 3RB5A 1WDAA 4PRHE 2YZ8A 4MS8D 5H37A 4WK4B 5L0QC 1A6TA 1B88A 4W9IC 2R2EA 2XPGB 4P4KB 5IW1A 1PG7X 2HT2D 1OAQH 1T04B 1AFVH 3NCYS 4LCWB 4XPTL 3TT1L 4JFOB 4IBUA 3UACA 1HHJB 2X4TB 5TGBA 2XV3A 4AE0A 5DEGA 3D18A 3CSBA 4EIUA 3TIDA 4Q6IA 1C9SA 4R90L 1FL5A 1A6ZB 3SQBA 1PYWA 1EA9C 1TJGH 5HVGB 1BAWA 1RURL 4XOCA 4HULB 3MJ9L 1RY7B 2BHFA 2YD8A 4N2GA 3BZEA 4Y2DA 2L7JA 3QQ3A 3IDJA 4FFZA 2BVPB 3SJVA 3KPPB 3NK4A 2RHEA 1S5IL 2VL4A 5KTEH 3RVUC 5GJTH 4XP1H 2COQA 3QFDB 4YGVB 4KVNL 4TVUA 1PIGA 1KJ2A 3IE4A 3UJTL 3II2A 4JHBA 4UOW0 4Y5YC 5IFHL 2HPOA 1D9KB 5KVMC 1K8DB 1JGUH 4KNTA 1S8DB 2ENSA 4Z7NF 5SV4A 5ICZA 1VDGA 5JDJA 2BRRL 2HMID 1QFHA 2FO4A 5EU7C 3MRBA 1BFSA 1UH4A 3HKFA 3QS2A 4K9EL 2G60L 4TXVB 3VO0A 2VLRA 1A0QH 4OLEA 4TNVF 1KJVA 5FC9A 3IJHB 4UIKL 3K72A 3P2DA 4WJKB 2ZWLT 2Y2YA 4I0PB 1IL1A 5EF0A 3LD8C 5TF0A 3CXHJ 4WWOA 4G5AA 3VGDA 3F7QA 5D2NB 3QIBD 1X5YA 2ATKB 2KUTA 3X1NA 4IRSB 3X2QB 2XCMC 1AXIB 1H5BA 1WEJH 3TCLA 3VFSB 1KULA 5CU9A 3B6SB 2Y5TB 3KLHC 4B0MM 3V7AG 3NCXA 2P9RA 2OXHA 5GRZA 3LB6C 1P5VA 1GGIH 3ARXA 3V5HB 2GYSA 2FAUA 5GS0L 5F88B 4G1EA 4K3DH 1ZT7B 4WGWB 4F91B 1U93A 3B5HA 3NZSA 2H4EA 4P5TD 3U7YL 3ZTJH 5B1JA 4X8JB 4XZ4A 2X5PA 1MG3C 3QHZL 5C0GA 1RZFH 4PD4K 3KL3A 2CLZB 3CTTA 5FYKD 4PJDE 3UZQA 3N06B 2H1LM 3MLWH 4HWUA 4I5BB 5AVTB 1GY2A 1Q1JL 5GS0H 3FZUD 4OVVA 4IK6A 3OKEB 4Z7VE 1PKOA 1U3HB 1IGFH 3OMAB 1MW0A 1RZGB 3QAZC 4UYPA 1DE4B 1HNGA 1MVUA 2IG2H 4H25A 1ROCA 5DCCA 5GGRY 3UBXG 3WO4C 4NJAH 4Q9CA 1DUYB 5B4MD 4CC4A 2VXUL 2YMXH 1AHWA 2D7MA 5KSUB 4Y8AA 1BCIA 1TXKA 1DCLA 3EJZC 4YBLC 2CIIA 4QTHA 3T77B 5BV7H 5IJVB 4OFVA 2EUZA 2I9TA 5IB2B 3K4AA 1CBJA 2BCMA 4X98B 5EMYA 2VDLH 5B3JE 4F2MB 5FECA 3BI9X 3WXVL 2BSRA 1RK7A 3PAYA 2ZKHH 5IM7A 5JXEC 1BF5A 5BMFL 1EZLA 3UIYA 4LGRB 1P1ZA 3WENA 1M6OA 4TQIA 2F8XC 2CJ3A 4TQHA 3MZTA 4Y4KD 3T0EB 2IXQB 4EI5D 5KS9A 4BA8A 3KPRE 4NCC2 1KJ3H 1V7NH 2EDMA 3SDYL 5C9JA 4GW1B 3ROOB 1OLZA 3Q6GL 4WCYL 2A6IB 4HUVB 2C3GA 3R06A 2EABA 3ZE2B 1FZOB 3MC0A 4U1HA 1DQTA 1C12B 3LJ3A 3SCMB 4JG9A 1W0VB 1Y6NR 3X3GL 2W9EL 4D9LL 4PV9B 1RURH 4AEIL 4GW4A 2CIKA 1I85C 1OGAD 3CDCA 3ATEA 1YQVL 4HJ0D 3S9DB 2J8UA 2NCEA 2PW1A 3SGDI 1EVTC 3LKQB 4D8PB 4AGOA 2WGXA 2EXTA 4DW2H 4XTRC 1HILB 3H9YA 1AJ7L 1GJIA 4B53A 5GIRB 4I18C 3UAEA 3IWUA 3LYRA 1ES0A 4M6NH 3QPXL 3C6LB 4NRXA 3MRFA 2KPNA 4MQXC 2YPLE 4WZ9A 1FBIH 4JKWA 1XH3B 5T5FH 3DVNB 4JHAL 4HUCA 4MJ5A 1T0MA 2MEJB 4Q9BA 5C3TA 5C0EA 5CBAB 4JPVL 4R5TA 1CFSA 2VN3A 2WQVA 1A1MA 3KDMA 4QHNB 3N85H 1QI4A 2GAZB 2QQLH 5J13B 3JV6A 3L4YA 3GD1C 1F18A 3V0JA 4C4KO 1HWWA 4TTDD 4Y4KA 3B3BA 5TE6L 5FUCC 4O5LH 5EF3A 3CHQA 3FTGB 3PWPB 2CCLA 4X6BB 4F5CE 2XA3A 3SIKA 4B9JA 3MRKB 3L9EA 4LQFH 4S1SH 1RUQH 1TQTA 1LQSR 5I5MA 2A4CA 4LVHB 5JQ6H 2X9YA 3PQYA 3MX0A 3M17A 3X1BA 4MJIA 5I24A 3GXNA 5DYOA 1CQKA 1KJ2B 2WBWB 1PY9A 1A5FH 3GDBA 4NFBA 5LCVL 4RBPH 3UO1H 1R4XA 3FU6A 5ACZB 2BP8B 2BSSB 3I2CL 3C60B 1AD0B 4MAYB 4GAJL 3UBXB 5CFHA 4P2RA 2BS71 3BH8B 3HC0B 1AD9A 3BN3B 2XFXB 3OPUA 1NC4A 2P47B 3GRWL 4UT7H 4LCCB 3EYQD 3HB3D 3PP4H 4WU5A 2X7LA 2AXFB 2B5IB 3RNKB 4QRRA 3K72B 2RIKA 5LBSL 1NM9A 2JKLA 3H7BA 1SXNA 3UMTA 3GJFA 4G8FB 4L3ED 4W9GC 2C1OA 3MJ8A 1CG9B 1QOKA 3FCSA 2RACA 2V6HA 5IG7A 1V3LA 3O8XC 1WZ1H 1A6WH 2VN7A 4UU9B 2OI9C 2WNXA 3U1SL 5A2BA 1HJCA 1FO0H 4GRMA 4JREC 5KBLA 2GIYA 3BH4A 4P2OA 3ILDA 2H9GA 2CPCA 3CFKB 4NZRH 3S3CB 3S5LG 2VDMB 4ZMPA 1AZNA 3IMRA 3KLLA 2QBWA 3ZGHA 1UD2A 4XC1L 2HT2C 3VSQA 1O9WA 1Z6JT 2P5WE 1H3GA 2N4IA 4OZIE 5T33L 1UJ3C 2UZYA 4H5SA 4B3EA 1A3RH 5KJRH 2IH9A 2DQJL 2BM3A 1KIUB 2PYEE 1QO3B 2R0LH 3KCPB 3GGWA 5FYJD 2Z3FA 3FRPA 1LD9A 3KYMB 1AP2A 1WWBX 3FOMB 3PDGA 3QXUA 3VNZA 2WBJA 3ULVH 2A74C 4H40A 1YEJL 1ZHBA 4BK4A 1MCOL 3QQ4A 1MFBH 5AW8B 2B15A 4ZW6A 3SDCB 4PJXA 1P5UB 2JK5A 4Z7UA 2BFVH 2F54B 3NABL 1P5UC 4PWHA 4Z7WB 2FGWH 1JN6B 1DE4A 4KDWA 4E9WA 1CFQA 2AK4A 5HYSB 3ATFA 5JW3L 1ADWA 4AE1A 4MCYB 5I26A 5I1GH 3QO1A 5EBLA 3WEOA 3TNMA 3QJZA 3ZDXE 4PJ5D 3DSNA 4ZQKA 4N1HB 2JKRM 2GUOB 1TETH 3TVMB 3O3BA 5IVXA 5AWNH 3GS0A 1P1ZB 2Z8SA 4KKAD 1F4AA 2YUXA 1JWSA 2P42B 2Y1ZA 4TUOB 2ENQA 4KKCC 1EZSA 2BOBA 2YFNA 4ICXA 5DJYB 3GZOA 2CHDA 3L3OA 2DM2A 1DANU 3F12A 4ZBJA 4B3VA 1AXTL 1WHOA 3BISA 3ROOA 3I75B 5AVUB 5AB0A 1N3NA 4U1JA 2D7PA 5AVWB 5F6HI 5SWSB 15C8H 1DBKL 1RZKH 5CJQH 2ZCKH 1E4KC 1JGEA 1Q9WB 3DK2A 1HT6A 2BSCA 4PJ8B 3ZHDA 3QJHA 7FABH 3C9NB 5ABDE 1NCAL 3TP4A 4F93B 4KFZC 3BP7B 4L3EE 3U0WL 4DZ8B 2IQ9H 3QZOA 4WTWA 2FE0A 2PLTA 3MRPA 4D8PA 1JYVA 2XXCB 1CD9B 4FLQA 5L4IA 3CFJB 4OLYL 5DVMA 3OAZH 4WJG3 1SN5A 1U3ZA 2VZ3A 3FQNA 5J6GA 4Z3HA 1DANT 4YBHA 4PTTB 2CDFB 2K0RA 1Q90A 3QBTB 1RV6X 1NGQH 4ODXA 3MRDA 2B0SH 2O5YH 3OAUH 3VG9B 5IESH 1FO0B 3QEQD 3KW7A 3ILQC 2AQNA 4AZUA 4PVBA 1BM3L 3C12A 3FFCE 5EU4A 1JZ8A 3HR5B 2OR9H 1W72A 2VRAA 3WFBH 1MHCA 2R4SH 4K0OA 1WAAF 2YD4A 2YPKA 4AQ8C 1NLDL 3NIDB 4J3VA 4OF6A 5HVHB 1WTLA 4KX8A 1HEZA 2B3RA 1F8TH 4GUOA 2OMYA 15C8L 4OZHF 5HVHC 4JGUA 1KSRA 1KEML 2IADA 4U6YA 1G7PB 3E7JA 4OLXH 1JPFB 2XHNA 2GITA 4N8PA 5DUPL 3SYAA 3DXAB 1EAPA 1S9VB 1FP5A 4R6UA 3VA2C 2Y3NA 1XCTB 1S7UA 2FWSA 5E8EA 5BVPH 5JIHA 1UADC 2YAFA 4JDEB 1CCZA 1JXGA 3GSVA 5B1AB 2F5AL 4BKTC 1I1CA 4NCC1 3ARYA 4PJ5E 1K4DA 4IRJD 2GSGA 2JE8A 4GG6F 4B9ZA 1TZHA 3QXVA 2P5EB 3I50H 4X5QA 2YRLA 4JLRA 1CICB 4KVCH 3PNRB 2QSCL 4L05A 1WFTA 2HFEA 1JZEA 3INOA 1Q0YL 1SNRA 4G8GD 4DP2X 1P7QD 3KXFA 3QDJA 4HGWB 4JFUA 5BO0D 4ATWA 1ZAGA 5CZVH 2OA9A 1EFXD 4IU2B 5CEXB 5DFWH 3HNSL 1IM3D 3J8F7 5I0YA 2O72A 3D0LB 5KW9H 1SLVA 4MYWB 4IRZA 4RAVA 4WENB 5K9QI 2LU3A 4A55A 1SDDA 4RX4A 4YWGH 4K71C 4WI9A 4DEPB 1CBVL 5FO9A 3CFMA 4YPGB 4X50A 1OAKL 1HSAB 4Y4FA 1PCSA 1QFWH 3LKQA 1CVSC 3BIAX 4JG1L 4BK8A 2OMVB 4BZ2A 3GXTA 1L5GA 1M57B 2XBZA 5I0WA 4BWTA 3RDTB 2ESVA 4NQSA 3SKNA 3FO1A 2RAMA 3S98A 3NA4A 1LDSA 4NZRL 4HFUL 4K8RL 1J1PH 4JFEB 3FOLA 2F18A 3OGOE 3VXMD 2ORBH 3AZUA 4RFEB 1RUAH 2VLRB 2R9HD 1JPGB 3II1A 1CDUA 1KJMB 4CSTA 3WTWA 4C4BA 1G6RL 1U8MA 2ZAHA 3JTTB 4M1GH 1ZE3C 1EDYA 4NQCE 5SWZD 3SBPA 2Z0BA 2D3LA 4HS8H 3NGBB 4M8QA 1GSKA 4I3SH 1DL7H 1DLFH 2FJHA 3WDIA 2HSIA 4TN9A 1QZNA 4GAFB 4FXTA 1RIHH 2FO8A 5DHVA 3P69A 1AQ8A 2EIMB 1M1XA 1NC2D 2VQ4A 3BAYA 1HHGB 1UKTA 3MRKA 3UTSB 2EILB 4U1KB 3LNDA 3L7FA 1I8IA 1SF3A 5DJ6A 3T9WA 1M3IA 1H8OA 1LK2A 4DAGL 3BIBX 3BUQA 3DXAD 2CR6A 1H3VA 5E23A 1S7RA 2C9XA 4JPWH 4LHUG 1JD9A 1U93B 2V7NB 3U46B 5ERWA 4KUCF 4AENA 1MVYA 3M7FB 1KTBA 4ZMTA 1RJCA 3EYUH 3L3OB 5ADOH 5EOQL 2WYIA 2DW5A 1SFHA 1PU0A 4XVOA 1ASOA 2PXYA 1YPZE 2IDUA 2IH3A 3WKML 2P8PB 2XRAH 1B2YA 3NP3A 3B7YA 4OCWH 1SXBA 4PJCF 2X7LB 4Z8FL 3TH4T 5D8JH 1PAMA 4X99B 2VMCA 3KPOB 2JSFA 3OV6A 3P0GB 4FLSA 5CUSH 5EZOL 4P2YA 4FMVA 3F01A 4NFCA 1X4XA 5J12B 1IGYB 1ZGLB 4JFPB 3PIQB 4P4KC 3VGGA 1YEFH 2K3TA 1FBIL 5T1KD 3ZE1F 5IJKA 3ZKNC 3BUYB 1A7NH 1VACA 4RLDA 3TT3H 4UDUA 4IGBB 1RL1A 1U8KB 5ESAA 2L4OA 2IEPA 1NMAH 1P4LA 5CCGE 3QZWB 3V6OE 3JV4B 1TNNA 2XIBA 3DX1A 2GT9B 3B37A 5JHLL 1YLBB 3IU3B 3EXJA 3T2NL 2DH2A 3BFWA 3QP3A 3EOYG 4A63A 3WUWB 1FNEB 4OFQA 4A67A 1TQSA 4NN6B 1KB5A 3PWLA 4JZOB 1B0IA 3G5ZA 3EXLA 3S8WA 3P0VL 1KCWA 3NAAL 4PFEA 1MFCH 1YNTF 3LPWA 3AG2B 3G6JF 2EXWC 5TD4A 1SHSA 1IAIL 4NQUA 4WY7H 1OAXL 1KBPA 5EOCL 5HDBB 3I6SA 1DBAH 3VD5A 4ZOCA 3S35H 1E6OL 3V0VA 1RZ8B 4LKXB 4NWUH 4BSJA 1KPRB 2BH0A 4JJ5A 5KUMA 5EULV 3U4EA 5CD5D 3D9AH 3C8KB 3FTWA 4R26L 2G30A 5CMAA 4K7PH 1R9FA 2HUHA 5D2NC 4ZW7A 1U6AL 3QUMA 4WRLA 3G5VB 2ICWI 2J8UF 2Q5BA 2YGQA 3PXJA 1E0OB 3BH9B 3LS4L 2IG2L 3ZTDC 3HBQA 3T3PF 2Z9TA 3BO8A 3BUDA 3EO0A 1XCWA 2XWXA 3H9HA 5EV7A 3HHRB 2AJXH 5T1LD 2CRMA 2R29A 4QTIH 3ZMEA 3I3EA 2HT4C 5T5NG 2XNAA 4JRXB 5IB3A 4IJTA 1VZIA 1NEZG 1OCWL 1CE1H 4U6VL 4A1RA 1K8IB 1TJMA 3L3KA 4KO9A 1IZJA 1DP0A 4EDXA 1AOZA 3VXPA 4N4YB 2AMGA 2EDHA 1HZHL 1T20B 1MFDL 3DX6A 4YX2L 4DKTA 2ICCA 3NRPA 2WBJC 1PW3A 2P1YA 1YYML 4Z3GA 3K6SB 1JNNL 1YAIA 3HI5H 4OZGA 3TH2T 3D50A 4TTGA 3R18A 3LKOA 5C6TL 2WKLA 3WSQH 1ZLEA 3AGWA 3BQUD 2VLME 3EDKA 4N86A 4NJ9L 5A1AA 1Z9OA 1W16A 5D55A 1ODAA 1OOAA 2NY2B 4GMSL 1CDHA 1YMHA 2J2ZA 2VXTL 3R0NA 2X2JA 4L9DA 3UADA 3W37A 3CK0H 4ZS6C 1G9MH 3V4UL 4Y8DC 1T6VN 5IWLC 5AL8A 3GI8L 3MNVA 1X9QA 1XMWA 1W9XA 3I6LD 2OBGA 4U7MA 2WLJA 5DD3L 5IB5B 3V4VL 1AQKH 4FZ8H 2D8KA 4I88A 5DGQA 2JI2A 4S2SB 4UIKH 2KH2B 6PCYA 1DJGA 5EUOE 4RQQB 3GBLA 4MTMA 5HGHB 4OLUH 1J8SA 3OKMA 5J6SA 3UTZA 3DDFA 2QMKA 4ZW8A 2ZUTA 4HWZA 4F92B 1JGUL 3QISA 4LEBA 1RLBA 3MYZA 5FYKH 4JDTL 4X6EA 5EO1B 3NN8B 3OXSA 1R3JB 2HVJB 3CFIC 2VM9A 4FRWA 4BQ8A 1CLCA 2EICA 3GSWA 5CP7B 4XWGH 3D0VB 3V4PH 2FATL 5HGDB 4HU2A 2DI9A 3OKKB 5DA4A 3QCUH 4YSRA 5C0AE 5MERB 1AP2B 3APCA 1E4WH 5ISZE 3HC2A 1OAZL 2K6WA 2SEBB 1XIWA 4JRYB 3UJJH 2B1HL 2LGNA 3ZN6A 2ATPA 4YE4L 5D7LD 3P9MB 5JPMB 4AZ8B 3DTUB 3UAJC 1ZTXL 2X3CA 4WEBH 4DGIL 1W8NA 2HFEB 3CVDA 1AOHA 4H88L 3GTVA 4BZYA 2PTTA 4JVPA 3DI2B 4ZNCD 2MRYA 4Y9FA 2Y7SA 1LP9B 4EVNB 5I1EH 4HAGA 4EF3A 4JM2D 3X1GA 3BSZL 4ZYKB 4ORGA 2AJVH 2HX9A 3PF2A 3TPUB 2FO1A 4H25B 4UAOC 3TA3A 2VW6A 4R8WL 4ENEC 5CEZL 4GIOA 5F1SA 3WCYA 1E4HA 1G7LB 4DVRL 3T8VA 5IEHB 2P49B 5KSAB 4HKBB 4MVBD 3DOSA 4LP4A 5E08L 4HV8B 3Q2WA 3O4LB 4NCDA 4YBLB 1BOYA 1E4XI 4JFFE 1JWSB 2CBMA 2DI7A 4Y5VB 4TUOA 1AMYA 1NUGA 5JR1H 5JXAL 3E9UA 1IU1A 1D7DA 3P54A 3TBYA 2I5YH 3CZFB 3RDTA 1F42A 2PETA 4O02B 1JRHL 4JO1L 5I0DA 1E5UI 1FGVH 1DQLH 3SSGA 4RSYA 4CVZB 3ES6B 5F7DB 2VNCA 4KJPC 1GZQB 1FNSH 1CGWA 1OT2A 1U4EA 3LZFL 4M7LL 4QRRD 4XT1C 5I74C 1KXVC 5GRJH 1AMXA 5FO8B 4JPKL 4PB9H 5CGTA 3AITA 2ETWA 2ZUYA 3KYNB 3JTTA 4YL9A 4ZPTA 5CZXD 2Q2EB 1Q38A 5GGQL 3QPKA 5JUEH 3CAFA 2OK0L 4CVXB 1EGJH 2VABA 2CA4A 1DQQB 2CU9A 4L29B 4I77L 2AQSA 3FQNB 2J88H 1XO8A 1M1XB 4JJ5B 1HILA 1ZMYA 5KSBB 5MEOB 3WNOA 3C8KA 4XBGB 2ZXCA 3LDBC 1A14H 1OT4A 3FB6B 4OIFA 2VMFA 1DEDA 4PJ6A 4NC2B 3NPSC 1W8EA 4NKMB 4RGNE 2DDQH 3B7TA 1R75A 3ZDWA 4LO9A 4O51A 1IFRA 1WVZA 4X6DE 4YDIL 3DGGB 5C0EB 5CBAA 1P7KA 4NC1E 1RUMH 2ICEA 1ILUA 5L2JA 1BOGA 1A1MB 3SPVA 4LHQB 5EUKB 1L6ZA 4ANKA 3EJSA 3PWVB 2X2YA 3Q5TA 2D7NA 2I07B 3LIUA 4OB5H 2CZNA 2EC8A 5I5IA 2Q86A 3CFEB 1FSKB 3MLSH 5J9PA 2AXHA 4PN6A 2W60B 2UYLB 4PLOB 5KSAD 4AW7A 3ZE0B 4RNRA 3OAZK 43CAB 3HZYB 4OIIH 4L8CB 4JVUA 4JS7A 3UPAA 1JGVH 5L8LB 1R3KA 4Y9CA 3P0VH 1CR9L 4KXZI 5F9DC 2OZNA 3BUYA 4YSOA 3S8FB 1K4DB 4XVJH 3FUHA 3H56A 4N2EA 2V5TA 3AG3B 1J87A 1A4JA 1ORQB 5ITFA 1UA7A 4NO5B 3SE8L 2XZAL 3BN9C 4MMZB 1AD0A 2M2DA 2P48B 4MB3A 2OSYA 3PGDB 3N43B 3DUSA 4DERA 4LMQE 1H3WM 3KXFB 3QDJB 4ZODA 1L3NA 4OT1L 3NZUA 1FGNH 1PZ5B 1HQ4A 2HJKB 1HVXA 4NHUB 5CSZB 3K71A 1S5HB 3QIWB 4BBWA 1MN4A 2ZF8A 4PWGA 3EHBB 4LEXH 3WEMA 1P7QB 1PKQA 5HGHA 3VI4A 3E6FB 1OGAE 3F7PC 4C83B 1NGYA 3TT3L 1J18A 1FNFA 3N9GH 5AKSA 3X11A 2VXQA 2P5ED 3E6HA 5EU6B 2EIZA 5F3HB 1FYHB 2W9DH 4F37K 2ZTBA 4QHMB 4IRJC 3SGJA 2BWIA 3D0VA 5DJDA 4BE5A 2YPLD 4NZDA 4M43H 2BHYA 2VSKB 4ELMF 1RJYA 2WWKO 2GIXA 4G7QB 3TN0B 1CD8A 4IRZH 1VB9A 1RVFH 4F27A 5IY5B 1HE7A 2F19H 4ZFOL 2VR5A 4JX0A 2FYYB 3K5SA 1LWHA 5HGBA 3CVIH 4IOSD 4HMCA 4UB0L 3L5WA 5F96H 5ACLA 2HPTA 3L4UA 3VYOA 4J3WA 5B22A 4LLQB 4TLTA 1W0YT 1QLEH 1I1FB 1MRFL 1HHJA 2FWLB 2X4TA 3W2DH 5F7MC 1MFVA 3T6WA 5BUGA 4Q6IB 4XP5L 2NY3C 3MRNA 4YIQB 2FX7L 2VXQH 4JRXA 2AK1H 5IWLA 3LNIA 5HYSA 2C34A 1T0NB 3WNMA 25C8L 2YO3A 4LSTL 5HYSG 1HL4A 2XQBH 1E6JH 3IDUA 3WFHA 4WI6A 3HN8A 5TF1L 2XPZA 1LK2B 3WTUA 1KCUL 2XWBA 5DSCA 1OSYA 4Y5XC 5E1GA 3FH7A 1YSOA 4JG0H 4GMTL 3TZVA 1GC1L 4M00A 1UXLA 3GXIA 3TVMC 2WXOA 5J56B 5I76A 2EIJB 4L1DA 2X42A 5ALBL 2D3JA 1TF4A 2K8QA 1RUAL 2PXYB 3I6GA 4FQIL 1N5AB 5FPIA 2FO4B 2LLLA 2HKAA 4HFUH 1JUFA 3GHEL 4K8RH 4PJ8D 3I75A 5D6CA 5FW6A 2PYEA 1MI5E 2OJZH 3G04B 4PJ7E 4WFGE 1R5WB 2GTZB 1RIUL 3BDBA 2CNZA 5ANMB 3HMXH 1G84A 1QFWL 4OLWL 4V1DD 4PJFE 3ZTNH 2YRPA 4C59B 3HN5A 1YEGL 2WNWA 4P49A 1OKEA 1XSOA 1LE5B 2ATKA 1FNGB 3V0WL 4DZ8A 3RTQB 1UKSA 1OT1A 2BVTA 3FHEA 1T1WB 3ILEA 3TCLB 5HYQB 4HUKB 1RJZA 4RX4D 4HWZB 4YEEA 1KGXA 1CDYA 4OTXH 4I85A 4GSXA 4BSVA 1XZ0A 1OE2A 1T7ZA 2ZOTA 3F7VA 4PLJD 4G8EA 4QCIA 4Y19E 2OZ4H 5GISL 4JFYA 5GISH 5LG1A 3RX7A 3JV5A 5IHZA 2YQBA 2EVFA 4F7TA 5K9OA 1K3IA 5IROA 2ESVD 5FO7A 3BSHA 4OLVL 4NZFA 5BRZE 3O11B 3ZZSA 1VZHA 2CPUA 2HRGA 3QULA 4QLRA 1KB5B 3PWLB 4JZOA 1LHZA 3G5ZB 5ENWB 1ZGLP 5G4OA 3ZYIA 2VC2H 3D4YA 4F58H 4F1SA 1HEZB 4G6KH 1SJHB 4TL4A 1TYJA 4KH2A 3T09A 4PB0H 1UB6B 1GYVA 4JQVC 4UANA 5D5ME 3Q8BA 2EDRA 4DP7X 1JHKH 1NCGA 2PTVA 2DL2A 4H0HB 2FT7A 4F5CA 1WZMA 4NZUL 5AUMA 4H2CA 4BUHA 4HJSA 3ECVA 1CL7I 3Q2LA 1B9KA 5G2NA 2WXGA 4DETA 2GB2A 4KTYA 3GSVB 3U9WA 2C9QA 1J9RA 3II3A 4PPTA 1OARH 2QR0A 4G9DA 4UAHA 1BQHG 3SEPA 3O9WA 4WGVB 3TV3L 2CXKA 3QXAB 4M62L 1KBGH 1CLOH 3HVDA 3BP6A 1QFWM 4AM0B 4ZO8A 4IBTA 3BRDA 4X7CC 5AVZB 4DO6A 2P24B 2CCVA 1XSKA 4EIZC 2WHVA 1TO5A 4AIZB 4YSEA 7PCYA 3MUJA 3GJEB 4ZUUB 4BWUA 4YK4C 4MD5B 4JHVA 1KJVB 5GRVL 1XTLA 4EOWL 5KSBE 5IROD 3ZPDA 1SBSL 3BAJA 1VEOA 3MSPA 1A3LH 2RJMA 3LPGA 3OD3A 4NRYB 4WJ5B 5FA4A 5C2UB 4K7FB 5B38B 3OG4B 4NT6A 4HQQH 1T83A 3IAQA 2VWEE 3ILQD 3CN0A 5CO1A 5GZOA 5L2KA 2X87A 2H8PA 5HDBF 4YHMH 1ZS8A 4R2GB 4NRXB 1DQJA 4YQXH 4MZRA 3DVFA 4DH2A 3MODH 3HFFA 3KPLB 3JZYA 3SE4C 1HH9A 2XY1A 5IF0B 3O4OC 4E36A 3CDFA 4R5VA 1I8MB 4PVMA 4YXHH 1D6VL 1QMUA 2VB5A 4LLDA 4N6RB 2GJ6A 3UJIL 2FCBA 4JO4L 1INQB 4NQDD 3MGOA 2V33A 2R2HA 5I5JA 4U1NB 3DGGA 4HXAH 2AQPA 1F6LL 2GCYB 1OGPA 3W56A 3IGKA 1BOGB 1ZXQA</