1SF3A

Structure of the reduced form of the p94a mutant of amicyanin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTAHPFMRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amicyanin
publication title Structural Studies of Two Mutants of Amicyanin from Paracoccus denitrificans That Stabilize the Reduced State of the Copper.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
total genus 27
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2004-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1sf3A00
4HCGA 2YAHA 1AS7A 2YXVA 3QJTB 4G7RB 3FYEB 4DP7X 3PPSA 4DPBX 4M3HA 3ERXA 4BDVA 3CVDA 1V55B 1E30A 5TK2A 1NINA 1KCWA 1V10A 3QJUB 4HALA 1QLEB 1SF5A 4BWWA 2P80D 1MZZA 3FU7A 2IDQA 4JHVA 2PCFA 1PCSA 4GP4B 2YAFA 3TU6A 1W6WA 3FSVA 1OF0A 2FQFA 1L9QA 2LLNA 4NERA 1GS8A 2IH8A 2GB2A 3AZUA 4YVNA 4KO9A 1OE1A 3ABGA 3CZUB 1T5KA 5I6OA 2J5WA 3UABA 1PLCA 4PAZA 1SDDB 9PCYA 3S3BB 5B3SB 3WNIA 2IDFA 1NWPA 3S8GB 1OV8A 1FWXA 1PNCA 4YSRA 5EHFA 1KBVA 1URIA 3PCYA 5F7BA 2J56A 3PXLA 2QDWA 4HCIA 2XXFA 1WA2X 2BWDA 3NP4A 4GP8B 5PCYA 3NJMA 3FU9A 4P5SA 4GXFA 2CALA 1BQ5A 2PPFA 2UXTA 1IC0A 1X9UA 2B3IA 3FYIB 2GSMB 1JVLA 4HHWA 4YSSA 3QQXA 2HLEB 5E9NA 2JXMA 3T6ZA 2AZUA 2FNWA 1ADWA 2VSMB 4A67A 5A7EA 1SDDA 2WO3B 4A2FA 3FQ2A 3PAVA 3AG3B 2VMJA 2FT8A 2H3XC 4M4RB 3S3DB 2HZHA 2YQBA 2HX8A 2VW7A 3TASA 5D4IA 4DP8X 3C75A 2JKWA 2ZONA 1AG0A 2H5UA 1AZCA 1ETJA 4HIPA 2ZOOA 1KDIA 3KW7A 1OOWA 3EH5B 4QKTA 1IKOP 2FQEA 2IAAC 2UX7A 2EINB 1CYWA 3ZDWA 3WIAA 5B7MA 2IH9A 3SBQA 1NIDA 2DV6A 2EILB 3DKHA 3H4HA 2XU9A 1JZIA 1PZBA 4KOCA 3SQRA 2VW4A 2PPDA 2DYSB 4WTQA 5FC9A 2BWIA 1NDTA 4DP2X 3BVDB 1ASPA 1AOZA 1IUZA 1WA0X 5B1AB 4BDVB 3N55A 1FFTB 3IN0A 2IWKA 1PZAA 4KO6A 4YSTA 2PLTA 2FJSA 5I5IA 3WI9A 4KNUA 1L9OA 1F56A 2OV0A 2PPCA 2R7EB 4ENZA 5I28A 4HCFA 4HAKA 2CAKA 4G72B 2WO2B 2X88A 1NIBA 2RACA 2XYBA 1HFUA 2QT6A 5TK4A 1NPJA 3NP3A 4BXSV 1AZBA 1BXAA 4NB7A 4AX3A 2WSDA 2PP7A 2BZ7A 3IE9A 4NAJA 3S8FB 1BXUA 4PCYA 1M56B 1YLBB 4Q8BA 1W8EA 3X1EA 1CURA 2E86A 2BZCA 4TXVB 2ZXWB 1DYZA 5AZUA 1PF3A 3EH3B 3AG2B 2GHZA 5B1JC 4A2DA 1TEGA 2YAMA 4JKNA 3ZX1A 3UACA 2R7EA 4W9ZA 1L9PA 4GY4A 2PCYA 3HB3B 5B1KA 3CVBA 3H4FA 2GC7C 3ASNB 2DYRB 3QPKA 5I5JA 1R1CA 1GY2A 4DPAX 4UF7C 1EHKB 1V54B 4G7QB 2IDTA 1SHWA 4N8UA 2FTAA 4E9XA 1A3ZA 2AFNA 4E9SA 1WA1X 3NJKA 4A2EA 4RH4A 2YAEA 1XB8A 4WKXA 1KCBA 4JHUA 2OCCB 3CDZB 5LDUA 1JXGA 1XB3A 4E9RA 1W6LA 3BQVA 4A66A 1AACA 1JOIA 1OCOB 2FT7A 2YARA 1ET8A 2I85A 1ILUA 2HRGA 1NICA 3X1NA 1L9SA 1CYXA 4FA7B 1SF3A 2IDSA 5IY5B 3T71A 1N68A 3OMNB 4UAHA 1A4BA 6PAZA 3X1BA 1EZLA 2CBPA 3RYMA 4A2HA 3S3CB 3QJQB 1SHXA 4DP9X 4KNTA 2W88A 2MTAA 1AG6A 2H47C 1RZQA 1WS8A 2IWFA 2J57A 1MDAA 3CDZA 8PAZA 1NIEA 2XWZA 2FQGA 3ABKB 2Q9OA 2IDUA 1JXFA 3JTBA 4BXVA 1ID2A 1BYPA 1KGYE 2DWTA 2B08A 1ILSA 3UAAA 4DP5X 3NJGA 1AS6A 4YSUA 1RZPA 3WG7B 5PAZA 3N2JA 3TA4D 1ZDSA 1ET7A 3V9EA 1ZDQA 2P80A 2XV2A 1QNIA 1SFDA 3MBWB 3V9CA 3EH4B 3NSFA 4DP4X 4L0PB 3EF4A 3QJSB 4KOBA 5I26A 1SFHA 2IWEA 1SJMA 2XX0A 3CVCA 1J9QA 2QPEB 1E67A 3FSWA 1AS8A 1KBWA 1AZNA 1PNDA 4BWUA 3JT2A 1AQ8A 1JVOA 1PY0A 3MX0B 3WKPA 2XV0A 5AKRA 3U25A 2AANA 1NTDA 1L9RA 3T6WA 1DZ0A 2HRHA 2GC4C 3ASOB 1A8ZA 1GR7A 4HHGA 1JZEA 1MG3C 6PCYA 3FPYA 4YSQA 4YSPA 2PP9A 3FSZA 2GIMA 5I6LA 2VW6A 3AG4B 1NPNA 2OJ1A 2BO0A 3H56A 3NJFA 1ZIAA 2XXGA 1IBYA 1I53A 4AZUA 1AZRA 1E5YA 3SBRA 5ANHA 2N0MA 2EIKB 4EF3A 3UGEA 3EHBB 3GXUB 3WKQA 4YL4A 1M9WA 3FQYA 1PLBA 4G7SB 3FT0A 2BP8A 4KO5A 4YSOA 5B1BB 3TBCA 2MRYA 3NT0A 1ZV2A 1BYOA 3OM3B 3FSAA 3AY2A 7PCYA 2I7OA 5I5MA 4KO7A 3NJLA 1GYCA 1AAJA 1J5DA 5D4HA 3T6XA 3GYRA 1TKWA 1ASQA 2YAQA 2NRDA 3FQ1A 7PAZA 2FT6A 1NZRA 1GSKA 1BQKA 1RCYA 3TBBA 1JZJA 1BEXA 2BP0B 4MFHA 2CUAA 1ZIBA 3CG8A 5I6MA 1OCZB 3WNJA 4E9TA 1GY1A 2HXAA 4G71B 4E9QA 4ZK8A 1XB6A 2BHFA 1JZHA 2PP8A 5B1JA 1CC3A 1L9TA 2XV3A 2PPEA 3OMAB 2GBAA 3DTUB 3DIVA 4UANA 4QLWA 1X9RA 1XMEB 1HAWA 1IBZA 1JERA 1ASOA 4G70B 3PAZA 1NIFA 2FWLB 2W8CA 2VSKB 5I6NA 3FS9A 2A3TA 4BWTA 4DPCX 3FPXA 3NYKA 1ET5A 4GP5B 1BXVA 2Q5BA 3GDCA 1ZPUA 1N70A 1AANA 2UX6A 2FQDA 1M57B 2BP0A 3UAEA 4AKOA 1OE3A 2XUWA 3X1GA 3IBOA 1BAWA 2BW4A 2GI0A 4AKQA 4E9YA 2AZAA 1MG2C 4W1TA 2HX9A 4AKPA 3NJNA 2QDVA 3NSYA 2DWSA 5I6KA 1KYAA 2TSAA 4F2FA 4E9WA 4A2GA 2J55A 1A4AA 4P5RA 1FA4A 3NSDA 4E9VA 1PMYA 1NIAA 1SNRA 3AW5A 1E5ZA 2X87A 4DP6X 2ZWNA 2UXGA 1NWOA 2HX7A 1GS6X 3KW8A 2YAPA 3X2QB 1TEFA 3UADA 2I7SA 2DY2A 3T9WA 2CJ3A 1JZGA 3ABMB 4A68A 5I6PA 5B7FA 1HAUA 3FU8A 3NJHA 1OCCB 1KDJA 3D12B 3NJJA 1GS7A 1AIZA 2Y69B 2UXVA 4DP1X 5AFAA 4YSEA 4DP0X 3IN2A 2TSBA 3NJIA 1GW0A 1J9RA 1MZYA 3QJVB 3ZIYA 1OE2A 3L45A 2XLLA 4YVUA 4YSCA 2BP8B 3T6VA 4HZ1A 1JZFA 3NSCA 2AVFA 2EIJB 1J9SA 4YSDA 2CCWA 1WAEA 3ZBMA 1AZUA 2Y1AA 1KV7A 1B3IA 2XVBA 2YXWA 3X1FA 5B7EA 4F2EA 3IEAA 4X4KA 2BW5A 3PLYA 2JFCA 1OCRB 3HEIB 3OQRA 2EIMB 3PAUA 2VN3A 4CSPA 1CUOA 1E65A 1VLXA 5F7AA 2VM3A 1WS7A 4YSAA 3G5WA 1RKRA 3OD3A 4GYBA 3ABLB 4N4YB 5D4JA 1J9TA 3FU7B 4AI7A 4FAAB 1A4CA 3OMIB 4Q89A 1PLAA 1A65A 1QHQA 2QPDB 2PPAA 3SBPA 4BK5C 1JXDA 2YAOA 2UXFA 2XX1A 4F7KA 3QJRB 1BQRA 3AG1B 1PAZA 4KNSA 1J5CA 2VM4A 1PZCA 1AR1B 4K9JA 1TU2A 4CSZA 1UATA
chains in the Genus database with same CATH superfamily
4RGND 3S37L 4R0LC 3REWB 2A5UA 1CXLA 3L3KA 4FP8H 4E68A 4XN9A 4I0CC 2A9DA 3M86A 2EDYA 5M94B 4JZNA 1UD5A 4NM8H 1NCCH 3TJPA 4KK6D 4YL9A 4LGPB 1V10A 4M8QB 4WEBL 9CGTA 4PJCB 4HALA 4X5XA 4UQEA 1XF5A 5JPMC 2EH8H 5E4EB 3TT3H 2R0KH 3O3UN 4U6HB 5DSCB 2ZKXA 3LZRA 5IMOA 3VGAC 2FQFA 4Y7OC 5B38B 2VDKL 1AQHA 3ABGA 3ZSTA 1SLVA 1UC6A 2NY0C 3HG1E 5ACMA 2ZOTA 3UABA 5HHOA 1Q1PA 3HMXH 9PCYA 1SDDB 3D05A 5IVXB 2Z93B 3QUMB 4HJSA 2Q76B 1G6VK 4PJ6A 3TBWA 1IGJA 5ESVA 3RX8A 4P4KA 1OPGH 1Z9NA 1TZGH 2NMSA 3EFDL 5FFGA 4CSTA 3HE6D 2EVGA 4RFEB 2QVKA 3ATBA 4KQ4L 4UWQB 4L8BB 4G80A 3QULB 2ZCLL 3U4BH 5LGHL 2F5AH 4FZ8L 2H2SC 4PW4A 5EIQA 1JRHI 2H6PB 3TBYA 4B60A 4KI5D 2ODIA 2BXZA 2ZX7A 1QLEH 3NZUA 5E2TL 1HL9A 5C07E 5JA8B 1AD9A 3VWKD 2WY3B 5GISL 1FYTA 2ITCA 4XPFH 4F9PC 4GUCA 4XBEL 3OMZA 1KGWA 1O7DE 4K94L 3MUJA 2RCSH 1KG0B 5EF1A 3ULVD 4A1RA 4LIQL 1MFDH 4HC1H 5ALBH 5IVOA 4ELKB 1C7SA 5HTSA 4F5CA 1HXMA 2ZG2A 1ZXQA 3EJSA 3HC4L 4IRJD 4JM0A 3V7AG 2YOAA 2E6QA 4KKPA 1EBAA 1MQKL 4F7TA 4E41D 3FN0H 4HV8B 1S9KC 4WW2B 1ZLUH 3V52H 4YE0A 1YPZF 2VR9A 3IAQA 4AVHA 3Q13A 2P5EE 4KTGA 5EEZA 3O4OC 2FBOJ 3G5XA 4Q6IB 4FXGB 4ACTA 1YQVL 1IKOP 1CZ8L 5CM1A 3TBTA 2ENSA 4OSUL 3GBNH 4LDEB 1M71A 4MKTA 5CLTA 4DKFH 3PGDB 3SQRA 3LPWA 3B2MA 3GLAA 2AV7B 3P69A 2MJWA 1I8LA 3RB7A 1ZVHA 2HSIA 1SQ2N 1MCPL 1VKXB 2QR0B 4MNQA 5ID0B 4FCAA 4JRYE 1H8LA 5EZLA 1DQQB 4DGYH 2AV1A 2DYPA 4DEPC 4EUPB 4GUOA 3W2DH 5FO8B 3FQNB 4KHXH 5ICUA 4BIKA 1F11A 3N0PB 3EKCA 4BFRA 2KBGA 3PJLA 1ZHLB 2HT2C 5FECB 3MV8D 4FFYA 2PPCA 4L4VA 3IF1B 2QQQA 3N41F 5F7YC 4ZJ9A 3DBSA 3BKYL 1KLUB 1ZVSA 4PGBA 4FLQA 1KLGB 4QCIA 3APFA 4HULB 1OQXA 2PW1A 3BT0A 4LHUD 4FZEH 4MHHI 4ZBJA 3FFDA 5A2AA 1BVLB 1T83A 1U8JB 2JQAA 5KVEL 5GS1B 4Z7NB 2PP7A 4IRZH 1A7QL 4WWPA 4G6KL 3Q1SL 2F8OA 4YHYC 3TNMA 2WHVA 1W2KT 2R29A 2EDLA 3CHQA 3CZKA 4F57L 4OKDA 1S7VA 2Z92B 1TR7A 4YWGH 2GHWB 3MRMA 4I0PC 2F9BT 4NO0B 3RWJB 4AM0A 2WBKA 3VGDA 1JNLH 3G5YB 5E1IA 2Z0UA 3O2VH 1JGEA 4QO1B 4LFHD 3OJ2C 4U1GC 1ED3B 1RY7B 4QRPE 5I23A 4XCCL 5A6MA 1GY2A 3V4PA 4OJCA 4MWFB 2WVUA 1UASA 1XGQB 2ZCHL 5FYJH 3UYRL 3BUTA 4RWYH 5I76B 3QW9A 3D3VB 4QWWC 5CINL 2CU9A 3UJJH 4Z77A 3NJKA 5GS0C 4FTDA 3C08L 4XVUC 2HFFA 4WKXA 3ISWA 4JHUA 1IRAY 4XBPA 5DTFB 3ZKND 2KI6A 1SY6L 2GSIA 4PJ5E 3WAKA 2OMUA 4QAMB 5K9JL 2AITA 1J8HD 4ODVL 2AJZB 1IJNA 4XCNA 5LXGL 3UP1A 1QZ1A 4WVRA 4Y5VC 3FKUS 2FVNA 3ZL4H 1K6QL 2XTLA 1S7XB 3C8DA 5D2NA 4PRHA 2NY1B 5HYQB 4AGLA 1NDMA 2I85A 3ECUA 3GKWH 2YLKA 3K72B 3PP3H 1NM9A 2HFGH 2VJ8A 4MDIB 3WFCH 3VQLA 4HWUA 5E6YA 3OMNB 5CGTA 1MEXH 3I6GA 2E7BA 4XOAA 2FO1A 1AXTH 4NKMA 3VI4B 5IMLB 4F9LC 3OXRB 3MZTA 1TO4A 3UTTA 4R5VA 3BHBA 2ADIB 2Z6FA 3GJFH 1MFNA 1MIEL 4KDWA 4Z7WF 1QUNA 5CU5A 1OB0A 4ZFZA 4JFFB 5DZ9A 4ZMPA 2FWOB 1NJ9A 2DLFH 4RISH 4GFTB 2X89D 3KCPA 1YCSA 3JTBA 3DX3A 3ZOAA 1J87A 4AV4A 2BRRL 2I69A 3B2VL 4LCCA 4EIGB 4KVNH 1FLTX 4YDLC 1K72A 4PN6A 5E2WH 1M53A 3X12A 1DEEA 1EEZA 3PG2A 4XC3H 3GWJA 2H1PH 3MLZL 5DJ2B 5GSRB 3IDGB 4W68A 3G6JE 1SFDA 1JHTB 2C9XA 2XTSA 3BPNB 3NSFA 4KDTC 4XNUH 1VCAA 2QKIB 1S8DA 1AHWB 5I26A 5SWSD 1KFAH 5EIIA 4NSKB 2A6JA 2AK1H 3RGVD 1HIML 4DUWA 4LLWB 3I3EA 1PG7X 2BSTB 4LCWD 4LSTL 1R3IH 1QBML 4QHKJ 3UAJA 2YRBA 1AKJA 1A6ZA 3CSPA 4DWHA 5HXMA 2BDNL 1CDYA 2RA1A 1EXGA 3K4AA 3HG1A 5ADOL 2NZ9D 1CXFA 1R5WA 1JYVA 5IHZB 4G8FB 2DQUH 4NZ8A 1AO7D 5FWRA 3ROLB 1BD2E 1RZJC 4GW5A 1K4CA 3RX5A 1NGZA 3O3DB 5DHVB 4YHZL 3OV6A 5J9PB 1F3RB 1XSOA 1CU4H 1T3FA 4U1KA 2OW7A 5FCUL 2UWEB 5A16A 4MD4B 1YY8A 1DN0B 5DMKB 4F93B 3QRFM 4PJXF 3EHBB 2R2EA 4QRRE 5IWLA 4AT6A 4J3OG 2X42A 3SCMC 3T0XA 4YDMA 2VL5B 2OBGA 4AW7A 5T5FA 1RIUL 3P54A 3CDYA 1G1YA 1IBDA 1BM3L 2FJGB 2X4PB 3KCWA 1NGYB 2GUYA 4PTTB 3KPMB 3MI6A 1BBJB 3NFPA 1I31A 3NBNA 5DI8B 3L8QA 2Y3AA 4MA7H 4GXVH 2PTVA 5LB1A 4G3YL 1AAJA 3T6XA 2O1AA 1WBYA 2XWBB 4FD0A 3LEYH 2NQCA 2ORBH 5AVQB 4EKJA 3R0NA 5C70A 3RZCA 3P77A 1OGAD 2FUTA 5H4ZA 1HWHB 3MACL 4IHOB 4Z7VF 5CS7A 2VO8A 3CVIH 1FGVL 1FFNA 4M7JL 1FO0L 2P5EA 3AVEA 4P3DB 3ALXA 1ML0A 1YC7A 5A2KH 3MV01 1ZTMA 2XVLA 1FNGB 4UQBA 4IDLA 4LCIL 5C09D 1LEKA 2KH2B 2OA9A 1OAUL 3UTPE 4BUGA 1X5YA 4XPTH 1HAWA 5BUGA 1T03H 4GMSL 3HJ0A 3WJLA 4KZEL 1I8UA 4HGMA 2O5YH 1OP3K 3MTRA 1XGYH 1KTLA 4BWTA 5HSFA 1VENA 2HFEB 1RZGB 4AGOA 1PZ2A 5HHXL 4Z78A 4JRYA 1WISA 4WTZG 2VXQA 5I6XB 3CV5A 5T5NG 4CW1B 1KTKE 4XX1E 2F1BA 3ZMEA 3B7TA 2DQTL 2QDVA 3MJWA 4LSRL 3GMOB 3S98A 4C54A 1R5IB 2J5LC 4WWKA 1PDKA 1EZUA 5DD0H 4ZXBD 2P5WB 3P4OB 3X14B 4DEUA 2K3TA 4UU9B 5KYUB 4GRMB 4KHTL 4XNMB 3RIKA 5I8EA 1AYRA 2A1WL 3HS8A 1Y7VA 5D2LB 3QORC 5BZDA 3KH4A 4G9FB 4RMBA 4W9CC 3D39E 5GRUH 3VXSB 4S11A 3MJ7A 4GQ9H 4Q58C 2ZOKA 2NSMA 2EDRA 1EO5A 2EACA 5CEYB 3ZXAC 1GXEA 3QI9D 3MTXA 3ABMB 3AGVA 1CE1L 1R33A 4XO5A 4Q2ZA 5I2IA 3DO7B 4OLEA 2FYYA 3TURA 2B16A 2UXVA 2KZWA 1JPEA 4JKWA 2OR8A 5AOJA 4AGNA 4E2OA 3GRWH 2DQGL 1I8IB 1U93B 2R69L 4EPSA 1MZYA 5HDBB 4OBRA 5IB3B 1A5FH 1H3PH 3D25B 4IKKA 4WK4B 2P24B 4J1UA 2B59B 2OTUB 5EBWB 5LGKA 1FYHB 2O6PA 5DC4B 1TZOA 1IM3A 3VFMB 4IBUA 2A0LD 3N9GL 5FA4B 3HS0C 3RWIB 1KV7A 1BX2A 4QRPA 4PU2A 1U92B 5I1EH 4W9JC 4MA1B 1B9KA 1R3KA 4PB0L 3MRPB 3HZ3A 2YD0A 1LK3L 1IAII 4TSAH 1E4XL 1WEJH 2AEPL 1HL8A 2O72A 4KV5E 3DPBB 1A1NA 4ERSL 5BRZB 1S7RA 4P46C 4ONFL 1WS7A 2ISDA 2ATKB 3MV7B 4G5ZL 4QRTB 4C8XA 4X7SH 2RQ8A 3GXPA 1HHKA 2GJPA 1ZMYA 1WFMA 2DOCA 1EEUA 4YQXH 4WKZA 1QHQA 1I1FA 1KJMB 4PMEA 3GQFA 2F19L 1EZVX 4S1DD 2UXFA 2XX1A 2YD9A 4OLWH 5HYJD 5DUBB 1I1AC 1WT5C 1KY7A 2WTRA 2KQMA 4K9JA 4JG1L 2D3NA 5SWQB 1DQDH 5LG1A 1DJGA 3L3DA 2NXYD 3L4UA 2NY6D 5IQLA 3TA3D 3WEXB 3T0ED 1JDDA 3I3BA 1OP5K 5M7QA 5EUOE 5HGHA 3ZYJA 5C8JB 2ZNXA 1WBZB 1H15B 4NCC1 5AG9A 5E00B 4F58H 5ICYA 1GHFL 1X7SA 5TK2A 3IJ7A 1E9OB 3O3EB 2V0AA 4AMXA 2UZPA 4I4WB 4NZTH 4R4BB 2A74C 2K78A 4R7DB 3CZJA 2G3XA 5E4EC 2PYEB 4LHJB 3GHEH 1ZHNA 3ARGD 1U8NA 5DK2A 5KVFL 1JSYA 1RZ7H 5AYQA 5B3JF 2GITB 2PCPB 2OKMA 4P23D 3FCTA 3T77B 1E4WH 3QG6B 5DS2A 2RBLA 5KVGE 1FIGH 3G6JA 2IDFA 1LO5B 4NWUL 5EZIL 3IPBA 1IBGH 5DJ6B 5D5ME 2VLKD 4DTGL 1MFBL 3IDJA 4K9EH 3JTTA 3U0TA 4Y4KA 1FWXA 3GI8H 1IQWL 4JANA 2ZSVB 4KI5E 3FTGA 4OZGF 4YSRA 5ADPH 4TQEL 1E8YA 1NBVL 1P6AB 1Q9KB 2GFBA 1E4KA 5GIRA 3ES6B 3P9LA 1N2RB 1YEJH 2O30A 3D69A 5DJDB 3ULVE 2UZXA 3DX4A 3B6SB 5E9DB 4G2AA 3OZKA 2AEOA 3UFIA 3AY4A 5J12B 1IVTA 3PWUA 4APQD 4YGVB 3RWCB 1TZHB 4JLRA 3V5DB 2FSEB 1MVYA 3QQXA 3BP5B 4TKWA 4W9KC 1EVUA 4E41E 3RWHB 4S2SA 1GGUA 3GZPA 4IOIA 4UTBL 1BD2A 5EORL 3AQYA 1ZSHA 5E24E 3HNSH 5K59E 2APBA 3MRGB 1WFTA 5MEPB 3FT1A 3HBQA 4ANKA 1B0GB 2BM3A 4RCAA 2GTZB 4K73A 3RVWC 4OY9A 2JELL 4NUQA 1QQDB 3NIDB 5F7KC 2G30A 2P9RA 4PB9L 4WW2C 1AGCA 1U8CB 5K39A 4IBQA 3RTQB 1KPUB 2XQYK 1YEHL 2WQRA 4N20A 3UP6A 4CVXB 4FTVD 5E08L 4QNPF 3MLSH 1L7TH 3OZ9L 1OAQL 4FXGC 2YGPA 4Q6IC 3RUGE 3JQOB 1JAEA 3BFQG 4O51A 4ZMXA 5I1HH 1NL0H 3N04A 5CLXA 4LBEB 3I9IA 3ZTNH 5HHME 4EMZA 5CN1A 4OI8A 5AB2A 2Y7SA 3H0TA 3V6OE 2CGZA 1I85C 4DP2X 4B7IA 1FZJA 3LQZA 1ZT1A 1KEGH 3SKJL 3FL7A 5DEJA 1KTCA 1DTUA 3F7RA 3RX9A 1YEEL 3HUJE 3MV8E 5J1AA 4HG4K 1RJLA 2JB5H 4P2RD 1NEZA 1HSBB 1KYOK 3ZR5A 1I1RA 1FFTB 5HHNB 2IWKA 3TJHC 4FQIL 2A9CA 2WLHA 1PZAA 3MCLL 5HJDA 1HEHC 5E4OA 3TC9A 4Z7IA 4AENB 2PLTA 4OM1L 4N0YH 4F7PB 2Y1YA 2G75B 1RUML 4JO2L 4ZFGH 4TV3A 1BA9A 2ZYSA 4WLCA 1I75A 5F9WC 2GJZA 1QBLL 4N8CH 5I28A 3V0WH 3KPRB 5JXAH 5GS3A 4LAQL 4FABH 2VDOL 3MUUA 3MJ8A 5DEGA 1YYLH 5IEHB 1FVCB 5F0JB 4MLSA 5DDHA 5K9KB 4L1HA 2QT6A 4X7FC 1AZBA 1E4JA 1OT2A 2WMPA 4ZTOH 2D3JA 1HQRA 3KAAA 5T3XL 3P3UA 1N8ZB 2WSDA 3O4LE 3SKOB 4AX3A 3M8OL 5GS1C 2BVYA 2XN9D 5CGBA 1KLFB 4ALAC 4QGTA 4DZ8A 1RHHB 4LKXA 4CN6A 5C2UB 2R0WL 4S1QH 4Q74A 4HLEA 1Z9OA 2FB4L 4PBDA 4U3HA 1T5XA 2QBWA 3QDGB 3K6SA 1QHOA 5MEOB 4YFLF 1F41A 3FQRA 3EOTH 4JKNA 4PJAF 1SYVA 2PO6A 1M4KA 3QPQD 2DQHH 1DLHB 3HS9A 3QXAB 3KLHD 4B9JA 4OF5A 1GYWA 1MRFL 3D39A 4HUWB 2Y06L 2YR3A 4AM0Q 4NYLA 4R3SB 2FL5A 1HHIB 4ISVA 2QSCH 4JRLA 3GUTA 2HWZH 4N6RA 1V54B 2IALA 1J8HE 3MBED 3RDTB 3BEVB 3P2BA 2EUWA 2E4TA 2EDHA 4H8WL 3IMRA 4HGKC 3V5HA 3HC3L 4OBSA 4AWJC 4NQSA 1NCIA 3ABZA 1XB8A 4B5ZA 4WI8A 1NMAH 4JDZA 1ZV9A 2P1YA 1DQMH 2VB5A 5J3HC 1YEDB 3MU3A 5CP7B 4DERA 12E8L 2GT9B 5FB8A 2B4CH 1MF2L 2YARA 1JF6A 3C5ZB 1VGEL 2XKSA 2NY1C 2V2XB 5TGBA 4JN1L 4JFOA 4NO3A 3WMQA 1S2EA 4WCYL 1E6JL 3SE8H 2OL3H 4A7UA 2XIDA 3ZTDC 5E56A 2JI3A 1EZLA 3VQ2C 2OMXB 3PNWA 2E76C 5GGSY 1M3JA 1I3RB 3NABH 1CVSC 1FFRA 3AS0A 4NRZB 1G6RB 4OD3L 1AKPA 1MPAH 4OD1H 2QMKA 3UPAA 1NIEA 5BXFA 3NIFB 4J3WA 3DRQB 2ODHA 2YD4A 4OFYD 1TTBA 1PG7W 2P47B 2XWXA 3X13A 3DURA 1ILSA 2G5BB 2G0LA 2MWCA 2XIIA 3WN6A 1CL7H 1SXAA 1WDAA 4HX1B 4IYKA 3E2HB 5JUEL 1AQMA 5D1ZC 2Q10A 3AADB 3A0OA 5EUOA 1FL5B 3WUWG 5FM4A 3IPEA 1YYMH 3BPNC 4H8HA 3P1VA 4XN7A 4GW4A 3SDYH 5MP6L 2QKIC 3KEDA 4H25A 5F7DA 1E67A 4DK6A 1X7TA 2WYZA 1KBWA 1L6XA 4OFKA 3MX0B 4N86A 3NCMA 1AO7E 1T0MB 1UHVA 3T6WA 3A67H 4HDIA 4TNWF 3H9SB 5EBGA 1F3JB 4WI0A 4K23H 5FW7A 4JHAH 4NQDB 1CICA 2IOOA 2ZUSA 2GIMA 2CO7B 4GRWF 3NEEA 3VFWB 1NPNA 5FIEA 4JVPA 4IHBA 4U7MA 3VXRB 3R18A 3SKNA 3LS4L 2F8XC 2ZOWA 4BQ9A 3ZN6A 5I16B 4AZUA 3WBDA 5KWYC 3GIVB 2EECA 1T6BX 3VX1A 3EHBC 4YBLB 2C7UB 3S5YA 5L2JB 3QS2A 3MGAA 1CLOL 3I84A 4Y2DB 3WN5B 4IRJA 2R29H 1ZV2A 4PGZA 1OGAE 4Y88A 3O41B 4E41A 1NCBH 4JMXA 2H2PC 4BFKA 2VLMD 5D1ZI 5CCHE 3UTSB 2BSCA 4LSQL 3ULSA 4ZTPH 3GC3A 5JQIB 1IGIL 2E27H 4HIHB 1VFOA 4N87A 1AGDB 4U1SB 1BCIA 1RCYA 1IKNC 2Q2EB 3DDFA 3HI6H 3MBXH 5IBTH 1CFMA 4OZIE 1XR9B 2CUAA 5C09E 1C7TA 1HCVA 3VU1A 3VFNA 4ZO7A 4U1IA 2DEXX 2V5MA 4KKNA 3F84A 4XP6L 2LFGA 4PGDA 1J86A 4GSUA 3G3LA 2DQDH 5E6IA 1NCUA 1R9FA 5EZJA 5LCVH 1XAUA 4C56D 4Q9RH 3RUGA 2F74A 3WUWB 4MJID 2GBAA 1XV8A 3EYQD 3L3GA 3TGXA 4BRJA 4TS6A 5FHAL 5ABZA 3WJMA 1WG3A 3ML8A 4LU5L 1MAMH 5JHLL 3TONA 2J43A 2BS8A 2XTJD 2ZZUT 1ZLWK 3HZVB 3V6OA 4HUXA 4IU3A 2D9CA 1ZK5A 5JIHA 1CG9A 1EXUB 1TIUA 4G6AD 4WSKA 5LVEA 3H3PH 1J48A 1EWHA 3HUJA 3MV8A 3CBJB 5D7SH 3I9GL 2CHWA 3IBOA 1BAWA 1MCEA 3NK3A 4IK7A 4Z5RA 3VDAA 5I6XC 4DCQB 4WJ5A 2Y5TB 5FUCC 1SUJA 1FL6A 1IGTA 3NSXA 4O2EB 3CUPA 3UBGA 2YRPA 3GLEA 5EO0B 2VABA 5JW4N 1XF3B 3BH4A 3BN9C 1WWWX 4J23A 4WUUB 3GEFA 4QHKI 3B9VA 3ZLQC 1HQ4A 5BV7B 5I1DB 2X4QA 4DVRH 2WXIA 2C7FA 1FA4A 4MQ7A 1N12A 1NIAA 2JLPA 3AW5A 1KYDA 4WU5A 2JKTM 1JMXA 4KFMA 2CBMA 4OJFH 4OCYH 1QSED 2ZWNA 5IREA 3EJPA 1EGJA 4PJ9D 1GS6X 1ONQB 3LZPA 4J3OC 4MCZA 1VZHA 3O4LA 3VRJB 4YPGB 1OAZH 3ATFA 5DRXB 1S9WA 5IQNA 1ZLSH 2B1AH 3H1ZA 4XCEB 1U6AL 1GZPB 5F2FA 5SX5H 2E9WA 3BKJH 3K6IA 4GSDH 3K6DA 4YSEA 2QQLL 3QQ3B 4JDEB 3STZA 4DP0X 3AB0B 4ZOBA 1F1GA 3RVVC 2V5SA 2XJLA 2Z34A 4WK0B 2QQKH 2XVKA 3OXSB 2IFGA 4MMXA 3ARVA 3WFEL 3PWNB 3OPZL 1WZLA 5DURD 2OZNA 5F44A 5KS9B 5F9JA 3MREA 1J9SA 2B77A 4Y4HB 3TZVB 3VM7A 2XOTA 1UVQB 3GXFA 4ETQB 1YNTA 3TTYA 2WXJA 2YN3A 1WFNA 5BVJB 1L3NA 1XF4B 5CEXB 3F05A 3GMLB 2BW5A 3NCYS 4HJ1A 4AXWB 1J8HA 3NFNA 4LIQE 3L5WA 1BGXL 5LBSH 2J8UF 4UQDA 5C0EB 3DWTA 5JLZA 5DJYB 4DK5A 1RUKH 2XA8L 1HYSD 1FNSL 1KV3A 1U42A 1WC7A 3EO1A 1MSPA 5HYJE 2D3LA 3RB5A 4HFWB 2A83A 5HI4D 5DVOA 2CKBL 4CBPA 1FN4A 4PMFA 1HL5A 3ARBB 5IQOA 3WSQH 3BGFC 2QVIA 1N5AB 1AGBB 4A6YL 4H13C 1E43A 1F4WH 1RJYA 5HGAA 5T5FH 4YBQC 4P2OA 3ETTA 3KXFD 4XRCA 5I8OH 4LEOB 1PAZA 3FT4A 4ODWA 1DE4A 3RIFF 5I1GH 3F7YB 3G08B 3QQDB 4QRSB 2MKLC 1AS7A 4NNXA 1T21B 2QGCA 4TUOB 2X89A 4JPKH 4AQEB 3IRCA 2XBTA 4G7RB 3FYEB 3T65A 1F4YL 3VRIA 5C08D 3HNTL 1J0ZA 4P2CG 4IBWA 1QSFB 3E8UH 3I2CL 2V17H 3N3EA 4LGRB 5HP5A 1HXYB 1U8KB 1QLEB 3LN4B 1TVDA 4N0CD 5GRJH 3IMWA 2BHYA 2HFTA 4DGIL 2GYSA 4NDMA 4NC0B 3I50H 3MNMA 4KQ0A 5DWPA 2VLKE 3CQFA 4NERA 3HPJA 4IMLA 5F21B 3J2PA 1DZBA 2CPCA 3MYZA 3RGVA 4UB0H 1N59A 3DGGA 1M6OB 1TLMA 3W82A 1YEKL 3QT2A 4OGXH 3EFOB 5E5UB 4J6RH 3WFZA 4NHCH 1TQCB 4ONGH 1I8MB 5K9QG 3H7BB 1S9VB 2OQJA 5CJOL 2ZD0A 3LDBB 4YUEH 5F9OL 5DUPL 2XRAH 5KVEE 5CILL 3V5KA 5DUJA 5ENWB 3BCDA 4YLCA 4ZNCD 1L7IL 2P52A 3NCBB 1NBZA 4NIKB 3U48A 4PV9A 1AO7A 1C16A 2FIRT 3LMJH 5L0QB 2EE9A 3MSPA 5J12C 5T3XD 1IC0A 2FNBA 1M2OA 2GY7B 4JGUA 3VMNA 3KLLA 4O9HH 3OKEB 3BIAX 6TAAA 4G42B 1IAKB 2CE6A 1VFAB 3KL0A 5JNYA 3S3SA 4N28A 1CXEA 5E99H 2J6EA 5DS8B 3DVNA 4ZUVB 3S6CA 2DD8L 4PJFF 4ZS6C 4J3BA 4PPTA 2DIEA 2R8SH 1M7IB 5D7IE 2ICWB 5J0BA 3X3FL 2DQCH 1JZ7A 4D7BA 5E2VL 3ULUF 4WJG3 4Y5YA 2EDOA 2ZOOA 3N40F 1OGAA 3K2MC 3EH5B 2VRAA 4UT6L 5I71C 5EF0A 2ZP8A 2DQIH 1CF8H 3Q5OA 4HZLB 2W0PA 3KPQB 5G4NA 1FBIH 2OXHA 4QXTA 2AJVL 3D34A 2OX5B 4P2RE 2WQXA 2DYSB 3BYTA 2IV9A 4YS4A 4OZIA 3LRSA 2D7TL 5TE7L 5C09A 1RJCA 4OKVA 2DIJA 3GPEA 1YYCA 4TUKH 1IX2A 1DBJH 2RMNA 1OARL 1U3YA 1I9JH 1UWXK 4ODHH 3N55A 5GXBB 1UM4L 3IT8D 4Z3JA 3PGCB 4G7VH 2PUQT 4NN5B 2CK0L 2HLAB 2WANA 2AJ3A 4QJ3B 3ZK0A 5C0FB 3FH7A 4KVCH 4I85A 1MCDA 4LCUB 1ZV5A 1A6UL 3UZQA 2ZYHA 3JWDH 3JWNE 4LLVA 2DM4A 4WZ9A 4APXA 2YKLL 2R9HD 4NO2A 4XH2A 3L1OL 3WNKA 3EG9A 3LB6C 4FX5A 4DO6A 2X6VA 5FWQA 3R06B 4PI2A 4YLBA 1EJ8A 5DRZA 4TTDD 3US1A 1QMUA 2G9HB 3IWUA 3JT0A 1NAMH 4LLDB 4ODSL 1LDPL 4PCTA 2WNKA 5CO1A 2M26A 3ARFB 3FCSA 4TXVB 1U30A 3HKFA 4IJTA 1S7TB 1IQDA 3PIQB 4RETB 2C26A 4FCHA 2L0DA 4Z7QF 3ZX1A 1QASA 2EYRB 4M03A 3H6AA 3KNBB 3M17B 1FNHA 1M2VB 3WJLC 4P2QB 1O75A 1QFWL 4GY4A 4ENEC 1KBGL 4GMTH 3BIBX 3DX6A 5JIMA 1MNUL 4A7GF 4UQIM 4N22A 4QT5A 5D71H 3TN0A 5KSAA 3EXJA 2VMCA 2IGFH 4UF7C 2JKIS 3MRLB 3Q2LA 4PS7A 1ICTA 2JKSA 5T3ZH 5T1KA 2CRMA 5I24A 2Z4QA 4N8UA 4E9XA 4XVSH 3RDTC 3GJFB 2Z91B 2IXQA 5ELIA 5IHBA 1S3RA 3CXDH 3D51A 3B9DA 3U1SL 1DJYA 2X41A 1TJGH 1X5GA 2Y7MA 3BDYH 2J1KA 1JF1B 3OLIA 4P07A 3JV6B 4MCYB 5J6GA 4A66A 1N18A 5DVLA 5GRVK 5C0GB 3FQWA 3O6LH 4N5EC 2YXMA 1DJZA 2YC1B 3ISYA 3C5ZC 4JM2D 3CVHA 2C1PA 4CMMA 1HH9A 4PRNA 3VFGH 3W0WD 1TENA 2BFVH 3T71A 4X0NA 1J7VR 4UAHA 2WTPA 5DJAB 1AGFA 4Z7WE 3CH8A 4WEEA 4NFBA 1DUZA 5GZNC 1R19A 3EO9H 1QKZL 4AIZA 3ETSA 2J4WL 2W88A 5HYJA 2EXWC 2D7NA 3B7SA 4F7MB 2BC4B 3KPPA 3DVGB 1N0XL 3LNFA 5E6SB 3T8XB 2MOVA 1U3HC 3TA3A 4L4TA 3H42L 3AGWA 3IGFA 4NQVA 3US0A 4QTFA 4D0DA 2H32H 4HH9B 3WKYA 1BJMA 2DWTA 1YJDH 4FQJH 4QHNB 3QZWG 4QRFA 4WV1B 1BZ7B 1U58B 1JVKA 3DOSB 4L3EE 1QNIA 3WY4A 5C2BL 4QRQA 5I66B 4TSBH 5D55A 5AW1B 1P84K 3D18B 5DYOA 3SBWC 3O9WB 3UBXA 1ZTXE 5D7JB 2Q8AH 4GKSB 2Y6TE 4IIZA 4QHUA 4D8PB 5FUOL 2X38A 3UG4A 4AE1A 2XV0A 4XVJH 2F58L 2VLKA 1IC7H 5I74C 3C9NB 4F2MB 4X99B 3DIFB 4OD2B 2IJ0C 4F7EA 2CLRB 3V0IA 2WCGA 3WHXB 4JG5A 4EI6A 3EYVA 4CL7A 1M1XA 3W37A 1XSIA 2OMNA 4JREB 3U0PB 3WTYA 4PJXE 1ZT7B 1I7ZA 1CCZA 1X4XA 4MAYA 2H3KA 4I48A 4GAGL 5HHQB 5JW4Q 3RL1B 3OWEA 3GXUB 3U46A 1P69B 4S1RL 1BFOB 4KK8D 5IEKA 4PI0A 4YBLC 1NCWH 3BPCA 5LDSA 5JDSA 1K2DB 4CU6A 1EX0A 4N8PA 2VDMH 4L1BA 5KTEH 5GGUB 3QEQB 4Y2DC 3RILA 3WN5C 4BCYA 3B7UX 3SKMA 3S8WA 4DEWA 4MS6A 3VD9A 5CUSH 4C4KO 2YRLA 1G7MB 2I7OA 3RAJH 3EZJB 1PAMA 1V7NH 3Q3GB 4Z7VE 1PCXA 3E6HA 1Z5LB 4EIUA 4ZMLA 5JPNB 2XZZA 3QWNA 3GYRA 2IBGA 2NRDA 4OUUA 4JZJB 4MRBA 3IKCA 3LRGA 3WEMA 3O0RH 1BQKA 1FFPB 4YDKH 4C56E 1R5VA 1U95A 5FYKL 1I82A 1KENH 3CG8A 1I9RH 1NGPH 1P4IL 3OQ3B 1SBBA 1T0PB 3B83A 1UKSA 5D7IA 4PV8B 3U30B 3BH8B 5FOBA 2Q3XA 1G7IA 3QZWB 4IGBC 5TJWK 1K8DA 1T1ZA 5IFJA 1N0LB 2DTMH 2XTJE 4FQHA 4UMGA 4QYOA 4BRVA 1SY6A 4F20A 4GKOA 3ME0B 2HN7B 4FQ1H 1R75A 1NFIA 4JFDD 1JRHL 1QI3A 2BSBA 2JKXA 4LT7A 5D1XC 4H2CA 5H94B 5ILTH 3SYOA 1T0NA 2HJFB 3BQUB 4KXDA 4RESB 5C0CB 4XPHH 5F7EH 5G5DB 4P2RA 3ARUA 4R97B 5BUAA 4JB9H 1L0XA 3D0LB 5KN5B 1M9SA 4D9LH 3TBVB 4HMCA 3U9UA 4P05A 1AZZC 2Q7AA 4TSCL 5CLZA 5CN3A 5C6WH 1IL1A 1AANA 3ZTJG 1RQ5A 2DWDA 1HHGA 5DVPA 1H3WM 3C6SA 2GBUA 1SGKA 2M1KA 4WAFA 5E5MA 5IW6B 5EC2B 3MLWL 4MNHA 5JW4M 5FYJU 3MNDA 1PX4A 2D31A 1QSEE 2F68X 4O5LL 4PYHA 3QIWA 3CC5A 4NP9A 4XOEA 4LQFH 4P5RA 3UTQA 3L3HB 4RMSA 5KVFE 3HTLX 5C0IB 4ZAKD 1XH1A 3VH8G 2BZDA 1QFHA 4P5TB 5FO7A 5HJ3A 3NQIA 1YDPA 5CJ8A 5FGBC 1L6PA 2DI7A 2HG5B 3HKZA 4JZOB 1Q1JH 5DJZB 3ZSSA 3HPLA 3T6QC 1BZ8A 5KBDA 4G83A 2N3JA 2A6KB 3RI5K 4F27A 4KUCD 4P2YA 3QUKB 4B50A 3HRZB 4Y9GA 4J8RA 1D9KB 1GS7A 5DHDA 1YAZA 2YJQA 1KTBA 4WHTB 2WCSA 1E0OB 3CCHB 4L9LB 1EO8H 2X6BA 1DFBH 3B2DC 3OJDA 3O2DH 5BOJA 3LPFA 4U2YA 2CGRL 4XT1C 1XBRA 5BS0E 3ETBF 2R2BA 4HAFA 2A4ZA 2R1YA 3TZVC 1FNEA 3KPLB 3K4ZA 4HPYL 1ULVA 5DWUH 3KJ4B 3X3GH 3WEOA 1GGIH 3HNVH 4U3XA 5KVGH 2OMWA 3CZEA 3S4SA 3BC9A 2WVVB 3MRJA 3M1BB 4RRPA 3RNKA 3U4EA 1GJIA 4X7TA 4HWBL 5L9DH 3D85D 2XPGA 3VD1A 2YD7A 1JWUB 2VM9A 4Z95L 4RZCB 4BJLA 3H2QA 5IZ7A 5L2KE 3RPIB 1H3UA 2ADJA 2G2NA 1T20A 3O0LA 1Y1UA 4XWOC 1JTTA 5E8OA 3ARBC 3ULVH 4BK5C 1MJ8L 1XH3B 5F6IB 3QJRB 2EDDA 4TQHA 1PG7H 1KN4H 3HLAB 4BFIA 5C86A 3VJ6B 1AR1B 2MCPH 4XCFH 1CQKA 4Z7WA 1ZD6A 4RX4D 1IILE 3LKPB 3EAKA 1CFNB 1X5JA 3RGHA 3MXWL 3QQ4A 4K3DL 1UD4A 2YPLE 4X8GA 3DX2A 5AB0A 3OAUL 1LO0H 2LFEA 2QADB 4ZT1A 1G7HB 1U2HA 2RD0A 3EO0A 4WUKH 1G1OA 1FO0A 5DQ9A 1S9YA 2Y23A 4BK4A 2WN3A 3P4NB 3VH8B 4OW6A 4PJBF 1KXVA 5FO9B 5IOPA 5CZRA 1LP9F 4F1ZA 2PXYD 1Z3GL 2CQVA 3OVUB 1T66C 4XBGA 1FH5L 3HB3C 5CJQL 5HPMB 2Q3ZA 4FQQB 4L2YA 4OZGE 1CFVL 4GBXD 4L3EA 4ZQKB 2MHAA 4MXWH 5DHEA 4BV1A 1TQCC 3FO2B 4XNYL 1AE6L 4KK9C 1T89A 5EBMB 5KZCD 5DFWH 4UIKL 4B0MM 2WXHA 1KPVA 1AHKA 1NUNB 2HG0A 2DW5A 3LDBC 4OB5L 2BNUB 5D1QB 4V1DD 3PS6A 5TE4L 4YDVB 4NS0A 3QJHB 3EDDA 5CZXC 5GRZA 1JTPA 3MUY1 4E5XA 3UMTA 2Y7QA 1E28A 4I1NB 4L2LA 4HWNA 1JYXA 3WTSA 2PPFA 2C3VB 2WOBA 5L0QC 4N24A 4JFEB 4AOFA 5JO5B 1O5DT 5F1OB 5DD6B 2JK5A 1F6FB 2C1OB 3PWVA 4ZNEE 2IOIA 4PJXA 2DN7A 1HS6A 2W0FB 3P4LA 3QXWA 3C2AL 1FH2A 1I8KB 3P3YA 2DQJH 1IKFH 1EGJH 3V0VB 4PEEA 1G7QB 1A02N 3DDGA 1CFTB 1A21A 2YQBA 3E0GA 3SY0A 4EN3A 3BGMB 4C55A 4H2AA 1LD9B 4QNPE 3LD8B 1TFHA 2FYVA 3TIDA 1PS3A 3Q06A 4MA8L 4JE4B 2R69A 4BFBD 3H55A 2PR4H 2N56A 3IFPB 3ZYZA 4UM8A 4YXKH 4FHJA 4JQIA 1P7QB 5JOEA 2MPAL 1I1YA 4Z7VA 3W9EA 3G04A 3QO1B 1MVUB 1LE5A 4JFPB 5EF3A 1HINH 2W1NA 5EO1A 3RG1C 1VEMA 1XF1A 5F0PB 3IDUA 4C56A 4CDGC 1OK0A 3RHWK 3BZEB 1U91A 1XFPA 2EC9T 3C60B 4UINH 3WIIL 4NOFA 3OKOB 4H20H 1SDYA 1R0AL 2V2WA 4WFFD 4GKZB 4B9ZA 4KC3B 1RZFL 4IKJA 1UXWB 3M88A 2OJZL 2EYTB 3AQZA 3KWWB 4LASH 4PSRA 4R7VA 5J5EA 5AW6B 4EOWL 2VO5A 4OZHE 4XPGL 1ORSB 3GSXB 2HJKB 4MQSB 2F7QA 4NN5C 4MXVE 3CXHK 3QDMD 4GRLD 1UM5L 5SX4I 4TVSa 4KRLB 5CIPH 1NIBA 5AWNL 2QZ5A 1I3UA 2OR9L 1BOGB 3C8KB 5ESQA 4QEGA 1GH7A 3NP3A 3O8XD 5EDSA 4I9WE 5KW9L 4P9MH 5AUMA 2I9TA 3ESPA 3L4ZA 1KJ2L 5FLVA 5ESVB 1IC4H 4PJAE 2D2OA 3LQAC 3Q6GH 4LL1A 2ICWI 1QSEA 5DR5L 4ICXA 1X4ZA 2ZP9A 4OLUL 4XNQA 3ARFC 1AYOA 4YHLL 3OR6A 1PSKH 4R4FL 3DMMB 2WTOA 3UTZA 3PWJA 3T0DA 4HKBA 2WUBH 5C97A 1NFDF 1QRND 1MREH 3STLB 2YA1A 2BRQA 2X9ZA 1FYTB 2DIAA 2ITCB 4RIRB 5C0AD 3UJIL 3WNLA 2AXFA 5IQ9B 4LMQI 2OL3B 5E8DL 3MUZ1 3CFJB 4GQQA 4PY7A 2PYFA 3CQPA 3CLEH 4HUNB 1BF8A 2FZ3A 5JHDD 4Y19D 4Y5XB 4MDJB 5I8CB 3SDXF 2NZIA 4O02L 2J25A 4DH2A 4WWOA 1LYQA 5I30H 1DHKA 2OMVB 1JP5A 3ARDA 1TVHB 4NQED 1FE8H 4LF3B 5F96L 5AW3B 5BS0A 4RNRB 5K9QI 4PJEF 1JI2A 2JCCB 3EYFA 2CDEA 4P8QA 4QRBA 2W07B 5E8NB 3W0WE 4N85A 2BOBB 2Z9TA 1LVEA 4M5SA 2NLJA 3WNNA 3BP6B 4YE4L 1OKEA 4OGZA 4XR8C 4AMKH 5AOZA 4XPBH 3B2XA 1P9MC 4UTBA 3RX7A 5FHBL 5A40E 5ABDE 4YHIA 4HT1L 4JE0A 1DVTA 1JGLH 1R3LA 2CIIA 1OAJA 4TVPE 2BNQD 2AQSA 4EQ2A 1SMOA 1NC2D 1XL6A 2E6PA 2NY2B 5L2KA 3IU3B 4NO5A 3S3CB 1A1OA 4DKDC 4KNTA 3SGEH 2HT4C 3SDCB 1AG6A 1A6WH 4URTB 1TQTA 2AV1B 2WKLA 4J3XA 8PAZA 2X6UA 2Y36L 5FGCB 5LQBH 1UA6L 1WHPA 4PBXA 2HLFD 2NR6D 3B5TA 3MJ6A 5FYKD 1BIIB 2ZPKL 1I9IL 1WBXA 2UUDK 1XIWA 4RSYA 4Z23A 3GMQA 4NXSA 3MXVH 5JA9A 3IJEB 1CLZH 1N8OE 3V9EA 4WV1C 1KY6A 3VDCA 2W94A 3FO0H 3F7LA 3GMNA 2X9WA 1DBAL 3MBWB 1EJOH 1GGBL 1IARB 1SJVA 4OVVA 4QIRA 1KGJA 2YPLA 5C0BD 3IFNH 4L0PB 2VC2H 2O6FA 1SFHA 1IAIL 1YEGL 5KEZA 1A6TA 1LQBC 5DMGD 3VWJD 3SODB 4FA6A 4NBZB 3FMGL 4L3AA 1XXDC 2XG5B 1J1OH 1Q0EA 3DJRA 1YNKH 3MOAH 2CMRL 1JVOA 4JGMA 1ADQA 2EYSB 3MRDA 5F3BB 5CXPA 1NC4D 4HBCL 5EWIH 1NGQH 4GRWE 3S36H 2CIKA 4OZGA 3TVMB 4HHGA 3QZNA 3CD4A 3DX8A 3AXLA 1TSHA 4P5KB 4PJCF 4IOFD 2NUTA 5I6LA 4XP4L 2BSSA 4JN2A 3H56A 4JREC 3PDDA 1ZA3A 4JDVA 1D7DA 3EGSA 2WLNA 5TE6L 5JQHC 2YQGA 5KG9A 2BNRD 2NX5B 8FABB 4G6FD 1WLHA 3NCEB 3S37H 1H3TA 4Z77B 2NY0D 4ODXA 1PKQE 2GJ6B 1IU1A 1TF4A 4YL4A 2HFFB 4AYSA 3TV3L 4G7SB 1RI8A 5IVXF 3S88H 2OMUB 3GMRB 2NUPB 4WEBH 4XXCA 4BSVB 3GS0A 4N0FA 1GMEA 5SWZB 4ZZKA 4RFNC 4ZNEA 3WJJC 2DMKA 2VITA 2XZCL 3FT3B 4PRHB 4M3KB 1QLRA 4OGAC 3UX9B 1JNHA 1NDMB 5I1AA 5HY9B 5JPNC 2VDKH 4WHYG 4PR5A 3FB5A 5IMKA 1VCBC 1S7WA 1GSKA 2OSLB 1CQYA 4JZJC 4QGYA 1CT8B 3DBXA 4GQZA 1C1EH 5AAPA 4U1HA 4MFHA 4M5ZL 4JFDE 5A2LH 4NKMB 3AACA 3L3IB 2X4TA 2C4XA 2V37A 4AQ1B 2JKJA 4E9QA 3RFZB 3U30C 2A77L 1F6AA 4Z7OB 3T3PB 3KPOA 3EFDH 4P48A 2Z35A 4G43A 5B1JA 4KQ4H 3UBHA 2GAZA 4LBAA 2ZCLH 5LGHH 4QD2E 4FZ8H 5ANMA 1G1KA 1A0QL 2X4RA 4R5TA 1P0SE 4XWGL 3BQUC 4M62L 3RVXD 2ZAGA 4HGWB 5E2TH 4AYFB 3QXDB 5HGBA 4QLRA 1IEAA 5GISH 4XBEH 3F12A 2A3TA 4I8DA 4MBRA 1Q38A 4K94H 1BXVA 2AAAA 1HK6A 3QDAA 2VLJE 3TEYA 4ZFQA 4LIQH 2AF2A 3WXVL 5EIIB 2AZAA 3ECVA 2P8MB 3AU1A 1QUPA 3HC4H 4NZRL 4OZHA 4JQXA 4HYTB 4F8PA 1MQKH 3TNNB 3QQ9C 3U2SA 3VA2C 3IJSA 1BXXA 1AKJB 1A6ZB 3GBDA 5E8PA 1UH3A 3ZR6A 3NPZB 5CBEA 4E9VA 1XF2B 2PCXA 1EAPB 1TQWA 4KX8A 1YQVH 2UXGA 3AREB 2IPKB 4ODUA 2F7OA 5D93B 4OSUH 3SGKA 1NDGA 2WZPD 4P5TC 4PJ7B 1JZGA 4A68A 5KYYA 1KNOB 4PJAA 3VU2A 1EK3A 3VFUB 2B9AA 1T3FB 3RL2B 4N9GB 4NQCE 4AV0A 2BSRA 1D9KC 1ZSDB 3KGUA 3CZFA 1MCJA 1M7DA 3O6FB 1MCPH 4TL4A 4KZCA 1QLFA 4Q52A 4L9LC 1HSAB 4LVNC 5E4IA 3HI1B 5FM5M 5C07B 2QELA 1LILA 3QIBD 4J3SA 4M61A 4Z7NF 3GSUB 4K5NA 4QHMA 3K0WA 4GIOA 1OLZA 3KWXA 3LS5L 3KM1A 2VZTA 3KJ4C 3GHBL 4ZUSB 3SPVB 1HEZA 2FO8A 3Q6FA 3VAEA 3BKYH 1F4XL 1U8OA 4DVBA 3BAWA 4J27A 4M4RA 2EC9U 3PAUA 4FFZA 4I0PD 3GMPA 3VTAA 3ZE0E 1KXTA 1I1CA 4P59L 5KVEH 4OV5A 1VADA 2YD8A 2LABA 4NKDA 4TULL 5D4JA 1T22A 3W0WA 1A7QH 5INCA 1DBKL 2BHZA 3BSGA 4DUVA 4G6KH 4ZW8A 1YVLA 2CD0A 3RDJA 2PPAA 4FQLL 5L8JB 2QHLA 3FTSA 2BK8A 3KVDD 3BIKA 2J2ZA 5F6IC 4F57H 1CD1A 3ZGIA 3FU6A 2VM4A 4XHJD 3U7YH 3O6ML 4LEXL 3K6OA 1JWSA 1AR1C 1P2CB 4LRNL 4PJHB 4G8IB 1IBFA 2Q87A 4K9EC 4BH7B 3ZT6A 4CN4A 1MHEB 2E75C 3QFDA 2YAHA 4HCGA 4AUUA 2BVPB 4Q7DA 3MFGB 4NUPA 4XCCH 5IJKA 2C5DC 3C6LB 1QR1A 5GSVA 3VXTB 2LU5A 2ZCHH 5HYIA 5GHWL 3UYRH 4ZMNA 1BG1A 2QADC 3QJUB 5CINH 3H9HB 4GO8A 1AQDA 2P80D 4YGAB 4R2GD 2VH5L 3C08H 5DRWA 4MAUH 2H8PA 3VI4F 1M1SA 2CPUA 4CSSA 3V8CA 1SY6H 5K9JH 2B39A 2LHAA 4ODVH 4DESA 2WPGA 5LXGH 5JHLA 2V8LA 4ZOEA 4V1DE 1FPTH 4PAZA 4YHML 1K6QH 5B3SB 1IGYA 1BP3B 2DJ4A 3QCTL 2IQAB 2AJSL 5ETUB 4L3CA 4XOCA 2ZOKB 1OCWH 5HDRA 4G6JL 3FOLA 4JPIB 1NLDL 3EZ8A 2C4FU 5FAAA 4ALAL 4RRPM 5F7BA 3UCRA 5D8JL 1UUNA 3W11C 4M7KL 5D1QC 5EFIB 3G6AB 2F2HA 3BSZL 4Z3IA 1JWMA 2WYIA 3P02A 3NUKA 4HOZA 1H8OA 3FCGA 3AABA 1MIEH 1YMMD 4ZW7A 5I18L 2JNZA 1JZDC 4KXAA 4KFZC 2GSMB 1JVLA 5KBNC 1OANA 1L0QA 1Y18B 1KF9B 2FNWA 2V7HB 5C0JA 2BRRH 3B2VH 2YSSB 4PJFE 2WD0A 5AW9B 4NQTA 5GRWA 3WLBA 2P7TB 4WO4B 5KSUA 2DLEA 2F0CA 3KPSD 3MLZH 1I7RB 3ULUE 2UZIL 1KC5L 1PKQA 5F7FA 2AVGA 4IKNA 2GSGB 4U3SB 3OKNA 3IFOB 3LD8C 4FQPA 2GIXA 4PJ5B 3U1PA 4JEGB 4LVOB 1BF2A 4RMRA 4KK5C 1ETJA 1HIMH 2DJMA 3KW7A 5ACLA 2K9UA 3GTNA 4LSTH 1QBMH 2ERJB 5DZAA 1H6TA 1XR8A 2IH9A 2J3SA 4NQXA 2EE6A 1UWYA 3F5WB 3HE7A 2BDNH 1LO2L 2OSYA 5C9KA 1DVFD 4W4NA 2L3BA 5ADOH 4WFFE 2AXGB 2PPDA 2RR3A 4RGOL 2GBTA 2YOCA 1E9PA 1F8TL 1MKFA 4JFDA 3TEZA 1HYRC 2HMIC 1NAMB 2GJJA 3BVTA 5HGHB 4OLVL 3C60C 4EZMA 2YD3A 4YHZH 5ICYB 1DSFL 1U8MA 2VE6A 3TF7C 5FCUH 5IVNA 1JFQL 2CKBA 2X4SB 3M46A 1P7BA 4I89A 2CJUL 3U6XA 3MNVA 2LU4A 2R2CA 4QPEA 2FJSA 3L5XL 3PRZA 3D4CA 1BZEA 1W72L 2MSPA 5CMAA 3WI9A 4DN3L 2R7EB 1F56A 3R0MA 3UROR 2XWTA 5DF0A 1OQOA 1RIUH 4I0KA 4IU2B 1BM3H 1UG9A 4G72B 3QUYB 3FONB 5K69A 1RVFL 2IBBA 1SXSA 2XXCB 1A8JH 2VLJA 3BFOA 3DYMA 5F0LB 5DRNB 2VRQA 3UG5A 4G3YH 3U0TB 1TTUA 5F9AC 1EEQA 4OZFH 5AVRB 3ZDXE 1T1WB 1A2YB 3FDWA 1QRNE 3RHWF 2PW2A 3MACH 4ZAKA 2B1HL 4UUJA 5C0AE 3D33A 2AJXL 3BEWA 3EH3B 1FGVH 2G5RA 2ICEA 4HD5A 4M7JH 3VXQA 3D69B 4M6NL 1FO0H 1XGUB 2PTUA 2UZXB 3DMMC 5KYNA 2R83A 2ROXA 2B4CC 2RAMA 2GTWB 4F15B 4WQOA 4JLRB 2NZ1A 4GUQA 4HVBA 4LCIH 4TNVK 3VCLB 4L1TA 1OAUH 1H6FA 4D2NA 3QPKA 3T2PA 4S2SB 4IOIB 4YZWA 3QDJB 2WP3O 2EXTA 1U41A 4GMSH 1EHKB 3F6JA 4KZEH 3X11A 4CADA 3V6ZA 4NQCA 4PJGE 4Y5XC 4ONHA 1WA1X 3LH2L 3SQBB 1DVYA 2AEQL 3QNZA 4FMKA 4QRRB 1J12A 4ZDHA 1U2CA 5HHXH 1A9EB 3ZZQA 1SOQA 1YMHA 3QCVL 2H32B 4N90D 3GT6A 3HG5A 1TFPA 3FULA 3H7LA 3JZYA 3T5WA 5F7UA 2L04A 3D85A 2DQTH 2FR4A 4LSRH 4NM4H 5AW0B 3I6KB 3ZUNC 1NUGA 4PLOB 3QUZA 3X1NA 2CH8A 2K6YA 1RZIA 4IOSA 4KHTH 2A1WH 4X8CA 4PRIA 5D72L 4OT1L 2BVQA 3VG0H 1N68A 3P30L 2ARJA 5IR1A 5ABAA 1K8IA 4IMKC 3RYMA 4J4PA 3QIUD 1S7SB 2O6DA 2Q86B 2NY2C 3L2LA 3MO1A 4S1SL 1B3JA 3FUMA 2UY6A 5J1AB 4TM9A 4NQQA 1CE1H 3SDCC 1URZA 3L48A 1GYVA 3PL6A 4DUXA 1NEZB 2J57A 3DUSA 3GSNA 5HGDB 3E6FA 4ANWA 2VMDA 4QTIL 4RX4A 2ZUQB 4YX2L 3OHMB 2C34A 2Q9OA 2IH1B 3ALPA 3NFSL 2CDGA 3CSYB 4UT6A 2DQGH 1D5ZB 4KTYA 2R69H 4ES8A 5C0BE 3TPUB 5CLWA 2GJZB 4P46D 4NRYB 5GJSL 3BYYA 3TA4D 3DSNA 1CFSB 3MJ8B 3N9GH 4WU7A 3KYMB 5DEGB 3MYJB 2MIZA 3BP4A 3BRGC 2JJSA 5K33A 4LL9A 3CLFL 5EU7E 1NGXB 3VGGA 3DOIA 4OGQC 4U1LB 1Y07A 2PXYA 4MJ4A 1PVHA 2OYKA 2DWEA 4QXUL 1JHKL 1BVKB 3L6FA 4PB0H 2FJUB 3ZHLA 5E94A 3MN8A 4AGPA 3FSWA 4F3FB 1I1AD 1E4XH 1RZ8B 2AEPH 3EBAA 4KJWC 3LZLA 5DK0B 1ZLUK 2WLYA 5IIEA 1DQJB 4ERSH 4ONFH 4Z3GA 1QTSA 2AQRA 4Q6KA 3Q44A 4HPOL 4G5ZH 1WZ1L 1DJXA 2O6CA 2CHZA 4HOMA 2OMTB 5KOVC 3GSOB 2Y72A 3MOBL 4V1DA 2WLLB 3MGTA 3TVMC 2BNRE 1PZUB 4NP4L 3HA0A 1W0VA 4C47A 2F19H 1KGCE 1TKWB 5HI3D 4XGZA 5IROA 4P9HL 4NYLB 1X5XA 3BOVA 2DQMA 4IRSB 1ZIAA 3GUTB 1P5VB 1QNZL 1DBML 4N6RB 5LXVA 2IALB 1F90L 3UDWA 1AZRA 4ZODA 1ITCA 1E5YA 1FUNA 2EDTA 2I26N 2OYMA 2W95A 4QRAA 5DO2D 3VI3B 3HG3A 3II3A 3V0EA 3LSOA 1OO2A 1UJ3B 3B1UA 4KX9A 3TH3T 5FYLL 1UCTA 5EBLA 3REVA 4HMDA 4KQ3L 1PLBA 4WSGA 3GXNA 3VFTB 4FFYL 1GHFH 3Q01A 4TVUA 2QJDA 5D4QA 5EC1A 2VAJA 4CC4C 3DRTB 5CWSB 2XKNA 5E95B 4X8XA 4MNGB 3LHPL 4WSJA 4NCDA 4JFYB 3FSAA 4MD5A 2Z31D 5FB8B 2ZUUA 3MRNA 2ESVD 5DCCA 3BUYA 1JI1A 2YQ3A 3DECA 4H8UA 2IDCA 4PJFA 3TBSB 1M05B 4MQXC 1OIOA 1MJJA 3GNML 4GAYA 5TGBB 2YMTA 2OW6A 5GGQL 4DFHA 3JV4B 5BJTA 3B37A 3RVTD 4NWUH 3NGBB 4UQ3A 5EZIH 1W9XA 2EQDA 4YDZA 1HJCA 2HXAA 4DTGH 4RDQG 1MFBH 3KYNA 4RSVA 4AQ1C 4U1NA 4QOKE 1IQWH 3RFZC 2BIIA 1N9PA 1BVNT 2V3DA 3G5ZB 3LNHA 3EJYC 1J0IA 4UDTA 5FKPA 1E2WA 4RGNB 3QHTC 3BAKA 3RVWD 3TIEB 1ZA6A 2AQPA 3CFDA 4BCXA 3NIDF 1I3GH 1OT4A 4O4YH 4RAVB 2IADB 3HAEA 4M6ML 4Y2OB 1QR4A 5DZNA 3V4PL 4G5AA 1COBA 4WW1A 4XVTL 4EO5A 5I1JL 4GIPD 4UTBH 5EORH 2FQDA 1VEPA 1PL3A 2XUWA 1IGFL 1RUPL 3NCYP 1ES0A 2XQYA 4LK4A 4UT7L 3R19A 2KC0A 1BOYA 2AGJH 3ZGHA 4EI5D 3ILDA 4OCSH 2JELH 4L0ZA 4E9WA 3OHXB 4JFTA 2XC8A 1I4FB 2AQNA 2YPKB 4PB9H 2TRYA 5EOCJ 1ZHBB 3I02A 5LAXB 4F8NA 1PMYA 2W38A 3KS0J 1PKOA 4D9QD 3WTTA 5E08H 4FXKA 3K71A 3HE6B 3F58L 3OZ9H 1OAQH 3PP3K 3AREC 3Q2WA 3TJHD 1BYNA 1NLBL 5JOFB 1IVLA 1TZIA 4WJKB 4N25A 5D93C 2E8ZA 4PGEB 4MSWB 5D5MB 4I88A 5BQ7B 2I7SA 4PJDE 3TYFA 2F54E 1HKLL 3UGUA 4BZ2L 1UOWA 3NJHA 3NJJA 1QRNA 3VWKB 5BO0D 1WIOA 4DP1X 1V3LA 1G7PA 2ITDA 3QC6X 1RPUA 3P4MA 1K5WA 3GJFK 1FC2D 1TCRA 3NZ8A 1Y0LA 3SKJH 5IUSA 5EU3A 3O6FC 1YEEH 1J9RA 4PWHA 3ZIYA 2QZQA 1ZEAL 3QE5A 2R23A 5MEQA 3RA7L 1QEWB 3GSRB 3BXNA 1D5MA 4FQIH 4MMYA 1BQHA 2XBDA 3MCLH 5KYXB 4IIQA 1BPVA 1IFHL 1FAIL 4OM1H 3POHA 4E41B 2VXVL 4JO2H 1RUMH 4XP1L 3BAYA 1PQZA 4LFHG 1QBLH 1NMCB 3BWAA 4LAQH 4KJYB 2VDOH 4TRPL 1SM3L 5CD3A 2CLZA 1EJ6A 4GW1A 3IMVA 4PJGA 4FFTA 2EIMB 3OGOE 4NBYB 4UM9A 4Y1AD 3UH8A 1CUOA 4ELME 2YBRB 2ADFL 1KIPA 2OJEA 1D2PA 3EYOA 4X0KB 1DQLL 3F7VB 5T3XH 1ANUA 3VD2A 5F89A 3M8OH 4JFQB 2ZUWA 4HXAL 2ZCKL 4LPVA 1MAJA 2Y9RT 2WKOF 32C2B 5F0MB 4AEFA 1IE4A 2R0WH 2FB4H 3FQ4A 2B7DT 3SBPA 4FHBD 4KZ0A 1KB3A 3D3VD 2VZ3A 3FB6B 3DETC 1BECA 4B9KC 2ZX6A 1QWUA 1BQRA 3D2TA 3ZDYB 1UB5A 2EXYD 1GCFA 1DUYB 2I27N 4M02A 3MNZA 4ZMQA 4HUXB 1MUJA 2CLVB 3RJDA 3U36B 1CG9B 2NR6A 1XGTA 5J3HD 3BZ4B 4HUMB 2WBXA 2DICA 1SLXA 1EHAA 3L13A 3ARDC 3C6LC 3MJ9L 4BDVA 1G43A 4R84A 1HDMA 2C3GA 4MASA 4WJ5B 4H8WH 1SF5A 3IU4L 3LKNA 3HC3H 1MZZA 1T7XA 4LHUB 5MENE 2BOCA 2N01B 5EPMB 1SZNA 2J8UB 5C0BA 3LKSA 3VD5A 4ZFOA 1CDGA 1HQ4B 3CDCA 2QV2A 3HIZA 4NENB 4JJHA 3ILPA 4PQXA 1HOCB 3BO8A 5EG6C 1V3JA 12E8H 4H1LA 4ABVA 2FBJL 1AFVL 1MF2H 2YUVA 2V33A 1XH2A 2VLRD 1NC4A 3IDXL 1VGEH 3NIFF 4R0LA 1B2WL 1KN2L 1TJHH 4NZJA 3S8GB 4JN1H 1AMYA 5EUKB 1YMME 3FAXA 4WCYH 4HIIA 1E6JH 3A4FA 1WIUA 2WWNA 1J8SA 4K7FA 3GB7A 5IT2L 4FI7A 1IFRA 2NW3B 5D1ZD 3TT1L 5JPMA 5F3HB 2GUOB 4R4ND 5TD4A 4OD3H 3APCA 3LH8A 2HVJB 4NZFA 3KLQA 1UT2A 3MREB 3KPSE 1FFOA 3NIGE 5HHPA 3A23A 5CJXC 3WNPA 4UZGA 2JXMA 2ARWA 2D03L 2DL9A 4FYSA 2XV6B 3ZY7A 2W59A 4PRPE 3SE4C 3QEGL 3UL4A 3GMMA 4B0MB 2C9VA 4DW2L 2DAVA 5JUEH 2VXQL 5I8KL 4NX0A 4WO4C 5A2IH 1INQA 3AT0A 2FT8A 1SHSA 3HAEG 4H8PA 3S3DB 1BZDA 2BH0A 3QXTA 3A4DA 4HF5L 3PWPD 4AK2A 1CS6A 2BSED 4XI5C 2LLGA 5F97E 5MP6H 3MUGB 3WY3A 1S7UB 1WC7B 3EO1B 4MQTB 4LVOC 4ZO8A 1FN4B 3IJHA 5GGSA 3VGFA 2QSVA 2YIHA 5CIPB 4UYQA 2B15A 5AVWB 2X3BA 4F9PA 2ERJC 3JWDC 4DKEL 3WFDH 1NIDA 3GD1C 1U33A 2EILB 2ZUVA 3LIUA 4W6WB 4Z7UF 5KJ4A 4ODWB 2FBRA 1PZBA 4N2EA 5AW5B 2W81C 3WO3B 3B8YA 2ED6A 4Z0BH 3UZEC 1JXKA 3RIAK 4PVNA 3CDGB 3VRIB 3LS4H 3AC0A 5D6DC 2H2PD 4QOKA 5HHOD 4D0CB 5C6TL 3MROA 2VDRL 2YN5A 1RXLA 3FCUB 3K74B 4QF1B 3IN0A 4YPJA 1WCBB 5LUMA 4O2FA 1LXMA 4YN3A 4HJEA 5TH2B 4P4KD 2XWJB 4MMZC 4NDMB 2F8VA 4ABWA 3WU1A 5SWSB 1CLOH 2X88A 3N85L 2UY7A 1EHXA 3BD5A 3QUYC 4RLDA 4ANXA 4LCWB 4ZPVB 2VR8A 5BZXA 2FECI 4KRMB 1RJZA 5TK4A 4PY8J 4ZZFA 3DX7A 3O3AA 4GLRH 4LSQH 1BFTA 3IE9A 2NSQA 4DAGH 2E7LC 1IGIH 4KROB 3HI5L 3MPCA 4FKHA 3BVUA 4JBSA 1E9QB 2OZ4A 3V5KB 1N64L 3FAWA 2BZCA 2VR6A 4Y8DC 4WDIA 4AYDC 1OWRM 3U4KA 2YGQA 5B1JC 3ZT7A 1E42A 1S3KL 4PV9B 2HT3C 5IJCC 1A3RL 1SMAA 4UIMA 4I87A 1GZHC 4XP6H 4U6TA 4FADA 1HCFX 3BW9A 2OS7A 4F15C 1CN4A 1ZS2A 4HG4J 3EFFB 4GEJA 4PP2B 2WWKT 4HCRA 5FHAH 4PJDA 2WXFA 3HCVB 5I5JA 1CLYH 1PZDA 3G5VA 4PRDB 4LU5H 2F54A 3BN9D 3NSJA 5F1KC 4ADIA 5JHLH 3VW3L 2ZSWB 3QCUL 4N90E 4JPSA 4V11A 5I1LB 1D7BA 2R0ZL 1KGXA 2DJSA 2P5PA 3DVNB 4R6UA 3WTXA 2BIPA 3MR9B 3W3BA 1S7QB 4RH4A 3D4GA 3BISA 1S5HA 2EUZA 2R2HA 4P0DA 3I9GH 5LDUA 5FDWA 2G4EA 4J3OD 4LHQB 3V2AR 3QFGA 3VXSD 1ZGLA 1XB3A 3OLDA 4U6YB 4ACPA 3D6GA 4Y5YB 2J72A 2FX9L 4HUUA 4BZ1L 4MNQD 4X6BB 1MLCB 1YJDC 4I0PA 1OGAB 3KMDA 3OKDB 1VDGA 2BSDA 2DYPD 3I75A 3EDJA 1OTTD 2JKRM 2ZOLB 1IBHA 2DKSA 2K4AA 5E1QA 1AI1L 3LKQB 4QYAA 4JG9A 4OZ4A 3RVVD 5FYLD 3SDDC 4Z7QB 4UQ2A 4U7SA 2VC2B 4X6FA 4L4VD 1B0IA 3QXUA 5KS9F 3FB8A 2CA4A 3LRSB 1R34A 3FO1A 1HHHA 5C09B 2X2YA 3MA9L 3BAEL 4JL2A 3A6CL 1PIGA 2MTAA 1RZQA 2DMHA 4OJEH 1WS8A 3FUIA 4J5VA 1S9XA 3MRQB 1JPGB 1QG3A 2ZF8A 3F64A 1K4DB 2YD2A 4Y5VA 2QQLH 2ZUQC 3MLUL 5EU5A 1A7BA 3KVQA 1QPKA 2AJYL 5GGTL 5GRYA 4PYGA 3BKML 2ADYA 5ICXB 1PIFA 5EV7A 2FUQA 3WFEH 3K4DA 3OPZH 3OJVC 1BFVL 4LLVB 2P80A 3L9BA 4GAAA 1YY9D 2BY3A 1DVQA 5TF1L 1N6VA 4ZXBB 4N26A 3WLWC 4HKZB 1NGWA 5DRZB 1X5FA 4YBQD 4L8SB 4F9LA 1P4BL 4NT6B 1BGXH 3LZQA 4I2XB 4BWUA 4AUYA 5MENA 3OX8A 3FSOA 1TVBA 2NW2A 2XA8H 1EMTL 4XCYA 2KZ1B 1A14L 1SJEB 1FNSH 2FGWL 2FJFA 3A21A 4W6YB 5FF6A 5AAMC 3QI9B 5DEZA 2SEBB 1SJHA 2MFNA 1A3LL 4HS8L 4RAUB 2CKBH 3VD7A 2FLBT 5EF2A 4BH8A 5ACZA 3OKKA 4YSQA 2VDKB 4A6YH 5GS2D 4YFLI 2W60A 4M5TA 1Q94B 3O11A 2OJ1A 5IF0B 3LIZA 4GUPA 4Y9CA 5TQ0L 4QT5B 2Y1ZA 2A6IA 1D6EB 4IRSC 4KDTA 1YMMA 2X3AA 3D87B 2C9AA 2W9LA 2YWYA 2Z4QB 1W8NA 1ERNA 1HJBC 2J8OA 3Q8EA 4HZAA 3CPLA 2PMZA 2RFXA 2GTQA 3L3OB 4PGCA 1F4YH 1X6LA 3GRGA 3HNTH 4X9IA 1UJ3C 2Y24A 2X2JA 1NCHA 3I2CH 1R3HA 2BP8A 4NPYA 1LE9B 2C8NA 1G9NL 4NJAL 4X5WB 3UTTD 1TG8A 4YHPA 4DGIH 4LVHB 3FQWB 3PP4H 3CX2A 3ESOA 4PRPA 3NJLA 2J20A 2WZ6A 1Q0XL 1E2VA 2P8PB 1MW0A 3H3BC 1YEKH 1JPFB 2Y4SA 4M4PA 2G5UA 2BP0B 3N44F 4PM1A 4HLJA 1NCCL 1CFBA 5IB1B 3W38A 1WF5A 3DX1A 1REIA 4O02A 2HJLB 4AIZB 5IFAL 3L4WA 1VFMA 4CGUB 4G1EA 1Z66A 1XB6A 5CJOH 3SCMA 5F9OH 5DUPH 3KPPB 3FF7A 2R0KL 3TT3L 5CILH 2NOYA 2YPVH 1NFKA 4MJ2A 1LMKA 5HYSG 1L7IH 1PY4A 2NY6B 3T0EB 4RGNC 4UANA 4ZUTB 4XNDA 4H88L 1MWAA 4ZOCA 4ZS6D 2VDLL 1JERA 5A1AA 2W0KA 1MFMA 1JD7A 2IH3B 4IJ3C 4RBPH 4OU3A 4TPRL 5IVZA 5I6NA 4MJ6B 2BPBA 5DVNA 3CX5K 4ZFFB 3HG1D 4NI3A 1ZHKB 5E1AA 1CGYA 5B39A 1CDHA 3ARGB 1AIFB 2JV6A 1DJIA 4EZJA 1ZT4A 4Y2NA 4DN4L 2DEYX 2J1WA 3UBXB 5C0RL 1OTSD 5D6CA 4P23B 1XEDA 4HIEB 1TNNA 4D9QE 2JTDA 4Y16C 5GQBA 4AZ8A 2DWSA 4Y9BA 2DD8H 2YK1H 4HJIA 2VN6A 3OHXC 2WINA 5IM7B 5KSVA 1A3QA 3X3FH 3MAWA 3G7TA 3BWUF 4CGTA 5E2VH 3HE7C 3QFJD 1ACXA 5A43C 6FABL 2XY1A 3F83A 3LXCA 5HYEA 1NKOA 1WJ3A 3CFTA 1ZLEA 3HE6C 4PSPA 1CIDA 2LTQC 3FH8A 3UADA 3BI9X 1QFWM 2V5TA 2E59A 4O2CB 5DJCB 2AJVH 1UZ8B 1XO8A 2EIBA 3OR7B 3FTZA 4APQB 2L7UA 3FU8A 3KPRD 4PREA 4HEPA 1D5XB 1MW2A 4Z7NE 4UYPA 2D7TH 1VZGA 3GUFA 4GSQA 4I48B 3VWKC 3LVEA 5EZOL 3RZCD 3VYOA 3QJVB 5IEKB 5DFVD 5H37H 1OARH 5FA3A 5LGJA 1Z9MA 1UM4H 3VD4A 2EIJB 4LKCA 1J05B 4Y1AE 5JORB 1JNNH 2P5ED 5J6HB 3ZMRA 2CK0H 2PR9A 3V7AE 3QORA 2XVBA 4TTGA 3RJQB 3ETBJ 3E6HB 5I15L 1A6UH 3ECBB 3Q48A 2VKXA 2X53A 1CD0A 3PLYA 3TO2B 5AVTB 4BSWA 5HYSB 4FTVB 1UD2A 4YHNA 3BAIA 4J28A 2YKLH 4U1MB 1V05A 3L1OH 4UZUA 2DL2A 3P9WB 3D3VE 4FXTA 4ENED 2FRGP 2ICEC 4K2UL 2WCPA 1IEBA 2VMEA 1Q9LB 1HILB 1U8QA 1K8DB 2Y25A 3QVAA 2VDPH 1LDPH 4HK3N 4JRYD 4OAWA 3UAFA 3F01A 4LPCA 4M1GL 3RDTD 4HW6A 1KIQA 3IDNA 3QUGA 5ERWA 2NTFA 1XXFC 3QEUA 5T1LA 1FVEA 1YN7B 1OF2A 4GPVA 4ZW3A 1URLA 4IBZA 2LE9A 1WWAX 1QO3B 2ICES 3VSQA 1PZ5B 1UATA 1QFWH 1KBGH 2K4WA 1CE6A 3QUXB 1MNUH 4DP7X 2WSKA 3LXBA 2DWDB 4DPBX 4P46A 4PVBA 3QA3A 3VI4E 1KCWA 1KTDA 3C5ZD 2X12A 5CSBA 3PJSB 4Y8AA 5HVHB 4XXDA 3LZFL 4GEIA 2P8LB 3QNYA 4XAKD 2YEVB 3FU7A 2IDQA 3Q7JA 1NA8A 2C9UA 1JPTH 2Y7NA 4LLUB 4OZFG 4XZ4A 1BJ1J 1GGTA 3L2NA 3M6DA 3MLVL 1JNLL 4XMZA 2VLRE 4I18B 1MW1A 5GZND 4XTRD 3P2DA 4Q0XL 4L5FE 4XC1L 1KZQA 1WD8A 1QFOA 2XN9B 3CN1A 5F1NB 3SO3C 1A1MA 2EXWD 1I1AA 1WT5A 2DM7A 3ZU8A 2IV8A 2JIXA 4X8JB 2AC0A 2FCBA 3S3BB 4MX7A 3GXDA 1U3HD 5HJ3B 5DMYA 1GZQB 2VIRB 1G7JB 1YDPB 4HKJA 3ZDZE 3WFHB 1IM3D 4QJ5B 3EDFA 4Z8FL 2E9GA 3FHAA 1XAKA 1UWGL 2PF6A 4QRPD 3LQAL 4OLZL 3Q0HA 2ED8A 5DT1H 2JTYA 4UQCA 4M8QA 1QKZH 3IJ9A 2J4WH 4JR9L 4KKRA 2A74A 4IBTA 4P5SA 1HI6A 3OJDB 4U6HA 5DSCA 5K1VA 3VFRB 4KKZA 2CALA 1BQ5A 2OYLA 1N0XH 1LEIB 4RQQB 3MBEB 1N4XL 1X5HA 4HISA 3GZOA 3H42H 2K9FB 4RAHA 5B38A 2R1YB 5L88L 2NTSP 4PJBB 4PS3A 2FHBA 1YUHB 2VCOA 1SDDA 1AXTL 1E5BA 3ZKNC 3S4SB 2PNDA 3MRJB 3PAVA 2Z93A 3AM8C 1PFOA 3U4EB 5IKCB 3QUMA 4DQAA 4R83A 1CBVL 3I9AA 5CSZA 5C2BH 4K7PX 4ZMTA 3SE6A 2KERA 5D4IA 2UWEE 1FZOB 2ADJB 3QULA 1AG0A 1NPUA 4UMSA 5AKSA 2EJ1A 1MRDL 4AQ8C 2H6PA 3KYAA 2Y1VA 4KVNL 3T3MF 3NJXA 5J11B 1PX8A 4OF7A 5FUOH 1BVNP 2EINB 2FEDD 5HDWA 2F58H 1NCDH 4I1PA 1J9CT 1DVSA 2VXTL 5AYUL 1U8HB 4FJYA 4XN5A 5CEZL 1Y6KR 1DJWA 4WTQA 4XNUL 5FC9A 4ELKA 4XODA 4ZOAA 4OZFB 3KBHE 4Y2DD 3NCWA 4ES9A 5DS1A 1T04B 2AK1L 4HLZH 1BAFL 4XAWL 2IANB 3QEHB 1WA0X 5SX5K 1RAMA 4HV8A 1D2OA 4WW2A 5DO8A 3MLTB 1NEUA 1FO0B 3ZE2B 1S9YB 2D9QB 3VX0A 1KXHA 4GAGH 4Y4KD 3E3QC 3OB0H 4HBQA 4D9RE 4HEPG 4S1RH 4Q6IA 3CHSA 4FXGA 4LESA 3W5NA 2MCMA 1GAFL 1OB1B 2CCVA 4WWID 1QPXA 2C9QA 4IGBD 5E0FA 4H8QA 3PGDA 2RALA 3FO9B 1I85A 3FFCB 5F70A 3OPUA 4M7LT 5D1XD 3D9AL 1FRGL 5IK3B 3THML 3QC5X 4X4XA 4KROC 1VKXA 2QR0A 4Q8BA 1BD2D 3H2PA 1RK1B 1DQQA 1UYWL 2NZ9C 1FFQA 5FYKH 4A2LA 1UXMA 1GW6A 5FUCE 1P4IH 5AZUA 1SN0A 3FQNA 3RIAF 3GRBA 4ZD3L 4ABUA 2Y7QB 1N67A 3L81A 3D50A 3K1DA 4LL4A 2BMKB 1Y6MR 2L7EA 1ZHLA 4WI2A 3MRKB 5FECA 2HTKD 4BA0A 2D73A 1AOHA 1VFBA 2P5WE 2PCYA 1O9VA 1KLUA 1JRHH 3CVBA 3KLDA 3ZTEA 1KLGA 2ENJA 5D2LE 1AR2A 1MI5B 2GC7C 1UQSB 2IWGA 2VXUL 5HD8C 3JYCA 4G9FE 1BVLA 3VXSE 4F8TA 1Q8MA 5GS1A 2UV3A 3VACA 3AAZA 2DLGA 5IBLD 1CD8A 2YAEA 4UNVA 4TSCH 3SY6A 4ANUA 4R8WL 2PTTB 1FVDB 2WXLA 2FEEI 4X9FA 2BVUA 3RKPA 4YDIL 3Q5TA 3DHPA 3NRFA 4C4BA 3MLWH 4XPTL 3ZQ9A 3CMOL 4Y1AA 5HDBE 1OOAA 1I3VA 4O5LH 4L4VE 3UEQA 1JK8B 4L4JA 4NO0A 3RWJA 4UTAA 1I1YB 1QVOA 1THAA 4HWZB 3G5YA 3T2QA 4UDUB 3MCG1 3W9EB 4ZUWB 1F1DA 2HAZA 1LE5B 3E1F1 5DC2A 4M56A 2CUHA 1BEYL 3VXPA 4MWFA 3VYNA 1XWVA 4C56B 1XGQA 2CBPA 5HJGA 3KPNB 4HJTA 4G8AC 1U91B 3NA9L 2ED9A 3D3VA 4M5YL 4MJIB 1ETZA 3QJQB 4Y2LA