1SF3A

Structure of the reduced form of the p94a mutant of amicyanin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTAHPFMRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Studies of Two Mutants of Amicyanin from Paracoccus denitrificans That Stabilize the Reduced State of the Copper.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
molecule keywords Amicyanin
total genus 27
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2004-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1sf3A00
4DP1X 5EHFA 4GP4B 4JHUA 2XV3A 1QHQA 3DIVA 2PPDA 3WNIA 3MBWB 2GBAA 2H5UA 3NSFA 5B7EA 4A67A 5I6NA 1L9QA 2YAHA 1NWOA 2PPCA 4BXVA 4E9SA 3OMNB 1MG3C 1OCCB 1M56B 2AZAA 4QKTA 3IN0A 3D12B 1GR7A 4X4KA 1MG2C 4KO9A 5B1BB 2XXFA 1AZCA 2PP7A 1DYZA 2PP8A 5B7MA 2CAKA 4HHWA 2VSKB 4YSPA 3QQXA 1I53A 1WS7A 2YAOA 5PCYA 5TK4A 1QLEB 2VMJA 3PPSA 4G7RB 2Y1AA 1OCOB 1PNDA 1MZZA 4N4YB 2OCCB 3AG4B 3AZUA 1BEXA 1XB6A 1SF5A 5B1KA 3SBPA 1CYWA 1WA0X 2GB2A 4NB7A 4AZUA 2J56A 2Q5BA 1VLXA 4GXFA 2H3XC 2J57A 1JERA 2EINB 2BZCA 4DPBX 1HFUA 1PLAA 3OD3A 1SDDB 1AG6A 4KNTA 4F2FA 2IWEA 4YSSA 3NYKA 4G7QB 2UXVA 1GS6X 2VSMB 4YSQA 5AKRA 1FA4A 2QDVA 2YARA 5I5JA 2FT6A 5B3SB 2MTAA 1AS6A 3CDZB 3FPYA 3UACA 4DPCX 1PMYA 4BWWA 2CUAA 3EH4B 2PLTA 2ZWNA 1J9QA 1PCSA 4N8UA 2DWSA 3FQ1A 1NIFA 5ANHA 3AY2A 2YAEA 4FA7B 5B7FA 5F7AA 1AAJA 1V55B 4ZK8A 4E9WA 4KO5A 5D4IA 1PF3A 2EIMB 3EHBB 1JZFA 1SJMA 2QPDB 4A2EA 2GC4C 1NINA 4AX3A 3PAVA 2YAFA 4BDVB 3H56A 2TSBA 3PXLA 1QNIA 2AVFA 2FQGA 1ZIBA 1RCYA 2I85A 4KOCA 3T71A 1BXVA 1NTDA 2VN3A 2HLEB 2XVBA 7PAZA 3G5WA 3FYEB 1J9SA 4HCGA 1GS8A 3IEAA 5PAZA 4A66A 1OE2A 2BO0A 3SQRA 3IBOA 3CZUB 7PCYA 2BW5A 2YAQA 1OOWA 1ASQA 2HRHA 1TEGA 1TKWA 1V54B 2XUWA 4YSTA 4BDVA 3TBBA 1JVOA 3FSAA 2BP0B 3OM3B 1CUOA 3X1FA 2MRYA 1W6WA 4GYBA 3NJMA 1SFDA 1WAEA 3IN2A 3NT0A 2I7SA 2YAPA 4KO7A 4CSZA 2IAAC 2EIKB 3U25A 3FSZA 1J9RA 1PZBA 2FQDA 5I26A 3T6ZA 3HEIB 1JZGA 4NERA 4A68A 3ABMB 3N55A 3NJJA 3CVCA 2IDTA 1NIEA 3QJUB 4NAJA 2EIJB 2AFNA 1BAWA 2CCWA 3ABLB 4W1TA 5I5MA 3FU7B 3PAUA 4A2FA 4G7SB 3QJQB 3QJSB 1PY0A 1BXAA 2VW4A 5F7BA 2YQBA 5I6KA 1NIDA 1ZV2A 4TXVB 2UX7A 1PLBA 2LLNA 3TBCA 5E9NA 4AKOA 1RKRA 3ZIYA 2AANA 1BXUA 3FSWA 3GYRA 2PCYA 2XV0A 2HZHA 1NICA 2J55A 3PLYA 2HX7A 2XU9A 2YXWA 3WKPA 2PPEA 5B1AB 4YSAA 1J5DA 1F56A 1ILSA 1ASOA 1JOIA 4KNSA 3GDCA 3WI9A 2IDUA 3DTUB 1AQ8A 2P80A 3NP4A 1NIBA 2E86A 4Q89A 1KCBA 3SBQA 5TK2A 1MDAA 3ZBMA 1J9TA 2OV0A 1IBYA 3S3CB 3S8GB 2DV6A 3FS9A 2BZ7A 3QJRB 3FU9A 1MZYA 1KV7A 4P5SA 3NJHA 4E9YA 1IBZA 1KGYE 3T6VA 3CVBA 5I6LA 2DYSB 3NSDA 3JT2A 8PAZA 5AZUA 4YSEA 4L0PB 1A4AA 4KOBA 1DZ0A 3AG3B 3PAZA 4DP7X 2QPEB 3T9WA 1FWXA 4WKXA 4JHVA 2HXAA 1L9PA 2FTAA 2FJSA 2P80D 1AG0A 4UANA 2XX1A 3ZDWA 3S3BB 5I6OA 4K9JA 1AIZA 3ABKB 4YSDA 1V10A 1J5CA 1N70A 2ZXWB 1T5KA 1B3IA 3FU8A 4CSPA 4E9TA 3BQVA 3ZX1A 2DYRB 1SNRA 3NJIA 3FT0A 1SFHA 6PAZA 1CC3A 1JZEA 3IE9A 1WS8A 4WTQA 1ADWA 2BW4A 1ET7A 3S3DB 2GI0A 2XXGA 3WKQA 4EF3A 1GSKA 3NJGA 3X1BA 3CDZA 1AANA 1AZUA 2GHZA 2HRGA 1BQ5A 1E30A 4DP6X 1E5ZA 1TU2A 1A65A 5FC9A 4HCIA 1ID2A 2QT6A 2BP8B 3X1GA 1NIAA 2PP9A 3QPKA 1A3ZA 3UGEA 3FYIB 2NRDA 2BWDA 3X1EA 4HIPA 4RH4A 4A2DA 4E9QA 2GC7C 5I6PA 3TU6A 3NP3A 2EILB 4FAAB 1OE3A 4F7KA 1JZHA 1ETJA 3X2QB 5I5IA 6PCYA 1HAWA 2UXTA 3AW5A 3UADA 2WO2B 4M3HA 1A4BA 2J5WA 1PZAA 2Y69B 3NJFA 2IDFA 1AACA 2N0MA 2YAMA 3S8FB 5IY5B 2FNWA 4HHGA 4GY4A 2DWTA 2JXMA 4BK5C 1SDDA 1BQKA 2R7EB 1IKOP 1JXFA 1KDJA 2RACA 2B3IA 1JXDA 3T6WA 2OJ1A 1NPNA 2FQFA 5D4JA 1AR1B 3KW8A 3TASA 4HAKA 1SHWA 3V9EA 1GS7A 3TA4D 2WSDA 2A3TA 3ERXA 3L45A 2XWZA 1JXGA 4HALA 4BWTA 3CVDA 1AZRA 1CYXA 2FT8A 1RZPA 1AZNA 2Q9OA 4P5RA 4DPAX 1ET5A 1ASPA 3AG1B 2XYBA 3RYMA 2QDWA 2PPFA 2VW6A 1JZJA 1OE1A 2FWLB 1RZQA 4A2HA 1E67A 4A2GA 4HCFA 1PLCA 3FPXA 3GXUB 2FQEA 4DP0X 1SF3A 3UAEA 2UX6A 3H4FA 4YSCA 2IH9A 4DP4X 4KNUA 4UF7C 3FQYA 1L9OA 2BP8A 1AS7A 1SHXA 2X87A 4GP8B 4G72B 1IC0A 1KBWA 1E65A 1PZCA 2I7OA 2IH8A 4YVNA 1WA1X 1R1CA 3EF4A 5LDUA 2W8CA 3UAAA 5AFAA 1GY2A 2PPAA 4E9VA 1A8ZA 3SBRA 1WA2X 2IWKA 1TEFA 1GW0A 1NDTA 1PAZA 4YSRA 4BXSV 2BHFA 3MX0B 1OF0A 3AG2B 4PCYA 3DKHA 3WG7B 2B08A 2XX0A 1L9SA 4QLWA 4PAZA 4DP9X 1XMEB 1M57B 3WNJA 2H47C 1GY1A 2X88A 3JTBA 1ZPUA 3C75A 3QJVB 2FT7A 4BWUA 1NWPA 4E9RA 2YXVA 1A4CA 5B1JA 4UAHA 2VM4A 9PCYA 1KYAA 1AS8A 1OCRB 2IDSA 1IUZA 3BVDB 4G71B 3NJLA 1ILUA 3UABA 3H4HA 1YLBB 3OMIB 1FFTB 1ZDQA 2HX9A 2IWFA 4DP8X 3HB3B 1X9RA 4AKQA 4DP5X 2WO3B 1URIA 2CBPA 3N2JA 3NSYA 1HAUA 1ET8A 2BWIA 3NJKA 3OMAB 4F2EA 1JZIA 1AOZA 1CURA 2CJ3A 5I6MA 1L9RA 1N68A 2W88A 1KCWA 1L9TA 3KW7A 1KDIA 3EH5B 1NPJA 4YSUA 1E5YA 2ZONA 1XB3A 3CG8A 1AZBA 2GSMB 4HZ1A 2IDQA 1M9WA 4GP5B 1W8EA 2HX8A 4DP2X 1ZIAA 1KBVA 2VM3A 2DY2A 4W9ZA 3V9CA 4Q8BA 2ZOOA 1OCZB 3NJNA 2UXGA 2UXFA 4E9XA 2XV2A 2BP0A 4YVUA 1BQRA 4M4RB 2R7EA 3FQ2A 2JKWA 3FU7A 4ENZA 1X9UA 1ZDSA 3EH3B 1BYPA 5A7EA 2VW7A 1NZRA 4JKNA 3PCYA 5I28A 1OV8A 2GIMA 2TSAA 3QJTB 1EHKB 3T6XA 4YL4A 3NSCA 4AKPA 3ABGA 1EZLA 3WIAA 4G70B 3FSVA 2PCFA 2XLLA 1JVLA 3ASNB 4YSOA 5D4HA 4KO6A 1GYCA 1W6LA 2JFCA 3ASOB 1XB8A 3OQRA 3X1NA 4AI7A 2CALA 5B1JC 1BYOA 4MFHA 1UATA 2AZUA 1PNCA
chains in the Genus database with same CATH superfamily
4Z5RA 1HOEA 2JSFA 2X0UA 2WBWB 3C60C 3TT3L 2RR3A 4NRZA 2CLVB 2OSLB 4P5KB 5GGUB 1MSPA 4IGBA 4IKJA 5B7EA 1C5BL 4GNKB 3NCYP 4HD5A 4KXCA 3QXUA 3OMNB 4OFPA 1T6WA 1ZK5A 4JDZB 2Q7AA 5BVJA 3FHEA 1BHGA 2ESVD 4UQ3A 1AP2B 4M9PA 1JGDA 3IDJA 3CDGA 4MXQD 1U3NA 1AMYA 4FXKB 1F3RB 2PCFB 4F93B 2A6IB 4KTGA 5A2JH 4QF1A 1H8OA 3BN9D 3QJXA 4X6BA 3WS6A 5T5FA 4PG2A 2OXHB 3OGOE 1A14L 4U7SA 1Q72H 2ICEA 3IBEA 3WGUB 1YMMD 1OT2A 5D7LE 8FABA 4XOEA 2IADB 3MBED 1AIFA 1ORQA 4KROB 1RUKL 1QBBA 3L3IB 1A7OL 1Q9WB 4X5WB 4WO4C 5ID0B 5C07E 3FXIC 2FX8L 2AJZB 5C9JA 1FZJB 1BLIA 4ERSL 3P9MA 3V4VA 2WXJA 5KAQF 4OFQA 2V2WA 2YARA 3P69A 3ZQXA 1D5MB 1MCKA 3QO1B 2JCCF 1XMWA 4NIKB 4YDIL 3C5ZA 5D7SL 1WFTA 5TH2B 3QXAA 2AQSA 3TC9A 4D8PB 2GITA 3UACA 2X4TA 5CLZA 4FF9A 4KJWC 3TF7C 3VFPB 4L29B 4X6DA 5LGHH 4KI5C 1PKOA 1TYRA 3V0FA 2Z8VC 2IOIA 2DWEA 1NCAL 4BH8A 5D71H 1G7HB 2APVA 1NGYA 2CQVA 2J1XA 3IMTA 3CVIL 2X4SB 5TJWK 2V2TA 3KL0A 5I2IA 4YWGL 1T0MA 1BQLH 1XDTT 3H56A 5DUBA 4O58H 3SDXA 1A3RH 3B4NA 3TEXA 5I1KL 1NUDA 1PPIA 3MRIA 1PW3A 1BJMA 5L4FA 1COBA 3M45A 3DOHA 1OSPL 2W9DL 2NSQA 4GIAA 1LLAA 5C08E 1K8DB 1KG0B 2V7HA 1QD0A 2CDGB 1QFWI 5FHAH 2HWZH 3FO9A 2DM4A 4LSTL 1G7LA 5HYJE 4ETQA 3IU3A 1VSCA 3QC5X 3EYVB 1A5FL 5I8OL 5HPMB 1ZJAA 4O02B 3O45A 5DO2D 2ISDA 3WMSA 1G43A 2AEPL 1F11A 1UA7A 3DI2B 1GW6A 1VF5C 3FSAA 2BP0B 2VR6A 4KDVA 1GGUA 2NTSP 3EDJA 3BZFB 4XMTA 1JMXA 1NDGA 1XBDA 4WY7H 2B0SH 3QIBB 4HK3N 4FZ8H 4TS6A 5FFGA 1VRSA 3SBWC 3FN0L 3RZCC 4F27A 5GS1B 2EUXA 3K4DA 3BQUB 3TWYA 3I75A 3VGBA 4YE0A 5BQ7A 4IU3A 2AEIT 3P9MB 2ZOLA 1TQBC 5K59F 4M62H 4WJG3 3NUKA 1T7XA 2G60L 2WY3B 2Z1KA 4I87A 5D2NB 4AQ8A 3ZDZF 3ZUNC 1OSPH 1CDGA 5I1LA 4OD2A 2DN7A 5JMOC 4GXVH 2H32H 1UEMA 4KH2A 4EUPH 3MUHL 4NM4H 5CILL 4GSQA 4G7SB 4UTBL 2C9VA 1NGQL 3QJQB 3PF2A 5E2UH 5BRZA 4XMPH 1ETZB 4F91B 1CFVL 5GRVL 3MNZA 2OMWA 4Q6KA 1XH0A 3D85A 4JO1H 5DQ9A 4HF5L 2VDQH 4HQQL 5EIVA 5AB0A 5JIIA 2CLRA 1GTNA 2OZ4H 4I1RA 1I1AA 3MXVH 2XU9A 3FNKA 1RI8A 4XMPL 1E5UI 2NZIA 4MSWA 1RERA 1F56A 4LKXA 4ZDHA 1G9MC 2CLVA 2OSLA 4P5KA 3Q06A 2V5MA 4MD4B 2E4TA 2XA3A 2P80A 1JV5B 4AMXA 5I1JH 5J89A 1JK9B 3NTCH 1ICTA 3DI3B 4WIQA 2WB1A 1OAZL 5F3HA 4K94H 3ZBMA 1AKJB 5C07B 1H3TA 35C8H 3VG9C 5L88L 3HLKA 1J86A 1IZJA 4XVJH 3QRFM 4NNXA 1QSEB 4PJAE 3IGAA 3S0PA 5I23A 4P4RA 4CC1A 4JFHD 2W5PA 3NJHA 5EPMA 5LAPA 3V8CA 5IF0A 5LVEA 2Z31D 3KXFE 3T4YB 2XHNA 3L08A 3CVBA 1KXHA 5KS9E 5D7IE 1MQKH 2I9LA 4M7KH 1A9BB 4P57B 3LNIA 5CCKL 3STLA 2PTVA 3BAYA 3DVGB 2ZXGA 2UY6B 3MOBH 4HC1A 2ZCHH 5E5MA 4WU7A 3N0PB 5IJVB 1QNZH 1E3ZA 2VXQA 5C0AA 1N7MH 1Z9SA 3WNMA 2ESVA 4ZXBB 3NCCB 1GAFH 2K6WA 4Y8AA 2V5YA 5DHEA 2RB8A 2G0LA 3CVHA 3PABA 4NEHB 1OSZA 5T3ZL 5FOJA 4HJ1A 4ZUTA 4NKMB 1KELL 2DYRB 3IJEA 3Q8BA 4KKLD 5CZXC 5HPMA 3P77B 1SJEB 1NH6A 5I0ZA 2HKAA 4PVMA 3BKJL 2BY3A 2V5SA 2DH2A 1FNAA 2IGFH 1LWRA 3EADA 3MV7A 5AD0A 1NFKA 4O2EB 3N44B 1EVTC 3I74A 2M26A 4FERA 4CVXA 1OW0A 4BFEA 1F4AA 2EZ0D 2FGZA 3PQYD 1L6ZA 1UB5A 3LKSB 4U49A 3H7LA 3C6SB 3JTTA 4HAFA 2BP8B 1SJHA 3P30L 4NKIL 4JRXD 2PP9A 4L3FA 2YMOA 3UGEA 5F7FA 4TQPA 3IJEB 4LSPL 4NPKA 4Y5VB 3FC8A 3GXTA 3HE6B 4JFYB 4EKXA 1YEWA 4YE4H 5DMGC 1QFWL 3NACH 5GRUH 7FABH 1VGEL 3KLLA 3DHMA 3VG0L 2P46B 2J5WA 2YJLA 2DMHA 5MEQB 1A6PA 4LLVB 3NCBB 4CBPA 1XH1A 3RVVC 1FGVL 1MCWW 2DZEA 3TVMB 1OB1A 2NY6B 4GY4A 4S1QL 4Z7WF 4NO3B 4F9LC 1DBMH 4V2CB 3BXNA 4FOMA 2GG1A 4POYA 5C9JB 5LBSH 5D93B 1BGXL 4KKRA 1J18A 2VL5B 3UO8B 2DQJL 2P5WB 2EIEA 1RXLA 5FYLE 1HWWA 2AEWA 2BMKB 1SY6L 4AL8H 1HX0A 4BJLA 3VD0A 4XHQA 4RZCA 1ZMYA 2I60H 4R90H 3NPZB 4Y9EA 3B3IA 1KJ2B 2YSTA 1FNHA 4FXKC 3IJ7A 1V05A 5I6XB 2QQQA 3ZYJA 1QFHA 4F2MA 4BWTA 4GAFB 2BVUA 3QG6A 1P7KB 2A73B 4HS8H 5DDHB 4WTWA 4XBEL 3E7JA 4DPAX 3QIUB 3KPPA 5TQ2L 3O9WB 4MCMA 1ASPA 1SLUA 3PIQB 3FT9A 3SY6A 3ULVL 3D39E 3O6KL 3LEYL 4M7JH 3BEVB 2XWJA 4YZWA 2GKIA 3ILQD 1CXFA 4Y5YC 2IH9A 5EEVA 1OANA 5FDYA 2Y2YA 2NR6C 2RCSH 4WSKA 5IV2A 2DICA 4GBXD 3AITA 5F97E 4JGJA 2D03L 3BUPA 4ETYA 1FP5A 4KTDL 4TL4A 1M6OA 1G9NH 1E4XH 1WA1X 3THMH 4ZW8A 1I3GH 3EJPA 1HOCB 3VFTA 2Y2TA 1U93A 4XN5A 5FM8A 5IBUB 3CLWA 2E9WA 2V8LA 3CIQA 4UT6H 4HOWA 5I8KH 2F5AH 1H8NA 3CMGA 1IB5A 2NR6D 4S1DD 1Q0XL 1FRGH 1XD1A 5EU7C 1OPGL 4HFUL 3QIBA 1UM4L 4TUJB 4TUJA 5I17B 1L9SA 1PTZA 4PV9B 4QRQB 5I1CH 5AZEH 5C97A 5TQ2H 1JPFA 5T8IA 4R7VA 3SODB 3D2UA 4Y9FA 2QQLL 3GSWA 1M7DB 2Y6SC 4QHKJ 1IQDB 4LF3B 3HN3A 1QO3B 43CAA 4PIBA 2VKWA 3D18B 4S1DC 1KBKA 4LL1A 2P4AB 1IAII 3DX9A 5CJQH 2B1HH 2ZSWB 5DHVA 1PAMA 1G9ML 4PS4H 3QRGL 3BKJH 2IDSA 4G71B 1ACXA 4QRSB 3BZ4A 3ULVC 2UYLB 5HDLA 5ABZA 1B2WL 4LGRB 5F2FA 2R51A 3HB3B 4GH7B 5DC4B 2XKNB 1AYOA 1W72H 2VZ3A 3UDWA 3CJJA 2VLKB 3ZE2B 5G4NA 3O4OB 1C8PA 2O5YL 1V8HA 1FORH 4GRWH 5T1MB 2SODB 1JZIA 2ZXDA 4JKWA 3HI5H 5ENWA 4DUXA 1CLVA 2VLRB 5EORL 4AMWA 3W81A 1H3PL 4FGMA 3UAJA 4DGVH 3WXVL 5DFTA 3KW7A 3QUZC 3MNWB 1NPJA 4CADA 1E5YA 3DNKA 4YLCA 2WLYA 3MLRH 2PWEA 2CUMA 4F9PA 3NACL 5AVSB 7FABL 5IQNA 3WIFA 2R0WH 3ES6A 3GDBA 4KMQA 4L4JA 1FYTE 1DCLA 4OV5A 1JI2A 3ZTNH 3QEQD 3SEPA 3L4YA 3MACH 1KWGA 2VXUH 4UQ3B 2WJ7A 3FB8A 1QQDA 4ONFH 3DGCR 1XCTB 1XCTA 2WSPA 4EPSA 1VFMA 2YD1A 1BFOB 4XNMA 4K71C 1JNLL 1L9MA 3IPBA 4U1JB 3AAZB 1G84A 5EBMB 3DX7B 2H32B 4ZPTA 1DQJA 3SOBL 2ZF9A 1TU2B 3ARTA 1BZ7A 4P46B 5BXFA 5DEFA 4U4IA 1MW1A 1FO0L 5SX5H 4WFED 3K81A 1BGXH 3DRTA 4ZNEE 2VE6A 2YKLL 2F5BL 2K7PA 2RIKA 4AW4A 1QYGL 4JFZH 2VT0A 5CWSA 4IHOA 5E51A 3D3VA 4N5ED 1HINH 5D70H 1JWMA 3ASOB 3LV3A 4XCNB 5F9JA 5E23A 1QKZL 3QUXA 4PREA 3NG5A 5BUGA 2RGSA 1KJMA 3PL6C 3I9GL 3HE7C 5CINH 1NCBH 3LVTA 1PNCA 3U7YL 3VI3A 5KYWB 5GZOA 1XGTB 5F1OB 3IT8D 2XV3A 3DIVA 2AXJA 4M03A 5E8DH 5J1AB 2AABH 2YQGA 3VFWB 3U4BL 4L0ZA 1L9QA 2YAHA 2PPCA 4YHLH 4E9SA 5CMAA 2CIKB 1MG2C 2R4SH 2B7DT 5D96B 1DYZA 5ICUA 1RZ8A 4HHWA 4JQIH 1DVFD 4JZOB 4GKZB 4A63A 1MEXH 5EO9B 1SN5A 3IU4L 2EADA 3DETC 1WS7A 2FK9A 5TK4A 1T66D 1IGIH 1TVBB 1GH7A 2D4FA 1X5XA 3DX9B 1MFCL 3D18A 4MA1B 5GIRA 5D5ME 3V7AE 2W65B 2CA4A 1NCCH 3EZ8A 4CA4A 5F7HA 3QULB 3BVTA 4Z7WE 5DZVA 1YNLL 5ILTL 2UUDK 2VC2H 1VB9A 2ESVB 4UT9A 1CICB 4IBQA 3L5JA 3AY4C 4KHTL 4RWHA 4QHLA 3GMPA 4XZUA 2ZUUA 1VAHA 4J1UB 3VWJC 3QCUL 3KLAB 2EDYA 2GJRA 4MMXA 3K6FA 4RFEB 4JO3H 4PJ5B 5DD1H 5L6YL 4HJJL 4FQLH 3EOBB 4Q56A 3KL3A 4I0CC 2V9RA 2FLMA 5FOBA 3CDZB 4PGDA 5EO0B 5AKTA 4P2QA 5FOBB 3KYNA 5EOQL 5SWSD 1CTMA 3KPLA 1PMYA 3QRGH 4HIHA 3TEUA 3T0WA 3ZE1F 3CDCA 1BFVH 1JFHA 3B9KA 4XWOD 4I3GA 1I3RB 5FDWB 4Q7DA 5FGBC 2IQ9L 4Z7IA 3WNOA 4KVCH 4ZK8A 4E9WA 1BLNA 3EHBB 4HKBA 3JUZA 1L0YA 4YBLB 4M5ZH 4HUNB 4HKXB 3WJMA 2J6EH 4LSUL 1TJIL 4BDVB 3P0YL 2TSBA 4LLQB 1QNIA 1TTCA 4YHOL 4F15B 3UTTD 3JV6B 4K71B 5E0QA 1TZIB 4ZOBA 1QVOA 3Q2LA 2JVUA 4X6CA 4IBYA 1QR1A 3LIZL 4R96A 1I7TB 4YPGA 3PWJB 2L04A 2Z35A 3L54A 3D69A 3KPOA 4AH2A 4M9OA 2F0CA 4UQBA 1A1NB 2VDPL 2ZPKL 2WZ0A 4OCNC 5IW6B 5E95B 1CFTB 4RAVA 4NPYB 2LT9A 2VH5H 2CD0A 1CGVA 1Q90A 3QA3A 2HP4A 5J6HA 1SHSA 3PJSB 4YSTA 1JWSB 1A21A 3HI1A 3CXDH 1QTSA 4ODXB 3VXRB 1MIML 3SGJA 3MUGB 5FYLD 4C58B 4B60A 3WTXA 4KFZC 3GB7A 5KYWA 2WZAA 2OR8A 3KDMB 3QQ9D 4HETA 4DFIA 4G6FB 4ZS7H 3S4SG 3B9VA 1CD0A 2IAAC 1M6UA 1RFDH 1FZOA 4UUJB 3HEIB 3VWKB 2MPAL 3QDGD 2BRRL 4N9GB 4YDLB 3FMGH 2VKXA 1YY8A 4LLWB 3WE6A 1Q94A 4AYBA 2WBJA 3IGFA 4FXLA 4LMQI 2HRPH 4CVZA 4G8IB 2AFNA 4KMTH 3RGBA 4H20L 3AAZA 2Y07L 4LVHC 1TQTA 3EGXA 1WBYA 2R0ZH 4IOSA 4OFYD 4XX5A 5EU6E 3RWJA 1BIHA 3GMLA 5AVYB 4NT6A 4XP9L 5I66B 5AW8B 4AKOA 3FW6A 2OMXB 1B0RA 4Y4FA 5D2NE 2WQVA 3UPCA 4ZMAT 2DDQH 1D5XA 1X7SA 5IK3A 4G43A 1NBZB 3BX7C 4APQD 5DJDB 3T77B 4LSTH 4WZ9A 1R19A 1EHXA 4Q9CA 4YSAA 3FZUC 3SSGA 2ZCLH 3VTTA 2EQDA 2H6PA 2UZYA 4B7IA 2FWOB 1ILSA 4JCLA 5E8PA 3MOAL 5GXBB 1RVFL 5TQ0L 4XHJD 3KLKA 3TCLB 1A6TA 3MO1A 1J1OH 3C5SA 4I9XA 4Q6YA 1LO4L 3CFJB 4MX7B 3LKSA 2WBXA 4HH8A 4YBLC 2JTYA 3L7EA 2FSEA 2FJGB 3C6LB 1XHHA 3QC6X 2WB7A 1KIUB 3BVUA 4HOZA 2YKLH 2CM5A 4IQHA 1HE7A 2Z31A 2F18A 2UZIH 2CRZA 1LE9A 1Q0XH 4MA8L 4XP1L 3VI3E 3HAEA 4PRNA 3QYMA 1MF2L 3D34A 4ANWA 4E0RA 5D72H 4FQQA 3VXNA 4PQXA 2WTOA 1KJVA 5HHPA 3NFNA 3RE0A 5LUMA 3L7FA 3TP4A 4JVPA 3JTSA 1I8LC 2VERN 1L9PA 3B7RL 5C07A 2VDMB 1C8QA 1KNOA 1WZMA 4N2EA 1G1CA 3OR7B 4Y2DC 5DSCA 1XF3A 2AJVL 4NBZB 1T1XB 1TKWB 5E4EC 5FFLA 4JRYD 4OM1H 4X6BB 2NY4B 2P5WE 3IE9A 4Z7UB 5KVEE 2BIOA 3UERA 1UGNA 1XXDC 3O6KH 4HF5H 2OKMA 3V4PH 3EOAA 4MJ5B 4NQSA 1GSKA 3O0RH 3SDXE 5HHQB 5I1EL 3CFEA 5CGMA 4ZUUA 3LSOB 5CU5A 1CTNA 4Q0XL 1OY3B 1WWBX 2A9AA 3IWVA 3O6FC 4L4VE 4Y88A 3R8BB 3X13B 5LXVA 2GFBB 3SDDB 4AQ1B 3FUJA 4L0YA 3ULSA 3VXPA 4DO5A 1F2QA 4U6XA 1CT8A 2C9PA 3JVGA 3VUAA 3NGBB 1JG9A 1ZXQA 3BVNB 4LSQL 4CU8A 5IREA 1JYVA 5D5MB 3HZYA 3UBXG 3CN4A 1UWYA 2X6MA 4FEMA 2Q87A 2WD0A 2H1PL 2VRKA 5TF1H 4F7KA 3PIQA 4LOUD 3L3KB 4B9ZA 5JA8B 3WMPA 3TYFB 5I75C 1AYRA 4XNXL 3WEBA 3K5SA 3L17A 5CM1A 4PCSA 4WY7L 1UH4A 3N04A 4JPIB 5AVWB 3BQUA 1RPUA 1DQML 2FNWA 4JDVB 4E41D 2VABB 2M1KA 1NC4D 2JXMA 2ETWA 1O5DT 5SX4H 4DGWC 4TUUA 4Y1AD 1INDL 1T04A 2NY0D 1ZHBA 4XE5B 3V6ZA 4BK4A 4UBDC 2A0LC 5HYIA 1MH5A 4ZFOL 4FP8H 1EJ6A 4G8AC 2OMYB 3RPBA 1ZT7B 3MR9B 1AHMA 5CBAA 4GXUN 3GKWH 4EUPA 4NXSA 1THCA 1JD9A 1QABA 4OFDA 1UJ3C 3B9KC 3ATFA 2J2ZB 3LQMA 4U1IA 1CB4A 1OB1B 4QRTB 2J6WA 5HGGS 4MJ4A 3V4LA 4A6YH 1AQMA 3MNVA 2X70A 2UWEF 2VLJE 1N67A 1T2JA 2DQGL 1TJHH 2H1LM 4LSRH 5C3IA 3KPRA 2DDQL 1T5XB 1JHTA 3G5YA 3BZFA 3LQZA 4YHKL 3AU0A 2XETA 2Y06L 3DMMD 3R06B 5FF6A 3GUTA 4ALAC 2O6PA 3NK3A 2FWLB 4AITA 1RZQA 2AK4D 2H0EA 1F8TL 2TRHA 3TZVB 3GMRA 4MAYC 4NC2B 5C0RH 2F08A 4HCFA 2ZXCA 3NZHH 3JTSB 3ZMNA 2FQEA 4Y2LA 1ZVSB 3L7FB 4UM8B 1KOAA 5EA0H 4N2KA 2VN4A 3PABB 2Y36H 5I76B 2DQGH 1J05B 4L3EB 2XNAB 5I8CB 4UU9B 2IH3B 5IFHL 4GAYA 1F4XH 3LZRA 2A5UA 5DJDA 2A6JA 3T77A 3CE1A 1A3LL 4MD5A 2OS7A 4OUUA 2XN9B 3EJYD 4R7DA 4NC1E 4YO0B 2PCPA 3KXFB 1MVYA 3KXFA 4S1QH 1UCBL 4ZS6D 5DJAB 2I9LB 4YFDB 3VH8A 1DJZA 3E6FB 3HNTH 5CCKH 2VLLB 1EV2E 2ICWJ 1D9KA 2AXHA 4Z7QF 3IRZA 5EV7A 5FLUA 5GSRA 15C8L 1HSAB 3VG0H 3BLBA 4EIUA 3BW9B 5DFAA 2WYZA 5DJZB 1ZGLP 2G5UA 2P8MA 3ZZ1A 3C5ZC 4JFTA 1YNKL 4ZFOB 3CVHB 4K9EC 4Q6IB 4ZS6C 3X17A 3Q8EA 4DQAA 1BPLB 5HHNA 3RTQC 4FABH 2GJ6E 4C47A 2EDOA 3LN5B 2Y22A 4JRXA 2KZWA 4L8SC 5T33H 3E1ZA 1CK0H 4EE2A 4AXWB 1QPPA 3U7AA 1FVDB 1E8XA 2H2PC 2OR9H 2JIXA 5GGQL 5TDNB 5EG6C 4IK7A 5GS0C 1WBYB 1CLZH 4P5TC 4FA6A 5LXGL 2WLIA 3EO9H 4HIQA 2DOCA 2WXLA 3TFBA 1URIA 4X8GA 5J6HB 1F4HA 2OJZL 2WTRA 1EZUA 2Z8WC 3FFCE 4FN0A 4XXDA 1U3ZA 2D7TL 4TOYH 2FATH 3QSKB 1RZFH 1KCWA 1YEGH 4XMKH 2R29L 3GC3A 2EE0A 5C6TL 1OXYA 4X6EB 3MRCB 4WW1A 5AAWA 1RUPH 4GUOA 3MI6A 2ZOKB 4K3JH 5GHWH 5I19H 3PY9A 1MHHA 5DR5L 4QCIB 5F7DB 4XNAA 4UV7H 5HVFB 4P3DB 2FEJA 3GBNH 4QXUH 1EHNA 2XPZA 5GRVK 5I1HL 4QYOA 4DEUA 5F8RC 4Q8BA 1RY7B 3ECBA 3KS0J 5T3XE 1WC7B 1WEJL 3MJWA 1F13A 5EUOE 3VI4E 2AI0H 4ZSOB 4BD4A 3IXAB 1KCVH 5A2FA 2ENYA 3PNWA 3B9DA 1QWNA 5B21A 3O4LD 1BQRA 3QUZD 2DD8L 4N2LA 5FGSA 2ATKB 5BUAA 2FWUA 5EU3A 4AMKL 2JKWA 4UB0H 4Y9GA 4ZQKB 3TWCH 2AABL 4GRMB 4MA7H 1S9XA 1YMME 2AMUA 1LE5A 3ZUCA 4PJGA 3KYOA 3DPDA 4IEFA 2DJUA 1FJ1B 3OMZA 1GL4B 4M48L 2WANA 3NFNB 3EYOB 4I77H 4RRPM 3SDDA 2DLGA 1DDTA 2WO4A 4FQIH 1WYJA 4LIQL 1R5WA 4QPEA 5DCCA 3UAJC 3FB6B 2NXYC 3HE6D 3MXVL 4LQFL 1TO5A 1RJLB 1DL7L 3BDYL 4FXTA 4N22A 5MENA 4JG9A 1MELA 5FW8A 2H3KA 3UTSD 1G7PA 1MRCH 2FECL 1OW0C 4R2GB 5E1GA 4X7SL 2V17L 3WIHA 2OTUA 3MRNB 4AQAA 4U1GB 3V2AR 3B1TA 4MQSB 3SE6A 3F85A 2QELA 3D87B 2ZD0A 5CLXA 4K3EL 2P5PA 2LFGA 4HCRH 3EDFA 1T3FB 4LHUB 5AYTA 1DSYA 4NBYB 2IMMA 1CGXA 1NA8A 2CKBB 1PYWB 5ABDE 5JW4Q 5F6HJ 5JXEC 3W11D 2JJSA 2XXFA 3OZKA 3ZYOA 1A2YA 1DN0B 3Q5YA 1QKZH 4JO3L 2VDNH 1NC2D 1KT2B 1ZHLA 4N2IA 4HDIB 1Y18B 1CDUA 3LY6A 5E8EA 1P4IH 4BFOA 1USZA 5IHLB 3O2VH 5DK2A 1TCRB 1D5MA 3QO1A 4HYTB 4G8FA 1AHWC 4XAKD 5L4IA 3MJ9A 4FQIL 3I6LD 1A6ZB 1XIWC 1MCDA 1BEXA 1NAKH 1XB6A 5F9OL 5J1AA 1IL1A 4DF9A 1U6AH 4UT6A 1WH0A 4ELMF 3ZVVA 2J56A 3TYGL 4L4VB 3MO1B 4RNRB 4KRPD 1BQHB 1OWRM 5E6SB 1CIDA 5SX5K 3ARGA 3DGGA 4O2CB 4AE1A 1AG6A 2DKMA 2XY2A 3K8KA 3O4OC 5FK9B 5AZEL 5ANMB 4I8DA 1JGIA 1B0IA 3Q6FB 5EO9A 3QVAA 2X9YA 4HUVB 4P59H 2X53A 3PP4H 4Z7VE 1BWMA 1JHTB 3LQZB 4U3SB 2HG5B 3WNKA 3OKNA 2VAAA 2WUCL 3WN6A 4KRMB 1WG3A 2E9BA 4B6ZA 1NC2B 3F58L 3DUUB 2QQKH 3IYLW 3H9SE 4UQ2B 5LGJA 2CUAA 5D55A 1NIFA 4ONHA 4XN8A 1JD7A 3QO0A 1BMGA 5DVMA 5IHUH 5D1QA 4EN2A 2YK1L 5T1KD 1BP3B 1MFMA 3KCPB 4XBPA 1KTJA 4LCWE 1B0GA 3RGVA 1FH2A 3T0EE 3WNLA 1MLCB 2B1AL 1SXNA 4P23A 1O6VA 3B2UC 1PJWA 2HT3C 1HNGA 1BMZA 1OB0A 3IXTB 3PXLA 4OZIA 1MH5B 2WBJB 5D71L 4ZYKA 1J11A 2Z93B 4Q2ZA 3AQXA 1RCYA 1N19A 3TBYA 3P4NB 3BCDA 4PTTB 2E7LA 4RSVA 3KL5A 4I5BB 3W82A 4W4OA 5LXGH 3OHXB 2NXZB 4NS0A 1KPUA 5KBPA 3K8LA 1BZ7B 3K74B 1DJGA 5AQ0A 1A3RL 4DKFL 2A99A 5J4MA 3EJJX 1RK1B 2QEJA 3LJ3A 1J12A 2NQDA 3HC0A 2X2IA 3Q3GB 2VMDA 2R56H 4KY1H 5DLMH 5SWQA 7PCYA 1ECZA 4IW4C 1YPZA 1FYTA 2QSQA 2JKRM 4M93B 4XC3H 5BV7C 3PREA 1WZ1H 3GMNA 1NFIA 1ZXKA 2YRLA 1N8ZA 2YWZA 3BISA 1CXHA 4BDVA 4MJID 1JVOA 1P1VA 3H53A 4HT1H 5A2BA 3HZMA 4J3VA 1VZHA 3D2TA 3LQAH 3HBGA 5ITFA 3LKOA 5IVXB 3F65A 1N9PA 5HD8D 3FONA 1HS6A 3HZ3A 3WS3A 1FNSH 2J20A 3CBKB 3L6FA 3L4UA 1GZPA 3KPLB 1BOGB 1LGVA 4XC3L 5HHMB 4KTDH 5EU6B 1QRNA 4U0RB 5DJ0B 1HCFX 3D05A 3FO2A 2P5EE 2KLTA 1VERA 1KC5L 3MRPB 2B1OA 3F7VA 2WKOF 3DX2A 5J3HD 4W6XB 3R0MA 4G3YL 3UO1H 1U3HD 2UZPA 3JT0A 2L7QA 4G1MB 4WUKL 3GEFA 2HRLA 1QPKA 5T5NG 4KX9A 5EIIA 1YJDL 2DJSA 1XGZA 2I07B 1CU4L 1CLYL 4J5VA 4AGOA 4CN6A 4UTAL 3MLZH 3MNDA 3QJHB 4F7EA 1EA9C 3F7PC 1DVSA 4I3RH 4NQCE 4XN4A 4NENA 2N59A 4G80A 5E2VL 2G30A 3UL4A 1OD7A 1PLBA 4KGJA 1FNEA 3DK0A 2YUWA 2IQ9H 4I0KA 1RKRA 4Y4HC 5JXEA 1ZLVH 4G6JH 2FCBA 4NUQA 4N8VA 1KXQE 5ACLA 1I8UA 3G08B 2J55A 3G6DL 1LJMA 1PX8A 2YXWA 3ZSSA 4AC2A 2XN9D 5B1AB 5EZPA 5AB9A 2DIAA 4C8XA 2C9QA 2CMRH 3VX0A 3L95B 5JXAL 3ARBB 5T5NF 3U1QA 3M1OA 2XWJB 4CNIA 3ALPA 1AHKA 4QHPA 3IJHB 5DU7A 1MDAA 3AMKA 1ZT1A 2PNDA 4G8GA 5ESQB 3UO1L 3AT8A 2LU4A 5GS0H 3KZ8A 1JK8B 4M61B 3H6JA 1HWGB 3FS9A 1FYTB 3UZVA 3CAFA 4PB9H 2BZ7A 2LABA 3VW3H 4KZDH 1INDH 4JO8A 2OA9A 4DOHE 4X80L 2HSIA 2A73A 1MHEB 4I2XA 1IAIL 3O9WC 1FAIH 1M7IA 2K70A 3EO1B 3LPWA 4WV1A 1EJOL 3RBSA 1ML0A 2GBVA 1KLGB 3UBGA 1IAOB 2CGRL 3FONB 3WS3B 2WUBL 3Q8FA 4HD9A 4X5QA 4PTTA 5I74B 3GRWL 1RHHA 1U42A 3QI9B 4HZLB 1FWXA 4XMVA 4WKXA 2QLYA 4Z0BL 3T2PA 2FJSA 4QTFA 4UANA 1UD4A 1ZTXE 5KYXB 4PRIA 1UYWH 3MJGX 1XH3A 2YBRB 2YHGA 4ONFL 5JW5B 2VDLB 2A83A 2ED6A 4XP4L 1ESOA 1A4JB 4XVJL 1YPZB 1RLWA 3N41B 3EFFB 2J88L 3P2BA 4ZSOE 4PWGA 1CS6A 5DVOA 2F53E 1DQDL 3LPGA 4GI6A 4WO4D 3W9DB 1H3WM 1Y1UA 3C08H 4JW3A 1IT9L 3VE0B 2ZX5A 1AANA 1BEYH 4TUOA 4QXVA 5FV2A 5HP5A 4YGVA 4HW6A 3V5HB 4OB5L 1M2VA 1SJXA 2JQAA 4Z7UF 5KANG 3WFEL 4AGPA 5ICZA 4U0RC 2Z3FA 2ZAIA 1TU2A 2GIYA 2W9EH 1JPST 3QDME 3Q8CA 3MFFB 2PO6D 3QH3A 4GO9A 1SQMA 1F00I 4MNGE 1AO7B 2B20A 4IDJH 1FPTH 1TITA 5SV3A 3X1GA 3QRLA 3C60A 1OK8A 4KUCD 4AQ8C 3FF7A 1K5NB 2VH5L 5A2CA 5AENA 1I8LA 2CBQA 5C0JA 2AQRA 5AW2B 4E9QA 1NDMB 3M07A 4JFDD 1JIBA 4RFNC 1T80A 5L0QC 1ADQH 2ZUWA 3OAUH 4PRHE 2XQBH 3BP7A 4ZAKB 4WK0B 4CNIB 1KWKA 1YYLH 5E8NA 2PR4L 3FUFA 3MBEC 4M3HA 5A6IA 4ZUSA 1OCWH 2CXGA 2R0KH 4R2GC 5I8EA 4WWKA 3ZK0A 3D9AL 1BFSA 1D5RA 1QHPA 3MV9A 3VGEA 2VO8A 3BKML 5CEZE 1J05A 4N2NA 2NX5A 4KQ4L 4XNUH 4Y4HB 2Q7NA 3GIZL 4IKKA 5KOMC 5BNXD 3KXFD 3L4ZA 3QWNA 1J8KA 1SJEA 2WLNA 5L9DH 4JFHE 5CFAA 5JORA 1SLWA 4X4ZA 5E6RB 1S7TB 5B39B 3QAZC 3D06A 4WHCA 3CBRA 2B3IA 1YQ2A 5JYMA 3W0WB 4Y9BA 2G5BB 3TBVB 1IL1B 1N59A 2NTFA 3LS4H 3NFPB 1C5CH 1R5VB 1MCRA 3P4MB 3TM6A 3CZSA 4KI5D 4WU7B 1K3ZA 2J71A 3VFRA 4O51B 3PFUA 4Y4FD 1S7QB 1JXGA 2AAAA 5LNDA 2CO2A 4QRTA 3LB6D 1X5KA 4A7UA 2Z7YA 3CVDA 4X4XA 4HOMA 3GJFK 3X14B 4FE9A 1XF2A 3FB6A 2LLLA 2GTWB 2Q9OA 4C4KO 4LOUC 3WTYA 3ARPA 2GTZA 2OFQA 3VSVA 3TTYA 4TSCL 1I1FA 5GSVB 2WNWA 4FZ8L 4LDLB 4P2RD 4J3TA 4R3SA 3LZFL 4YHYC 3BSZL 2LU3A 5BZXA 3QHFH 3B9KD 1AH1A 5KSAC 3MRDA 3KJ4C 3QFJA 2DQDL 1YEGL 3QORD 4B95C 4X6CE 5JIKA 3U6RA 2PXYA 4OQTH 1OPOA 5E9AA 5C0BB 3ZDXF 2PABA 1SN2A 2BIQA 3AREB 5LG1A 3C8DA 1IC0A 1FZMA 1V27A 2JI3A 1Z3GL 2AW2A 3QEHA 1XF5B 5E0FA 5HHMD 3RTLA 4XHJC 3K46A 4YXKH 1U91B 4NZUL 4QRUA 1MJUL 5AW0B 1J0HA 1MNUH 5KS9F 4ODSH 1TMQA 5DFVC 1SOXA 4MHHI 5KSBA 4ZODA 1GOGA 3KYOB 4JFQB 5BQDA 3ESNA 1MUJA 4YBQC 1FL6B 5EIIG 5I9QC 4GAGL 2EEXA 5AOJA 2CKNA 3O6LL 3IRCA 2O6CA 5J6SA 1JK9A 3AJ7A 2G3MA 3ELQA 4XNZC 5IGXH 1ACCA 5HDBE 4BSJA 5D96C 1DLFH 1NGPL 2OJZH 3O4LB 2ZYHA 1O6TA 2JB6B 5IB2A 4JY4A 2OM5A 1JMZA 3D4CA 4JBSA 2DPKA 1KLFB 1RUPL 2D2CC 2BSRB 2D9QB 3CBJB 4ZZKA 1QA9A 2EC9T 1BF5A 1YLBB 4PVBA 3GO1H 1WZKA 1ZDQA 4IGBC 3WKYA 3H85A 4PS4L 5CLWA 4U7MA 2VXSL 5EDXA 4I18B 3GSXA 1HDMB 3CHRA 4ZFOA 1L0XA 3DDGA 2CA3A 1CL7I 3D7PA 2IPTL 1KBGH 2P42B 3I84A 5EUOB 3VI4B 1ACYL 4ZPVA 3GO1L 5E6IA 3TO4A 7CGTA 4BZ1L 2VTFA 4A39A 1EJOH 4MCYB 5DJAA 1HVXA 3BYYA 5T5FH 2JIXB 3WHXA 4B27A 5BW7C 5C0AD 1FI8C 2WSKA 1FN4B 2ADJA 4XN9A 3VXUE 4WSJA 4RBPK 4X83A 1P53A 1OAQH 5TGBB 1WHPA 5FW7A 3KM2A 4MX7A 2BOLA 5KAQG 5L8LB 2BFGA 2UXFA 2H3NA 5C3LD 3W2DL 3Q1EA 3WXWH 1F3DJ 1KIRA 4KI5E 2XKSA 1F4XL 4FFVD 2P44B 2VMEA 4JRYE 5I8OH 1M1XB 2GJ6A 4ERSH 1WCQA 5DRXA 3S3PA 4MXVE 5DRXB 2CO3A 3V4VH 1E7VA 3VRLF 1N7ML 4LLMA 4DJMA 3Q2CA 1P5VB 3OZ9H 3EH3B 3TPKA 1BYPA 3MGTA 4QTHB 4AYEC 4GSXA 2K4AA 4UV7L 2X4TB 1CK0L 3HS8A 4YHIA 2V6HA 2XQ0A 5KJ7E 3QJTB 2IAMA 2Z64C 3AM8A 4G7YH 1R47A 4MDIB 3ABGA 2K6YA 3KPQA 4DGYH 2XN9A 4U1IB 5ISZE 1CO1A 4P4KB 4MD5B 3MBXL 4F58L 3FQRA 5D4HA 5EZOH 3RWIA 4G6KL 3ZKND 4PIRF 3WGVB 2VZUA 4PJIF 3P2DA 3BUYA 3UTTE 2XQYA 4OZHB 3KBFA 2IALB 5EZIL 1SVBA 2WWNA 3ECWA 4K8RL 1LO5B 4WLCA 1LE5B 1F18A 2HN7B 2PPDA 3F04A 4R84A 2XQBL 4MCNA 5F70A 4JLRB 4Y7MA 3O2WH 4I18A 4ZXBA 4TUKH 5ELIA 4G5ZH 1MCJA 4APXA 2KQNA 3BP5B 1HNYA 4Z3TA 4FYTA 5DUMH 4UUJA 4B53A 2YGPA 4KO9A 1IX2A 2R1WA 3QK0A 5I74C 2J4WL 1G7PB 3ECBB 4JO1L 4XNDA 3HIZA 1B9KA 4I13B 4XE0A 1JHLL 4PRHB 4JFZL 1DUYA 3TO4B 3HZKA 4G7RB 1C08B 3U9UA 5C70A 1JS4A 5MHSD 4YBHA 5SX4I 3ULUD 1O9VA 4HT1L 2G9HA 5D7JB 4IJTA 1RLBA 3K2KA 5I73B 3OHMB 3U9WA 4QRRA 1EDQA 2O5NA 2YN3A 5DWUL 3QEQA 1UM5L 5IBLC 1MW3A 4R5TA 4HS8L 2EINB 1ED3A 1KYOK 4XO9A 3GZKA 5AOLA 4U6XB 3SQOL 3TBTB 2AQTA 4NQEB 3X11B 1FC2D 2R4SL 4AV0A 2NY3C 3NFSH 2E6QA 5ETUA 4HX1A 4JFEA 4PRHA 3N42B 1E8WA 1F4YL 1NCOA 4ZMZA 4MJHA 2H6UA 3US1A 2VLME 3CFUA 1YUKB 2F7IA 1J9QA 1GJWA 1PCSA 1UZ6F 1PIGA 4GEJA 3IMRA 2OCFD 4G9FE 1AAJA 2BSSA 4XVTH 2EIMB 4N2FA 2CLZA 1CFVH 3OZLA 3HUJA 4LCWD 2P9RA 4PJHB 1UWEH 3T0ED 3ZMRA 3GXFA 3RUGF 1DQVA 5EOTA 1U8NB 4KJQC 5CLYA 4IOIA 4P2QB 2QHRH 2O5ZL 4LNRA 1ES0A 3GS7A 2YSSA 4TNGA 3KH3A 4E0RB 4HH9A 3W0WE 1KXVA 4GG8A 4WQOA 3KGUA 4ODSL 5PAZA 1OP5K 2A9NH 4HUUB 4A66A 5KSAA 1E5CA 4X7EC 1EAOA 1KCUL 3LAFA 1A6VH 1OQOA 1GZHC 5FS5A 1U2YA 4LLVA 1LP9E 4Y2DB 1A9VA 4N90D 4XCEA 1JDCA 1TKWA 1LEKA 5F96L 4HKZB 3AMLA 4U1HB 4NSKA 4GSDH 4H0HB 4NOBA 2DJ4A 3BGMA 5LG6A 1E4JA 4Q74A 5T3ZD 1BG1A 3S37H 1SZNA 2A6DA 1SEBB 3NCJL 5BO0D 3RY4A 1IEBA 4N2OA 1D9KB 2I7SA 1BVNP 5EU6A 5GSRB 2CE6A 2FX9L 2Y7LA 4LP4A 4X5XA 5DEGB 1JRHH 1J9RA 1TTGA 3MLVH 5I8EB 3IJYA 4PB0L 1OF2B 3P3TA 4ZFZA 2MCG1 4QXWA 5LCVA 3PFQA 3TJPA 3SJVB 3CIAA 2F7OA 3V0WH 3VFVB 5HDQL 1EEQA 2VDPH 2ZPKH 5K39A 3E6HA 1RQ5A 1KFGA 2V2WB 5EUKA 1FDLL 4M8UA 5J11C 1HZHL 3TN0C 1XGTA 5IVXE 2OQJA 5I5RA 1EQWA 4ZPVB 1ZSDA 2G2RA 32C2B 3DX8B 4WJKB 5B39A 1ACZA 2GBUA 2N4IA 2ZKWA 4FQXA 3LH8A 4JFXB 4PG9B 4TPRL 5DYFA 1T4KB 3SO5A 4XNQA 1U3YA 3L5IA 5FGCE 5F7BA 4OCWL 1IT9H 3S36L 3AFLA 1Q1JL 1E2VA 4PY7A 4M6MH 3WNPA 1RZ8B 3GSVB 5FXCH 2W60A 4RAHA 2NW3A 5DHYB 3MCYA 3DVGA 5EBWA 3KBPA 1LQSR 3GSQB 3EGDA 3L5XL 3AXIA 2VUKA 1OLZA 2D3VA 3RDTD 1I9JL 2J12B 2MSPA 2EXYC 1ZV5A 1J1XH 3K0YA 2SEBA 2H0PA 3HG1D 4ALAH 2JCCB 3UTSB 5C86A 2J73A 2CG9X 3CH1A 4CVUA 1QI4A 3L1OH 3ZPDA 3S4SA 1E27A 5C0IA 5IHZB 1S5HA 2WQXA 2CU9A 4G7YL 1EEZB 2EE6A 3NSDA 4U1LB 1RL1A 4UMSA 3W9EB 1HT6A 4P4KD 1ZKAA 4I18C 4YSEA 5FYJU 4PJ9A 3T2NH 1T6VN 4IKNA 2FGWL 4JFFA 4L8DA 3TZVC 3CFEB 1Q9OA 1V5JA 1IBDA 4Q4EA 4NO2B 2OMWB 4CU7A 3L3HB 1EXUB 4NUMA 1N70A 3GZPA 1TJIH 4GT0A 3IMBA 3O3UN 2VYRE 1M05B 2DQMA 4O00A 4C56D 4DO4A 2GJZA 3PWPA 3WTSA 2VRAA 3LH2L 2AGJL 4L1HA 4P9HC 5IW1A 3MREB 5IFJB 5GGRY 5E8DL 5DMKA 5ISZA 1ADWA 5C09B 3S3DB 3K71B 1E5AA 3RHWK 3ZZSA 1CR9H 1U8QB 5FUCE 3CDZA 4PGDB 5EO0A 3RBGA 5ISZD 2ENJA 4BQ8A 4CADB 3INUL 5H2BA 2AK4B 5CJOH 3RFZA 3AADB 1CTOA 2JIXD 4XO8A 1IFGA 2FBRA 3LHPH 3TH4T 3EYQD 3HG2A 1CD8A 3ARWA 4F7MB 2DI9A 1MRDH 3VRIA 1B90A 1SXZA 2P8PB 3EFDH 1DZBA 1KGXA 2VRQA 3QUMA 5IROD 1DBKH 1T20A 3QUMB 2PYFA 1XGQB 3CN1A 5EBGA 1OAUL 1UOLA 2IQAA 3B5GA 4U1KB 5GS0L 4DVBB 3ILEA 4OZGB 3EF7A 4BINA 3QT2A 3CSYB 4EEEA 3VRJA 3Q43A 5EOQH 5T3XD 1U93B 1ZD6A 2IBZX 3IFPA 3QORB 5F3BB 3CU7A 3BZEA 1HAWA 2CDFA 4OLYH 5L2KD 4Z7NF 5E8PB 1PZAA 4RVBA 1L5GB 3DX4A 4J23A 3CPLA 2XWCA 5HGHA 3ZU8A 3QCVH 1GZPB 2Q7YA 1OM9A 2CO7B 2IBZY 1RHFA 3IDGA 1KZYA 4PB0H 4OH2A 5FIEA 3CFIC 1ETB1 2FBJL 4PW9A 3VRLE 2JLLA 3FFCD 3QFGA 4MJ6B 5CZKA 2R23A 2R69H 3CFKA 1VFAA 1UZ6E 2PR4H 3SDXB 1JXDA 4JFFE 1S6NA 4JUTA 4OFKA 5E6ID 4EAEA 4UQEA 3GJFA 1EJFA 4KK9C 3CXFA 4NZRL 4FS0A 4N0RA 1F0LA 1OHZA 3T4AB 2GUOB 3ZTCC 4KJWD 3NPSC 3VYOA 1UKSA 1MHHB 2WIIB 4FMKA 1WQVT 4GO6B 4I48A 4OZ4B 4FFTA 1S5IH 5GRZA 2VMFA 4JAMA 3O41A 1Q1JH 3QIWC 3US9A 2YOAA 2CCVA 3W0WD 1S5HB 2QFRA 3T2OA 3QQ9C 5IHZA 3MA9L 1NUFA 5HYQB 3EG9B 2R9HD 2Z93A 5FHBH 3BZ5A 3WKML 4HC1L 5HI3D 4PSPA 1GA2A 2GY7B 1JZJA 3MCG1 3OKOB 3S36H 2P7TA 1I9RL 4YXHH 5L4JA 5KVMC 1XGYL 3EYFA 5KSUB 1SQ2N 3WXVH 3EGXB 4RA0C 5C7ZA 3FPXA 1DDHA 3D39A 3V4PB 3VMOA 2YBRA 3HFFA 2HCZX 5F7YC 3JWDC 1OAXH 3F01A 2XWTA 3NIGE 2WXQA 1QSED 1XSKA 3DARA 4LRNH 3RGVC 4AQOA 2DQFA 4DZBA 2W8CA 5KW9L 4UDTA 1DQIA 3QZWG 3RX8A 3UAAA 3EYUH 3HJEA 1DEDA 4L1DA 4Z7NB 1A8ZA 3SBRA 2WP3O 2DQDH 3BPNB 4NAMA 3ZRCC 3M7FB 1IGCH 4PCYA 1M42A 4GMTL 2QKIC 1T22B 4NN7B 4G9DB 4WUUE 4YQXH 3P4OA 1GMEA 2ICWA 4FXGA 4HMCA 1JNHA 3QDJA 1FBIH 3IJSB 2A83B 4QYAA 1UB5B 3JTBA 4J4PA 4AM0Q 4NYLA 1SMDA 4HKBB 4XNUL 2AEQH 4KITB 1TNNA 5DHYA 2YXVA 3MDJA 3C60D 1LO0L 5ANME 4Z1PA 4FX5A 5FYJH 2YPLE 1JUFA 3FQUB 4NHCL 1QBLH 3DX0A 2XA8L 1IUZA 3PV6B 4QRBA 3F00A 3RZCD 2BS71 1ZVSA 4UM8A 4BM7A 1PZDA 1UWEL 4J12A 3KLHD 4N0YH 3WL9B 2J4WH 1WFOA 5JPNA 2WXGA 1AGBB 2XZZA 5DT1L 1UKTA 1YN6B 3AB0C 3HC3L 4AENA 2NY1B 4LPXA 3F6LA 5FYKD 5SWSA 3K4ZA 1WUZA 3VVVA 1FCCA 1L9RA 1YUHB 3FQTA 1N68A 3FUDA 5D1XE 5GRWA 1F4WH 4Y5XA 2EDEA 3MA7B 3CXHJ 3I2CH 3WTVA 2ZONA 5FUOL 2EDLA 3KLHC 3IDIA 1MRFL 3NEOA 3FRPA 4XH2A 1UKQA 3S96A 2ZIDA 5HHOD 1YHPA 3UGXA 4DK3A 5BZDB 1BAFH 1LP9B 2HX8A 4DP2X 3S6CA 4ZD3L 1CLOL 4BIKA 4MWFA 5CEZL 2EYRA 1DE4A 3VSTA 3THML 3EOYG 2BNQD 1I1YA 4DEPB 2X6UA 3KLSA 5FYKE 1ZHBB 1GYUA 1IBFA 2AC0A 4OLYL 4QT5A 3OKEB 4PJGE 3RNKB 3ML9A 1C5DB 4RCAA 2E6PA 4OSUH 3FU7A 1HEHC 4CL7A 1X9UA 4UYQA 2NZ9D 4YZFE 2X42A 4LLUB 5EEWA 1TLKA 1DVFA 1I7RA 3HG1A 4QY8A 3AGVA 1ZOXA 3CDYA 4FMVA 3TO4C 3WXWL 3IDUA 4M93C 4XBEH 4FNUA 4HJSA 4PJBA 1NL0H 2F19L 1JHLH 3CFTA 3F8UB 1U8NA 3CHSA 1TQCB 5DHVH 1RD6A 5KVDL 4LIQH 5CD3B 3QWQB 1HXKA 1QBMH 1BQUA 1XB8A 4UINH 1JUFB 1VENA 3VXOA 4EN3B 3KM1A 3MREA 3OJDB 1I8MB 2QZ5A 3LEYH 4M7JL 4Z0BH 4PJ6A 2YGOA 4XO5A 2QGCA 4F7CB 4K9EL 3WNIA 5HYSG 5EFIA 2WOBA 3UTSA 4EMZA 3ULSB 3EOTH 3S48A 1MFVA 2CJSA 3Q6GH 2N7AA 4Z77A 4LSQH 1FAIL 3MTXA 4HIXL 3V6BR 4FYQA 2IANA 2VL4A 5HHVH 2EEAA 1OAXL 5I0VA 3PWPE 3TNNA 1PIFA 2LW3A 3IPEA 4YSPA 1S8DA 4DT2A 3G5VB 3RAJL 4PV8B 2XQYK 1NDGB 1L7IL 5GGSY 4LNVA 2NY2C 4A2LA 5JQIB 1X5GA 3SGKC 2L7EA 3AZUA 3DYPA 4TQ8A 3SBPA 1X5MA 3EGSA 3O81A 4JN2B 3K7UA 3VXSB 5DJZA 1QLFB 1FAKT 3RILA 1ONQB 3QS3A 5J1TC 2B15A 1NCDH 2BZCA 5HBBA 5HYJB 1OAQL 1UWGL 3CGTA 4YBQD 3UZQB 3FB8B 4EVNB 4JJ5A 1JN6B 4Z8FL 2R2CA 2UXVA 1WZAA 3U30B 5KANI 4C56B 3W2DH 5T1KB 4H8WH 2PKDA 2A0LD 4JE0A 3FT4B 1Z0MA 2PCPB 3RU8H 4M1CD 2NNAA 3VXTB 2FDBP 4BYHA 3MV7B 4PWFA 3UEQA 1CL7H 1OARH 1J5HA 5EA0L 2ESVE 5H37A 1MF2H 4FYSA 1ETA1 3WY4A 1KTBA 2VXTL 4BELD 4FTVE 1RZIB 3KVQA 3H8NA 1KY6A 2ORBL 1V55B 1OGSA 2WVSA 1K85A 5I1AB 3IGKA 2YJQA 1UURA 3GSWB 4OCWH 2QPDB 3QIBC 7TAAA 1MJ7H 3VD5A 3FUNA 3OKMB 1K8IB 2YPVH 1OSEA 4GRLD 2AXFB 4FFZA 1KUMA 2F68X 3C5ZB 1ZTXL 4GKNA 3FT4A 4N0YL 4D0BB 4GKNB 4CC0A 2HKHH 3GRBA 3FYEB 4YOKA 3GXNA 3CZFA 5A7BA 4JL2A 3STBA 1OE2A 2ZP9A 2HTKD 2QPUA 3OGCB 4L3EE 3AROA 2IH3A 3FFOA 5IF0B 4JEGB 1MJ8H 2EH7H 2XWEA 1Q9WA 2BS8A 1NGYB 3U4EB 2HRHA 1TEGA 1FVCB 3CFDA 2YC1A 2XUWA 4RA3A 4NKOB 2B0SL 2C1PA 2GI7A 2VLJB 3P4LA 4GW5A 1GGCL 1IAKB 4R4BB 4ZQKA 4YEFA 4H8VA 5CSZB 3NJMA 1BAFL 2WCGA 2EO9A 4LKXB 1DLHA 1MFDH 4FNLH 3H9SA 3C6EA 3F6IA 4YDVA 4CSZA 1I4FA 3ULUF 2MIZA 1XIWD 1Z3GH 3HPLB 4WU5B 5MENB 1UA6H 4MXWH 1ZJBA 4XVSH 4FCAA 4Z77B 5FHAL 1P7KA 3K72B 3LIZA 4P0DA 3GSOB 5EPMB 2AQ3A 1U8KA 3CVCA 1YA5A 2JB6A 5GJSL 1EFQA 1IBHA 4HA1A 4O2FA 4DOHB 1E8YA 1ZA6B 5F6IB 3K71A 3REVA 1PGRB 4TSAH 3PDDA 5C0BD 4JG1H 3ESPA 1R3LB 4MLSA 2I5YH 5CR8A 2CO6A 4PRPA 5TFSH 2CO6B 4PRPB 1UG9A 4FQHA 5I15L 1T03H 3NSJA 1EAQA 2JKSA 1GHFL 3BEVA 4KAQL 5IW6A 3M1BA 1G4RA 3SGDH 4P04A 2B5IB 3L3HA 5I6KA 1NIDA 2GFBA 5B22A 3TBCA 5G2NA 4GINA 1KYUA 2ZOLB 3N43B 1QSFA 3WKMH 3CPUA 3O2DA 3TN0D 3SPGA 5DUML 3L16A 3R4RA 3QG6B 4M29A 2HZHA 5MP6L 5C0CD 4PRAB 4K7PY 1N26A 5LAXB 1J5DA 3JQOB 2DEYX 2QVKA 5DEZA 4F7CA 1JOIA 3HZYB 1RZKC 5ILTH 4NZ8A 2O61B 5EOCL 3MRDB 3QFJB 2H1PH 1KJ3L 3HG1E 4MMYB 1KNOB 3CH1B 1J9TA 2YD3A 1K72A 5IHHA 4QRRB 1UJ3B 1T2QH 3U4EA 3BW9A 5JW4N 4L05A 4YDNA 3QJRB 5EWIL 2ITDB 3L9RB 2RAMA 4DVRH 1SJHB 1U4FA 5LHDA 5DK0A 3LPPA 4HWZB 3ZTNL 4MJ5A 2WK2A 3HHSA 5I0DA 2ZX7A 4M48H 4L0PB 5EO1A 3AM8C 3UTZB 3H3PL 3Q8AA 4H13C 4Z76A 2AEOA 2QPEB 5AG9A 1PG7W 1UCBH 1Z3RA 1DO5A 3GJEB 3HI5L 3F7QA 4WWID 1GPOH 2VR3A 2X4UA 3T9WA 2EYTB 4TLUA 3P3UA 5GRYA 5I76A 2E27H 3WAKA 2NXYD 3HE6C 5FUCC 1V10A 5EC2B 3UBXA 4OJYA 4FTVA 4BQBA 2YIHA 3EBGA 3MA9H 5JORB 4O02A 1QZ1A 3NJIA 3PHOB 5CBEA 1TO4A 5IG7B 4F1SA 1XQ4A 1Y1DA 4AJVA 1YEKL 4HHAA 2XN9E 1F8TH 1ET7A 5J3HC 2F2HA 4LOFA 5IQ7L 3D85D 3DO3A 2ITCA 5IJVA 1MI5A 1TZHB 3WDHA 4RWYL 4O51A 5GGVY 3ZE0F 2JTDA 1CXEA 3PHQB 4GUPA 2ED9A 5BRZD 1E9OB 3IJYB 2GSIB 4DP6X 2YMXH 3CQFA 1NEZG 4LEOA 1IE4A 4GXUM 3RVWD 2PWGA 3C8KA 4X0NA 4L3EA 4GG6F 1CXKA 1NAMB 4PLKD 5JPNB 3BD5A 4JZJB 3DSNB 2WN2A 5EUOA 1HCYA 4PREB 3VI4A 1OKEA 2FX8H 1JF5A 1S2EA 4H1LB 3QUXC 2GBTA 4MZIA 3MXWL 1WAAE 3DIFA 4OTXL 4PJDB 3ULAB 5I5IA 3OVUB 3GLEA 3MHZA 3H9SD 3B2UD 3U7YH 4WI9A 4HIJB 5BXFB 3E2HB 5FGRA 2J5LB 5DJ8B 4NFDA 4P5TB 4Q97A 2F58H 1OAYH 3ECVA 4GRWE 1GGCH 4NZTL 3FOMB 1DSFL 1ND0A 2FX7H 3FCUB 3TGXA 1JV2A 3MUGA 3FF8A 2EDQA 1QQDB 4OQ1A 5E00A 3M17B 3O3DA 5T1LB 4BH7A 5D5MA 1NEUA 3NAAH 1C1EL 2B9AA 1MFCH 4R9HA 4KFMA 1M2VB 2I24N 1G7JB 1ZLWK 2R0LL 3EUUA 2HKHL 3FCBA 2BSSB 3H42L 3O41B 3R7QA 1EWHA 2BVPB 3K3QA 1AMXA 2VDMH 1UJTA 3G6DH 5FCUL 2FR4A 2OSYA 4JDEA 3AT9A 1GGBH 4C55A 1KYDA 5ENWB 5FA3A 3S88L 4BCYA 2ZSVB 1D6VL 1A4JA 2J1YA 5GGSA 5IB1A 4HUKB 4PP1D 3QR0A 2E8ZA 3EYFB 5KSUA 4BBWA 5CHNA 2X0VA 3QIUC 4A2GA 4R0LB 2A9ML 5EMYA 3FCTA 4UT6L 2XG5A 4RISH 3ORJA 1F1GA 3N42F 3GXUB 4M5SA 4JFOA 4XCCH 1ZLVK 2Y7OA 5FO9A 4H4NA 3T8XB 1L9OA 1EIBA 3B83A 5JHLH 4M56A 2EDTA 3FBKA 2DLIA 1YEEL 4JAMB 4DN3H 3MCLH 3FFCA 2LFEA 5C3TA 1U8KB 4WHTA 2YXMA 5TDPA 3G5XA 4ELMA 1QVOB 2E9IA 4E9VA 2XZQL 2VLRE 1NDTA 3WUZA 4JB9L 4JDTH 5E7FA 3VX1A 3EDEA 5FW6A 3IJHA 4W9EC 5DI8B 5HHXH 4DVRL 1DJWA 3HMWL 4HUCA 1PCXA 3QZPA 4DGIL 4MQ7A 4F7MA 3S88H 3M6DA 4PBXA 3V0GA 1EANA 1WT5C 4JZJC 5EEZA 4M5YL 5IMLA 5TE7H 3PQYE 1F97A 4W9GC 3LEVL 4AUYA 4L3ED 2FAUA 2Z0UA 3NVQA 2IV8A 4FQQB 5CEYB 3VXNB 3WUWG 4W9KC 5BMFL 5LLIC 2X6VA 1AHWB 2QBWA 3HUJF 3BZEB 1Y7VA 2B4CH 4JFPA 4PP2B 1UADC 2UWEA 1TIUA 4L4TA 1YNTA 2WUCH 5ACMA 2FO4B 2IWFA 1NGXB 2H8PB 1O6SB 4UI2A 4IKIA 1U33A 4G7VL 1RPQA 4XWGH 4GJTB 4HCRA 2FEEL 3RZWA 4AENB 3IJSA 4KVPA 2G3ZA 5JHBA 3UMNA 1JGVH 2D9CA 1F6AA 5CFHA 4AIZB 1H8SA 1WO2A 2F74A 3GXDA 3AS0A 4PJ9B 1U6AL 2MKLC 1BM3H 4LL4A 2BNRA 1NKRA 4RETB 1BREA 1WAAA 4J6RL 4RX4D 5JIQA 1AR1C 1RK0B 3NCWA 1QW8A 3PV6A 4HZ1A 5DO2C 1QWHA 4YGVB 2GCYB 4WWKB 4GP5B 1NLBH 1W8EA 3DV4B 3GIZH 3HFMH 3QJFA 1FZOB 2F8VA 3QXTA 2BSTA 3WMQA 5IESH 3K2IA 1XCQA 3HC3H 3F5WB 2GJZB 4KX8A 3T65A 3VQ2C 3CDGB 3NJNA 4HULB 1UM5H 5IHWA 5KBLA 5FO2A 3AWGA 3FAWA 2AV7A 1CFSA 1BVNT 4BZ2L 3D09A 4YPJA 3BUTA 3HR5B 2W92A 3FQ2A 8CGTA 4FQCH 5DF0A 4H44C 4JFFB 3HFML 1T7WA 1OAZH 2FYYB 3MX0A 4FJZA 5F9AC 3ULUE 4M6NH 1CICD 4R4FH 3HG5A 4UQ2A 4BKLB 3V4VL 1NC2A 4LPVA 3MROB 1EHKB 1FPTL 3T6XA 4MKTA 1HINL 2GCYA 1ZLUH 3ZE2E 2EO1A 5DS8B 2ERJB 2GJPA 4FJ6A 3G04A 3VU2A 3WIAA 4BGDA 1JVLA 3DYOA 3MRRA 4K15A 2QQNH 5D6DA 1NOAA 3DOIA 1MHEA 4I2XB 4K2UH 4LVEA 3AWFA 3BEWB 4AI7A 2CALA 1TZIA 2NZ9C 3SPVA 4TRPL 2XWDA 3ZE1E 5M94B 4JM2B 4UTCA 4LGSB 4AG4L 4QOKA 2ID5A 4JFUA 1E42A 4OTXH 1M1SA 3ENEA 3VYNA 4AYGA 5C6WH 3NSFA 1L0PA 5J9PB 2D7PA 2QR0A 4D9QD 2CJUL 4GUPB 1XAKA 2QPFA 4BZYA 4N24A 1XGRB 2V7NA 3B5TA 2CAKA 1KZQA 4XAWH 5AL8A 5DZJA 4F33B 1PY4A 5SWZD 5C7XH 2FVNA 2NXZC 5FECB 3QWOB 4CMMB 4H88H 1OCOB 3B2XA 3B2VH 2J8UB 2L8AA 4NQED 4KWUA 5DJ6B 3JV6A 5F0JB 3U0TB 3NIFF 4IOFD 1A3QA 1XR8A 3O6FD 4R2GD 5FM4A 3ZGHA 4PGEA 4K7PL 1Q0YL 4XVUD 1WEJH 2K3HA 3SIKA 1V3JA 1A6WH 2H3XC 2VDRL 4WUKH 1O6SA 4YHNA 4GQZA 1RIHH 5C8JA 4I2XE 3LN4A 5GRJL 2DD8H 4K5OA 2G2PA 3VXME 5IKCA 1HXYA 3TTSA 3EO9L 3OXSA 2EH8L 3EYSH 4P2AA 4NQUA 3V0DA 3V0AC 1KT2A 5AKRA 3RIFF 1ZTXH 2D3NA 2FT6A 5SWZE 1I85A 1QW9A 2MTAA 1KCLA 4UBDD 5GS3A 2VXQH 4KAQH 1BBDL 4UQ9A 3L3JB 4H8HA 1DVZA 4IEFB 5GS2H 5BMFH 1R3IH 5HHME 3IFPB 3QORA 2Y7QA 3VXSE 5AAPA 5JNYA 4E36A 2JH2A 4FTDA 4NZFA 1DJYA 3QDJE 2MOVA 3QZMA 3DTXA 5EB9A 2XG4A 3GMPB 4YHOH 3GFUA 1EFXD 2Y72A 4QHLB 1M71B 2PW1A 1ACYH 2LOEA 1FGNH 2RMNA 3FOLB 4F5CA 5I30H 1UTDA 5BZWA 3LD8C 1PLGL 1U21A 1WC7A 1RUML 4E5XA 5KVGL 3HZVA 4Z95L 4X8JA 4XPGH 1FUNA 1MFDL 1U8LB 1G7MB 2V3EA 2XVBA 3G5WA 3IDXH 4N68A 1J7VR 4W9LC 3PWVA 2BVTA 5IHBA 4F15C 3QP3A 1QRNB 1ETZA 3UYPA 1NMBH 2G75B 2Q3AA 4MZRA 2ZP0T 1IAIH 3MROA 4PJHA 6FABL 3J2PA 4JHZA 5DO8A 4HUXA 4HWEL 5B4MD 1SUHA 4IU2A 4AZ8A 2ZTBA 1GAFL 2EICA 3RY5A 1WAAF 1ORSB 2N7SA 3LXAA 1YPZE 1TMCB 1VCAA 3ZHNA 3M1CA 3BFWA 4ZUVA 3FUEA 1GPOL 4MRBA 1EFXB 1R6VA 2X1QA 3MRQA 3IN2A 4BFNA 4XMXA 4PJCA 4ZFGH 1A9EA 1G1YA 1N12A 3L4TA 3OKOA 2IPUG 3HPLA 3OTTA 4QCIA 3S35X 4ATWA 2EIKB 3F5WA 3LNDA 1PZBA 2FQDA 3IDNA 3QYNA 4OD1L 5HGBA 3GSVA 3DRTB 3S5YA 3NRQA 3Q6FA 3K6DA 2C3WA 3KYAA 5ESVB 2VLJA 1LVEA 3P11L 3HCVB 3GLAA 5CP7B 2BCKA 2O6FA 3ABLB 4RFNB 2BMKA 4GAAA 3K80A 5EOCH 5LGHL 2VXSH 2WXIA 1ANUA 4KVNL 1YZZA 5EORH 2B14A 4PGCB 2MOGA 4AYSA 1BXAA 3QFJE 4LEOB 2QSTA 3RIFK 4EZKA 4RMRA 2EXSA 1J1PH 2XKNA 1N6VA 5E56A 5K39B 2BRQA 2H8PA 1VEMA 2BY2A 3KGSA 4NQCA 3ZIYA 1KN2H 5IJBC 3LN5A 2JB5L 3O2DL 4JRXB 4OUUB 1FFOA 2AXGB 3KLDA 4UV4L 5EBLB 3REWA 4WI7A 1KLGA 2HX7A 2Z31C 4PJDA 3HMXA 4HSCX 4Z7OB 4YFEA 1Z2KA 3GDCA 1FVEA 5JLZA 2HKFL 5HI5D 3NCXA 2KC0A 3SDDD 3PWUA 3NP4A 3L5HA 3NPSB 2C7FA 3UPRA 1MCFA 1NCTA 3ROLA 4FHJA 1X6LA 4HWUA 5JLZB 1BQLL 1SM3L 5JOEA 2NY2D 2HFFA 2N1TE 4LCCB 1T20B 4WHYG 1H15B 1TF4A 4OLVH 3PUCA 4Y2DA 1G9HA 2CNYA 3PGCA 2AJ3B 1CG9B 5CP3H 2X4NA 5ICYA 3H2WA 2V9UA 4FNRA 3SDDC 4KKLC 4X5PA 3FTGA 4S2SA 3VFTB 5D7JD 3G08A 1AHWA 4ELMB 5KTEH 5BOPA 3Q2NA 3DO7A 3MN8A 3Q0HA 4EUPB 3V4PL 5CCHE 4J28A 5K93A 1BD2B 3RA7H 4UB0L 2WWMC 2FTAA 3QEGH 1AG0A 1NLDL 1T3FA 1YC7A 2IADA 4LHUA 4WK4B 2AXWA 1TJGL 5BCAA 4HJ0C 4FADA 3UAJD 3CVHL 3JWNG 1JPFB 4NDMA 4YAQB 5F88B 4MQ7B 4QHNA 1R75A 2VZTA 3NQIA 5MEOB 3HN5A 1T5XA 3A23A 2HJFA 2Z92A 3SDYL 1AD0A 3RPIB 2KZKA 5HDBF 2J6EA 3JWOC 3N1MC 3BPNC 2Y3NA 2RQ8A 5AW1B 4OLZL 3PDOB 1HOCA 4JFEB 5ECJE 1A14H 2FO8A 3HG4A 4FFZH 4X6DE 2L3BA 3GSNL 2Q3ZA 4Z9KB 5I15H 3C09B 1CGWA 3OR6A 5FC9A 1UC6A 3CNKA 3AQYA 3Q7JA 1BOGA 1FORL 2CPUA 2VISB 4O5LL 2EXTA 1T1WA 5G4MA 5GS2D 4BE5A 1CZ8H 2V4LA 2ENSA 1XXFC 4UT7H 1IGYB 2OL3B 3RWFA 1F5WA 5AAMC 1S9VA 5I8KL 4Z7QB 3HRZA 3NAAL 3TIDB 1YAZA 4WF7A 4H8UA 5D7JA 1O75A 4OZHE 1C7TA 5HHXL 3WJLC 1UOVA 1P7QB 3UADA 3BWSA 3GI9H 5C0FB 3FH8A 1IJ9A 1VACA 4P8QA 4ATTA 1I4FB 1YY9D 2B5IC 3A47A 4GIPD 4PSRA 3SE9L 2RA1A 2VXVH 3TBTA 4Q9RL 4X6FB 4PJ5E 1SDDA 4R0LC 4JFWA 3JWDH 4W9DC 1T1XA 3ZDXB 1J8HB 2V33A 3GMQB 5IQMA 1SDYA 2YEVB 2VJXA 5I1DB 2GK0B 3KVPA 1H6UA 5FYKU 4HAKA 2G9HB 1BW8A 2Y5TB 4UNTA 3ULVH 2W9DH 4PLNC 5A2KH 4QNPE 3U2SB 2KLRA 3TT1H 2LHAA 4NI6A 3FHAA 4MB4A 3CSGA 4LCCC 5LBGA 1AZRA 1YYML 2YRBA 3OF6D 5DLLA 1ZAGA 2J88H 4GRLA 4MD0B 1MLBA 4JKMA 3SJVA 5KVFH 2R1WB 4OZGE 4DGYL 4KH9A 5F7WC 2A74B 1K3IA 2ZCKH 1S5IL 4LLYA 3UIYA 3ZKSD 1R9FA 1CFBA 3BO8B 4HIEA 4QTHA 5FAAA 1N64H 4W70A 5E24E 3DIFB 5E5RB 2L7JA 1BV8A 1HH9B 3OG6B 1M7XA 1SDAB 5F3FA 1GJUA 2YRPA 3ULUL 1T0NA 2XN0A 4OUOA 1HCVA 2EDFA 3UP1A 3QEQE 5D7IF 1GGBL 3BHBA 4KZCA 4ZO9A 5IB5B 5JQ6H 3ESUF 3LPOA 2C3GA 2XIDA 4X2UA 1KBWA 1PZCA 3VXRE 2DWDA 4P2OB 5LDUA 1R1CA 1SXAA 4X42A 2NW2B 3RDTB 4KKAD 2ITCB 3HHSB 5BVPH 1R5VA 2ZWYA 3OJVC 2X4RB 3KWUA 1AKJD 4OSUL 1R4XA 4A7VA 1UZGA 3KEDA 4MA3B 3MGTB 4DK6A 2D3JA 1QASA 2XX0A 4X5WA 3COOA 4YC2B 4Z78B 2B77A 2Y25A 3IDMB 3SPHA 1XH2A 5LBSL 1P1ZB 4NQDD 5EC2A 1SBSL 3RZCB 3UBXB 2EDRA 3N43F 4Z0XA 3CXDL 1N2RA 1NWPA 1J8HA 1LEKB 3QUKB 3SOTA 1L3WA 3RHWF 3QARA 1ZLEA 4JQVA 1MFAH 2OTUB 4U7KA 4AQAB 3G5VA 5KN5B 5JHDB 2VSCA 1HNFA 1KYAA 1TTUA 2WQSA 2MFNA 3RWGB 1DBJH 2UY6A 4PJXF 3UTTA 1PZ5A 1N5YH 3STLB 3UABA 4LVNC 3BP7B 3BRFA 2J8UE 1FFTB 2XN1A 4BZ2A 3U2SA 3WS6C 1DDHB 5C0FA 4PGCA 4ZUWA 3GIVA 1AQKL 3EYOA 4DP5X 4GKLA 2HVKA 1QUPA 2VJ8A 3LRSA 1QLFA 1CN4A 1EEYA 5DMJB 2CBPA 3OPUA 1O7VA 5KS9B 4LAJH 4AZ8B 3TA3C 4YFLI 1QRKA 3X12A 4Z7OE 1J0JA 1T03L 3CWGA 4MD4A 1HIMH 5AW4B 4JFQA 2OP4L 2ERJC 4N0CD 3V0IA 3HAEG 2R9HC 3FTXA 5AW5B 3UTSE 3KPOB 3WJLA 4AH2B 2CRIA 3KWWA 2K0RA 4PY8I 4E41A 3FN9A 2C4FU 1S7SB 2YWYA 4XVOA 2PYEA 4Y16D 2HJKA 3D85B 3CFNA 1FFQA 5IB2B 1GCYA 2F54B 3GK8L 1NUNB 4HJJH 4GKOA 3VG9B 4OF7A 4A04A 3GF8A 1UCTA 3EAKA 1EGJH 3LQAC 1W9XA 4XXWA 4B5ZA 2XV6B 1LP9F 1H6EA 4I0PB 2DM7A 2PW2A 1MY5A 3QRBA 4XBMA 3SB3A 3OJDA 1I8MA 1X5FA 2WVTA 1PKQB 4K3DL 5A2AA 3TJHC 4MNQA 4I9WD 1MUJB 1JPTH 4YDJA 3E1F1 4Q9QL 4HEPG 5C0CE 1UOKA 4AYMC 4WO4B 1L5GA 3D69B 5I1IL 2EVFA 5K59E 1G7LB 3U9PL 1FNEB 3VVWA 2GTQA 3OGCA 2W9LA 4BA8A 1GGIH 5KYYA 5LQBH 1RUMH 3S3SA 4RFEA 4XO4A 1MWAA 2A9BA 1KXQA 3H9ZA 3NRFA 5KEZA 1TJXA 1BYOA 5KN5A 1OGAA 1KJ2L 2WQWA 4U6TA 4ES9A 4NGHL 1BVLA 1EXHA 4QXGL 1KCRL 3W57A 3C5SB 3MBWA 1I3RA 3EBIA 3UPRB 2HN7A 3B9KB 1WWAX 5F7NC 4G9FD 2E7BA 3MRJA 4NM4L 5CILH 3S8WA 4FTVD 4Z78A 3MV9E 2EYRB 2XKUA 1RURL 5F44A 4X9IA 3OX8A 4FHBD 1H3VA 1KIRB 2EEFA 3WUWB 2NX5B 4Y4HA 4ORGB 2GTWA 1BZQK 2WBJD 3VXUD 4DCQA 5JQ6L 2F1AA 3QQXA 3Q9PA 5EUOF 3VI4F 1MAKA 4TM9A 2VMJA 3FQ4A 3J7HA 3V5DA 3WLWD 3CHQA 5ITFB 5GQBA 1ZA3B 3CK0H 3MGAA 4FA8A 4J3OH 3NFPA 1CFNA 2BSEA 4H20H 2ZYIA 2WKLA 1ADQL 5E6UB 5CGBA 2OMNA 3S37L 3TO2B 4AZUA 1Z0NA 2YD5A 4WW2C 1XIWB 1N4XL 5C2BH 2LE9A 1G7HA 4I3SH 5AEAA 4ZNEA 1QFUL 4G5AA 1HK6A 3LDBB 2QTEA 3IETA 2H41A 1VFBA 2IWEA 4AIEA 4F7TA 3D3VB 5ESVA 4G7QB 3VGDA 2AQ1A 2EJ1A 3N6YA 3EW3B 4QKXB 1JF6A 2QDVA 2ADGB 3Q1SH 3FQUA 4UDTB 3O6ML 2Q76A 4Y19B 4LSVL 5IEKB 3VE0A 1U8JA 4U6YA 3LKOB 4KRPB 3VXUB 5IVXA 2W07A 3RAJH 4NKDB 1AGFB 3WYRA 3WO3B 4N8UA 5EBMA 2UVFA 5TE4H 2YAEA 3KGRA 4OZGF 5D6CB 5A3IC 1LHZA 4UCFA 3UJIL 5HYJA 4KO5A 3SDAA 1I9EA 5GGRB 1RZFL 2LR4A 1H0DB 2I9TA 1P4BL 1OIOA 2ICWI 2IVFC 3QQNA 3SO3C 3TN0B 2YAFA 4QRAA 4P23D 4CVZB 4A37A 3HCVA 2W0KA 4JPQA 3ILPA 1RMFH 4QTIL 1BXVA 3HBZA 5B3JF 1OVZA 4JFEE 1IGCL 2HG5A 1MCLA 3VXOB 3GBDA 3UIZA 3RG1C 5LNGA 2VLJD 3UYPB 1JGLH 1SMAA 5D7LA 1AI1L 1WZLA 3K2MC 4HP5A 4MS8C 1NMAH 4XZ4A 2ICES 3D4YA 4UT7L 3N1FC 3ESVF 4KK8C 1TYEB 5BVJB 1JVKA 1BQHA 1RFDL 5B8CC 3HS0A 4XBPB 2X4OA 4LLQA 1LDSA 4NC1C 3L81A 4PH8A 5BZWB 4D2NA 4CILA 3QUYA 2AV7B 3F64A 4KXDA 2C9RA 3SYPA 5LO7A 2MRYA 3ARBD 4RISL 4NZJA 4FC3E 4B3EA 3P9LB 1Z5LB 1LDPH 4Z7VF 5AW9B 2FO4A 1RHHB 2VAAB 5IOPA 1TSRA 3Q01A 2QFPA 4AIOA 1NSNH 3IGLA 3C2AL 3FSZA 5DD6B 3WD5H 4FEIA 4PTUA 4YNYB 4TNFA 1PYWA 3ISWA 4O58L 4AQ1A 1LP9A 4EDXA 2WIIA 1R0AL 4B0MM 1QO3A 2C7UB 3MJ9L 5F1NA 3X14A 1F6AB 2DWXA 1FC1A 2ZOWA 4UOW0 2OSXA 1J5OH 3B37A 3DBXB 1OHQA 4D9QE 1MRFH 2VC2L 3EJQA 1HJBC 3FU7B 1A6ZA 4KTEL 3Q6GL 5KUMA 2B3RA 1ZA3A 2X6CA 4IGBD 3TBSA 4M1DH 4DQOH 2H1XA 4CKQA 1Z9NA</