1SFCB

Neuronal synaptic fusion complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
72
structure length
72
Chain Sequence
SKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (SYNAPTOBREVIN 2)
publication title Crystal structure of a SNARE complex involved in synaptic exocytosis at 2.4 A resolution.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein
total genus 34
structure length 72
sequence length 72
chains with identical sequence F, J
ec nomenclature
pdb deposition date 1998-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1sfcB00
3HD7D 1GL2A 1JTHA 1GL2C 4W80A 3RK2D 1L4AD 4N78E 2XDJA 1KILC 1N7SA 3RK3D 2H8PD 3RL0B 4WY4D 3RK2B 2HG5D 1L4AB 5KJ7C 2NPSC 1KILB 4LGDE 4WY4B 4W7YA 3HD7C 1L4AA 3RK2C 1L4AC 5CCGD 1KILA 2NPSB 1URQD 2HFED 4WY4A 3RK3C 3PP5A 4WY4C 3HD7B 1SFCD 5CCHD 2M8RA 4JF7A 4W7ZA 2N1TD 5KJ7A 2NPSA 3B5ND 3HTKB 1XTGB 1HVVA 3RK3B 3HD7A 3M0DC 5CCGA 2N1TB 5CCGC 3B5NB 1N7SD 3VOPA 1URQC 4OH8B 1JTHB 1SFCC 2WZ7A 2N1TA 3B5NA 5CCHC 2N1TC 3B5NC 2YMYA 3RL0D 1URQB 1GL2D 1SFCB 1KILD 1URQA 1N7SC 2PP6A 2KOGA 1T3JA 1NHLA 1SFCA 1GL2B 3KYQA 5CCHA 3P8CE 5KJ7D 2NPSD 1N7SB 3RL0C 3TSIA
chains in the Genus database with same CATH superfamily
1OMIA 3O6QA 1E5WA 2H43A 2XDJA 3AE6C 2OTJP 2HG5D 1SQBG 4TLFA 2Q5UA 1FS0E 1M1JA 2KNCA 3II6A 1HGVA 2FYUE 4UB8H 1VQ5P 2AXCA 3MTUE 3R2PA 3H1LJ 3CX5I 3H1ID 2AXTE 2J58A 2OYIA 5TJHA 3PP5A 2JWAA 1YBKA 1L0LJ 1RY3A 5B5EH 3EFGA 3E7KA 1VDFA 3GLMA 3RGUA 1FOSF 4D6TE 1T3UA 2Z4EA 4N78D 2K9JA 3CWBJ 1SQXE 1MFZA 3T97A 1PGOA 1NTZJ 4ZNCA 2PRRA 1VF5D 3VOPA 1L0NG 1JM0A 2YKOA 2FY8A 2JWDA 1IO4A 3S9OA 1GDTA 2DW3A 2XV5A 3WU2E 1VQ9P 2BCCE 1CI6A 3H1HJ 2IBZI 3CI9A 1NU1E 5BVZA 3FGAD 1SQQK 3AE5C 1FJPA 1UIXA 1NHLA 1T6AA 3IR9A 3G4SP 1BSHA 5BU5A 3CD6P 1FAVA 2E75D 1KQFB 3PHLA 1S1CX 1MV8A 3L71D 4ZKUA 4GOFA 1T2KD 3PRJA 1L2PA 1SS1A 5APWA 1J1DC 3ITKA 1H88A 1VQMP 4UB6E 2QJPC 1JOCA 1KB9D 3RL0B 3L74E 4BXLA 5AVWB 4K35A 2NPSC 1JY3O 1KTMA 2A06D 1JEKA 1HWTC 2V7QH 2CK3H 3L73E 1BGYD 4AYCA 3CXHI 2G3AA 3L75D 3S1KA 1P84D 1PFIA 2ZXEB 4DZOA 1M57D 3VYIA 1NWQA 5CCHD 1LTAC 2Y9ZA 3HD7A 3GW6A 4KT0J 3EQ2A 1NTKJ 1MUUA 1KYOE 3M91A 4OH8B 2QM7A 2H7HA 3RK3E 1G1JA 4D6TG 4M3LA 2JEEA 1SQXG 5E79H 3M0DA 2CPSA 4C7NB 2AEJA 3W68A 1N7SC 3A2AA 2KOGA 1YJNP 2BCCG 3FWLA 1FZCB 3MP7B 2FFDA 2FFDC 1DH3A 1NU1G 2Q1KA 3V2PA 2FBWC 2C9NY 2P10A 1SQVJ 2W8ZA 3RL0g 3HE5A 3VMAA 2JDIH 4YPCA 3GF3A 4BRYB 2E75B 1KQLA 1IFPA 3L72E 2P1JA 5AW0B 2HLOA 1DD3A 5KJ7C 2KS1B 1IFDA 1M1KQ 1JY2N 3IN6A 3MZWB 1RF1A 3L74G 5CMZA 1PGQA 1URQD 2D2CC 2WVRA 1H0TA 1JB0J 1N86A 4WVZA 1DIPA 1G2CB 3TK1A 5AVZB 4ASWA 2N1TD 3CC2P 3B5ND 1SQQD 3A0BE 3NTNA 4IL6H 3L73G 4OGQD 3A0HH 1KC8Q 2XZRA 3H25A 3OAKA 5CCGA 5CCGC 2O01J 3IF4A 1J1EB 1CZQA 5L8RJ 4I1LA 2WZ7A 1PPJD 3CLQA 2GM4A 2WSFH 1VL2A 3VMYA 3L35A 3BASA 4I7ZB 1LTGC 3BCCD 2PP6A 1T3JA 3H1IE 2Z5IA 3AE1C 2KYVA 3KYQA 4LLHA 1PP9D 3WUTA 3Q5RA 3G3ZA 5AVVB 2R3SA 4HB1A 3P8MC 3H1LG 2R44A 1MZ9A 3CX5H 1ZRTD 4N78E 2FXOA 2K1AA 1IFIA 2WQYC 1LWUB 4JYBA 5KLVK 2K37A 4B86A 4C7NA 3CWBG 2SPZA 1L0LK 1GW4A 1NTZG 1W5CE 2QJKC 1VQPP 1FJKA 1N73B 1FZEA 3L72G 2POHA 5TISE 2IYPA 1HBWA 3P8CD 5CHXA 2WPSA 3PH0A 1FOSE 1MKMA 4JF7A 2XNXA 4W7ZA 3Q3DA 3G71P 1S5LE 1WRGA 2H88C 4BRYA 3MUDA 2WITA 1FZBA 1LNQA 4N3YB 2N1TB 3B5NB 3L71E 3TYYA 3U1AA 1RH5B 3AECC 2KS1A 4OGQB 5AW5B 4ASVA 2WSCH 1KQSO 1JTHB 1KB9E 2YO2A 2OTLP 5DJTB 4YXWH 4ZKPA 1BCCD 2A06E 1LTJC 1VQOP 2K88A 1JY2P 3GHGB 3E1RA 1BGYE 1Q2NA 5DJUB 1OFCX 3L75E 3O6QB 3LW5J 1P84E 2P58A 5CCHA 3VTPC 3AEBC 4XFJA 1OIPA 2NPSD 1WT6A 2FYUJ 2WPVB 3TSIA 4PD4D 1YI2P 3KPEA 5CBNA 3CXHH 4YXDC 1M1JB 3H6PA 2KNCB 3HUSC 1PL5A 3UIAA 1GD2E 2M5AB 2QEXP 2BASA 2YKQA 3KDPB 1PIXA 1EZVG 4D6TJ 1JCDA 2OYIB 1JY3N 1SQXJ 1CSBA 2W83C 4O9BA 2ZVOB 3GG2A 1QEXA 3F5HA 1HUCA 1NTME 1BSNA 2K9JB 4JPZB 2RMZA 5B66E 3T97B 2OYHA 2OYHC 2BCCJ 3TGUD 1NKZB 1NU1J 3AE3C 5M1BA 3HTKA 2YIUC 1N7SD 4JQ0D 1CI6B 2KXPB 1SFCC 2A45I 1RE3C 5KLVD 5KAIE 2W6JH 1SP4A 2OYOA 5KTBA 1W2EA 1L0LD 1URQA 1EDJA 2Y0CA 2KSEA 2E74C 3L74J 5AW9B 1SQPK 3H1KD 1QVGO 1J1DB 5KJ7D 2XNDH 3JCUH 3AE2C 1SQQE 2JKVA 3G6EP 1NKNA 4NPEA 1GL2A 1JTHA 3CMAP 1GL2C 4W80A 1BGYG 3AEEC 3KHUA 1AVYA 1KILC 1RF0A 2D2CD 2J59M 4EYYQ 5AW1B 3L4FA 2KLUA 3C8VA 1PPJE 1BDCA 2OGUA 3KXDA 5GTIE 1PGPA 2YO3A 1L4AA 3BATA 3N4XA 1L4AC 5CCGD 2E42A 1YJ9P 3BCCE 2GUSA 3NMDA 1R5LA 3HD7B 2FYZA 1A02J 2QVAA 2O3JA 3BVHA 4DT0A 1PP9E 2J5UA 4IFMA 3RK3B 2M5AA 3BRTB 1SQBK 1NTMG 3CMEP 1ZRTE 1Y47A 3CCSP 1S2EA 4DJGA 3HE4A 3E1IA 1Q81Q 3CCLP 1QVFO 1W2BO 1JY3P 1IK7A 2FFDB 2H89C 1EXIA 4PJ0E 1GU5A 3L72J 1NAYA 2WMMA 3P8CE 4H13C 1XTCC 3HE5B 1HGZA 1J2JB 3A5TA 2ZYAA 5APVA 1L0NK 3HRNA 3CCVP 2ZT9C 1YTZT 1QL1A 3B8EB 1N8RQ 2ZJSE 2O1KA 4OVNF 3V2QA 1ZW0A 1U7MA 2Y9YA 2WWWA 3CPWO 1RF1B 4PV1C 2D2CB 4IL6X 1H0TB 1BE3E 5APSA 1DEBA 3V2NA 4XE5B 1BCCE 1GTWA 2QJYC 3PJSK 4WY4A 4WY4C 5GTHE 1M7LA 4U3FD 1JCCA 1QGKB 2NPSA 2OARA 1KN7A 1JMBA 3M0AA 1SQPD 1USEA 2V4HA 2WSEJ 3BCCG 4PD4E 5KAFH 3H1IJ 5H2FE 3AEFC 2KB7P 3V6IA 1U7JA 1AJYA 1QL2A 2G8YA 2FYUG 2ITAA 2P2UA 2M3BA 1YYCA 3V4QA 2YMYA 2K9YA 2ZYDA 1PGJA 3KZIH 4N6JA 1E79H 1OW6A 5AVXB 4GDOA 4IOIH 1ZR2A 2P67A 4NPDA 1VF5B 5AVSB 3TGUE 5AVRB 2V7QJ 1NJIQ 5AW2B 3GMAA 3H32A 1FE6A 1N7SA 1NOHA 5K5GB 3RBXA 1YHQP 1KZUB 1SQBD 2R5DA 1LP1A 1S9KD 2IDBA 2KI7B 3FXDA 4MN4C 1WMKA 4L75A 2PAJA 3P32A 1MFTA 3MD0A 5KLVE 3L71J 3IAOA 2KIKA 3AE9C 3EWKA 1SFCD 1Y8AA 2A45H 2N9BA 5KJ7A 1LTTC 3I56P 1ZOYC 1IZNB 3H1KE 1BE3G 2ZAEB 1HVVA 1BCCG 2R32A 1OXZA 4UB8E 2BEZF 4A7PA 2O01H 4RKUJ 1FBMA 1BGYJ 4C46A 1KYOI 1L0ND 4YTPC 2E74D 3L75J 3CC4P 5B5EE 2I1KA 2YXRB 2QSIA 2LXBA 1EDLA 3CX5D 1GL2D 3SWFA 1KILD 2IPPA 3IFMA 2E76C 3M06A 3SFEC 1GU4A 1USDA 3F89A 3RL0C 4HKZH 1BDDA 2Q3IA 2Q3EA 2WPRA 2JJLA 1L4AD 1JUNA 2LXCB 3JC22 1NTMJ 2QA4P 3TGUG 2IBZD 1CW5A 1YQ3C 1JMMA 1DD4A 4I6MC 2OYHB 2WT7B 3A7OA 5BU8B 4GKGA 1RE4A 3FX0A 1RE4C 5EFWB 2KZJA 2R5BA 1JNMA 2YIUB 3HTKB 5KLVG 1AQ5A 1H8AA 1GK4A 2KUBA 4L73A 3PLNA 5KLIC 1LGHB 1NTZK 2I1JA 4H13D 3BRVB 3Q2YA 1YIJP 1SQQJ 2E74B 1URQB 3CXHD 2KZIA 3CL3D 1YITP 2Z5HA 2ZT9D 2L91A 2GA1A 1GW3A 3LW5H 1GL2B 3SFDC 1Z56A 4U3FE 3U1CA 5AVQB 2RKLA 4PV1D 5E79E 1LTJA 1Q86Q 1EZVI 1OW7A 4L76A 2AXTH 1EQ7A 1EDKA 1FZFA 3BCCJ 3ABVC 2FYNC 2Q6QA 2B89A 4WY4D 3TNUA 1LT9C 1L4AB 1EXJA 2IYOA 1PP9J 2PFXA 1OVRA 3H1JD 2N9YB 1OX3A 1VQ7P 3H1IG 1FU1A 3HUSA 3KQGA 4IFFA 4EDFA 3AEGC 3L70D 3M9QA 3WU2H 3D70A 1J1EC 3LIEA 1IJDB 3VP8A 1K8AQ 3L73D 2FKWB 3P7KA 1IFJA 1FZAA 5APQA 3HE4B 4H0LC 2WSSH 3CCRP 3NXSA 1AA0A 1M90Q 1KB9I 1OWAA 1NTKK 4Y28J 2WT7A 3OW2O 1SQBE 2HYNA 1GK6A 4IL6E 3A0HE 1K9MQ 4Y99C 1KYOD 4UB6H 1N7LA 5GTHH 4R4LA 1SFCA 1P84I 2IFMA 5AVYB 2ZT9B 1LWUC 3D6YA 3M9HA 1RQUA 1RE3A 1BE3J 3H1LD 3L71G 2CPBA 1BCCJ 4PV1B 4U3FG 1SQVK 1Q90D 1L0NE 3L36A 1HH0A 1X79B 1NAFA 1OZHA 1TU3F 2QJYB 2A06G 3CWBD 2QJPB 4WY4B 1NTZD 3RK2C 3CX5E 1KILA 3D6ZA 5APTA 2NPSB 3MGNA 1KYOH 3L72D 2Q9IA 3L75G 2E5TA 2YKPA 2LR2A 3QH9A 1T8ZA 3JSVC 3WUUA 3USSA 3V2RA 3H1HD 3ZDMA 3Q5PA 2XKMA 1FDMA 2NZ2A 3RBZA 1AV1A 3AE7C 2E76D 4IFDK 3CC7P 1EC5A 1S3JA 1OW8A 3GHGC 1VQ8P 2Y0DA 3RL0D 3TGUJ 2IBZE 1S72P 4RESB 5KKZC 1YTZI 1Q7YQ 2E43A 1KV4A 1YQ4C 5AW8B 2ZVNB 4DOJA 2BEQD 2FXPA 1QX8A 3H32B 1M1JC 1NTMK 1K04A 4KJMA 1N7SB 1KMIZ 1LTSC 2RH0A 5KLVJ 2Q7CA 1LP1B 3LIDA 3SWKA 2OYIC 4EIJA 2QIWA 4KHXA 4WWIA 3A0BH 2ZFCA 2YMKA 3H1KJ 1IC2A 2QE7H 1D7MA 3C1LA 1EZVD 1OVUA 5APYA 1SLQA 4GODA 2W27A 1NTKD 2R3CA 3CXHE 2K3RA 1HF9A 1NYHA 2B87B 2C0XA 3OA7A 4XA4A 1SQQG 1XTGB 3EFFK 1G1IA 4RJTA 2WSEH 5AVTB 2RN0A 2QM8A 2O01N 3Q5SA 1LTIC 2JR8A 4EI2A 3Q1MA 1PPJG 3C9IA 1VQNP 2E76B 5C39A 4AQRD 2HODA 5CJ0A 1SQVD 2L5GB 1U57A 2HPCA 3H1JE 2Y0EA 3MIWA 4K3AA 1VQ4P 4H44C 1PP9G 2IBZG 2KSJA 4BWNA 3L70E 1S4XA 4Z1MH 5CBOA 2KK7A 1ZXGA 2FYUK 5TISH 2E5YA 4LC1A 2MKVA 4R4MA 3WUVA 1S5LH 1GMJA 3JCUE 3HD7C 2NRGA 3AEDC 4ZMDA 1LJ2A 4H0LD 3RK3C 1SQXK 1KB9H 1JO5A 2QJKB 4CPGA 2KP8A 3CCQP 1PV3A 4RO0A 4U7JA 3AEAC 5CJ4A 1N2DC 5KLIB 1AVOA 3M0DC 4PD4I 3H1LE 1NTMD 1KFNA 1NU1K 1ZV8A 1P84H 1L0LE 4U3FJ 4WB4A 2P7JA 3A3YB 1IK9A 1DX7A 1ZMEC 2YNYA 2B87A 2M0BA 1SQPJ 3CWBE 2AEMA 1NTZE 1K05A 3CCMP 2OQQA 4GOEA 2WPQA 5AW4B 1LTJB 3N7NA 5APXA 3VN0A 4TT3H 1ZN5A 3WMM0 2FYNB 1VQ6P 3H1HE 3H1JG 1LT9B 3RK2D 3TNUB 1RF1C 3VP9A 3CCEP 2H8PD 3M9BA 3CCUP 3L70G 5B66H 1KD1Q 1EDIA 3MHVA 4DCKA 1X22A 5APUA 2IX7C 3U59A 3HUSB 1IFMA 2ZYGA 3R4YA 3AE4C 2UWJE 1NVOA 1LTBC 2W90A 1SQBJ 3NFQA 4H0LB 5KAIH 4I2LC 1RQVA 2JP3A 2C9LY 1AQTA 2B88A 4Y99B 3I5CA 3V4WA 2FYUD 3V5BA 3QWOC 3L37A 2WSFJ 2QG4A 4JYCA 1ZR4A 1EZVE 1SFCB 2YXQB 1X0TA 1NTKE 1FZGA 5KAFE 1VF5C 1L0LG 3SSUA 1RHZB 1L0NJ 3H1KG 1ZP0C 2O1JA 4D6TD 5AW7B 1SQXD 5GTIH 3B71A 3PTZA 1FZCA 1PZQA 3GF7A 1FZCC 1KORA 1H89A 3KZIE 3CCJP 3RK2B 2BCCD 3H1HG 1KILB 1FC2C 1HJ0A 1NU1D 4HH2A 5AVUB 3MUDC 2E75C 2HR3A 1ZLLA 1FDIA 2IFNA 1R5SA 1SQVE 1SQPE 1T2KC 1HTLC 4NPFX 3O8ZA 1Y9BA 2HFED 3I55P 1LT9A 3AE8C 2M8RA 2AEFA 1VQKP 1BE3D 1YJWP 3VMZA 1K73Q 1G2CA 3L74D 2IZ1A 1DEEG 4PJ0H 1AFOA 2C0WA 2WSCJ 5CCHC 4H44D 5KKZB 3FWNA 4JBZA 1GZLA 1X8YA 1KQGB 1A02F 2GUVA 1NGMB 1M8OB 4OWFA 1X9VA 2XU6A 4I7ZC 1M56D 3D71A 3FXEA 4C7RA 3HD7D 1FDOA 1S9KE 1NTKG 5AW6B 4QMAA 3W67A 4H13B 1SVFA 3TF5A 2PGDA 2KLVA 4HYTB 3RK3D 3B4SA 3K5BA 1JY2O 1LWUA 2ZXXA 4LGDE 4W7YA 3TDKA 4PD4H 2FXMA 2B9BA 5H2FH 1UIIA 4EOTA 5AW3B 2WTYA 1VPCA 1OVVA 1N73A 1KFMA 4L74A 1N73C 1SQVG 2VRSA 1SQPG 2JO1A 2MJZA 4AUWA 2OTKE 4WBAA 3H1JJ 4GT1A 4HJGH 1URQC 4GIFA 2HODB 2LKMA 1KILE 2I8DA 2N1TA 3B5NA 2W6BA 2N1TC 2HPCB 3L70J 3B5NC 3OJAB 2QRXA 4OGQC 1R8EA 1IFNA 3L73J 2W6AA 1NH4A 4H44B 3G9RA 1RF0C 2A45G 1NO4A 1HJBA 1QLED 3SWYA 2M3EA 2IZ0A 3S4RA 1LT1A 3GHGA 1S5LX 1VQLP 3VMXA 1Q82Q
chains in the Genus database with same CATH topology
2Q3IA 1E5WA 2WPRA 3KPEA 2JJLA 2H43A 1L4AD 1JUNA 2XDJA 1M1JB 3H6PA 2FYUK 3HUSC 3UIAA 1GD2E 2HG5D 4LC1A 2Q5UA 2BASA 2YKQA 3KDPB 1M1JA 3II6A 1JCDA 1HGVA 1CW5A 2OYIB 3HD7C 1JMMA 1JY3N 1CSBA 4O9BA 3MTUE 3R2PA 4I6MC 2OYHB 2WT7B 3A7OA 2J58A 5BU8B 4GKGA 2OYIA 3RK3C 1HUCA 3PP5A 1RE4A 1SQXK 1RE4C 1RY3A 3EFGA 1VDFA 2R5BA 1JO5A 1JNMA 2OYHA 2KP8A 2OYHC 1FOSF 3HTKB 1T3UA 5CJ4A 1AQ5A 2Z4EA 1NKZB 1N2DC 4N78D 1H8AA 3M0DC 1GK4A 1MFZA 3T97A 3HTKA 1KFNA 1N7SD 3VOPA 1NU1K 1CI6B 2YKOA 1ZV8A 1IO4A 1LGHB 1NTZK 1SFCC 1GDTA 2I1JA 2A45I 3BRVB 2XV5A 4WB4A 2P7JA 3A3YB 1IK9A 1DX7A 1CI6A 2YNYA 1RE3C 1URQB 3CI9A 5BVZA 1SP4A 3CL3D 2Z5HA 5KTBA 1W2EA 1SQQK 1URQA 2WPQA 5AW9B 1SQPK 5AW4B 1GW3A 1LTJB 1FJPA 1NHLA 3LW5H 1GL2B 3N7NA 5APXA 3IR9A 3VN0A 5BU5A 1J1DB 1Z56A 5KJ7D 3U1CA 5AVQB 1ZN5A 3WMM0 1FAVA 1NKNA 1LTJA 1GL2A 1MV8A 4ZKUA 1JTHA 1LT9B 1GL2C 4W80A 3RK2D 3TNUB 1T2KD 5APWA 1J1DC 1KILC 1RF1C 1H88A 1EQ7A 3VP9A 1FZFA 1RF0A 2J59M 1JOCA 2H8PD 3RL0B 3M9BA 4WY4D 3TNUA 1LT9C 5AVWB 5AW1B 1L4AB 3L4FA 2NPSC 1JY3O 5APUA 2IX7C 3U59A 3HUSB 2YO3A 1HWTC 1L4AA 3BATA 1IFMA 3N4XA 1L4AC 4AYCA 5CCGD 2E42A 1FU1A 3HUSA 2GUSA 3NMDA 3KQGA 4IFFA 1PFIA 2ZXEB 3HD7B 4DZOA 2FYZA 3VYIA 3M9QA 1NWQA 5CCHD 1A02J 1LTBC 1J1EC 3NFQA 3LIEA 1IJDB 3VP8A 3BVHA 1LTAC 4IFMA 3RK3B 3HD7A 4I2LC 3BRTB 2FKWB 3P7KA 3EQ2A 2C9LY 1IFJA 1SQBK 1FZAA 5APQA 3HE4B 1MUUA 3M91A 4OH8B 2QM7A 3NXSA 2H7HA 4Y99B 3I5CA 1G1JA 3V4WA 1OWAA 1NTKK 4M3LA 2JEEA 3HE4A 3E1IA 3V5BA 2WT7A 2HYNA 3L37A 1GK6A 4JYCA 1ZR4A 3M0DA 4Y99C 2CPSA 1SFCB 1JY3P 4C7NB 2FFDB 1FZGA 1N7LA 1N7SC 3A2AA 2KOGA 1GU5A 1SFCA 2IFMA 2O1JA 1FZCB 5AVYB 3P8CE 2FFDA 1XTCC 3HE5B 5AW7B 2FFDC 1LWUC 1DH3A 1HGZA 3V2PA 3M9HA 1RE3A 1J2JB 3A5TA 5APVA 1L0NK 2C9NY 2CPBA 1FZCA 3HRNA 1FZCC 3HE5A 1YTZT 1QL1A 3B8EB 2O1KA 1H89A 1KQLA 3V2QA 1SQVK 3RK2B 3L36A 1HH0A 2P1JA 1X79B 5AW0B 2HLOA 1NAFA 2WWWA 5KJ7C 1KILB 1RF1B 4HH2A 5AVUB 1IFDA 4WY4B 1JY2N 1ZLLA 2IFNA 5APSA 1DEBA 3V2NA 3RK2C 4XE5B 1T2KC 1GTWA 1KILA 1RF1A 5CMZA 1HTLC 5APTA 2NPSB 3MGNA 2Q9IA 1URQD 3O8ZA 2HFED 4WY4A 4WY4C 1N86A 1M7LA 1G2CB 1LT9A 3TK1A 1JCCA 2YKPA 5AVZB 2M8RA 1T8ZA 2N1TD 2NPSA 3B5ND 3V2RA 2OARA 3M0AA 3VMZA 3NTNA 2XKMA 1FDMA 1G2CA 2XZRA 3OAKA 5CCGA 5CCGC 1J1EB 4IFDK 1CZQA 1AFOA 2KB7P 2C0WA 4I1LA 2WZ7A 3GHGC 5CCHC 1QL2A 3CLQA 2GM4A 2P2UA 2M3BA 1YYCA 3V4QA 2YMYA 2WSFH 1GZLA 3RL0D 3VMYA 1X8YA 1A02F 2GUVA 3L35A 3BASA 4RESB 1LTGC 1YTZI 2E43A 2PP6A 4N6JA 1T3JA 5AVXB 5AW8B 1X9VA 2XU6A 2Z5IA 4DOJA 2KYVA 3KYQA 4LLHA 3H32B 1M1JC 1ZR2A 2P67A 1NTMK 3G3ZA 5AVVB 1N7SB 5AVSB 1LTSC 3HD7D 4C7RA 5AVRB 3P8MC 1S9KE 5AW2B 5AW6B 1MZ9A 4N78E 3H32A 2Q7CA 1SVFA 1IFIA 1LWUB 2KLVA 1N7SA 3LIDA 4HYTB 1NOHA 4JYBA 3RK3D 2OYIC 4EIJA 5KLVK 4KHXA 1KZUB 4B86A 2R5DA 2ZFCA 4C7NA 1JY2O 1LWUA 1IC2A 1S9KD 5APYA 4LGDE 1L0LK 1SLQA 4W7YA 1GW4A 2W27A 2PAJA 3P32A 3MD0A 2FXMA 2R3CA 1FJKA 1N73B 1FZEA 2POHA 1HBWA 3P8CD 4EOTA 5CHXA 2WPSA 1FOSE 5AW3B 1SFCD 2A45H 2C0XA 2WTYA 4JF7A 1VPCA 2N9BA 2XNXA 3OA7A 1LTTC 4W7ZA 4XA4A 5KJ7A 1N73A 1KFMA 1XTGB 1WRGA 1N73C 3MUDA 2WITA 1HVVA 1FZBA 2R32A 2VRSA 1G1IA 2MJZA 1OXZA 4AUWA 2WSEH 4WBAA 5AVTB 4GT1A 2O01H 4N3YB 2N1TB 3B5NB 3TYYA 2QM8A 3U1AA 1FBMA 4C46A 5AW5B 1URQC 4GIFA 2HODB 2LKMA 1LTIC 2WSCH 1JTHB 2I1KA 2N1TA 3B5NA 2YO2A 2W6BA 2N1TC 2HPCB 3B5NC 3C9IA 4AQRD 2HODA 3OJAB 5CJ0A 1IFNA 4ZKPA 2L5GB 1LTJC 2W6AA 1NH4A 1GL2D 1JY2P 2HPCA 3GHGB 3SWFA 1KILD 2IPPA 3IFMA 1RF0C 3M06A 3MIWA 2A45G 1NO4A 1HJBA 3SWYA 3GHGA 5CCHA 3VTPC 1GU4A 2NPSD 2KSJA 1WT6A 3VMXA 3RL0C 3TSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HD7 D;  1GL2 A;  1JTH A;  1GL2 C;  4W80 A;  3RK2 D;  1L4A D;  4N78 E;  2XDJ A;  1KIL C;  1N7S A;  3RK3 D;  2H8P D;  3RL0 B;  4WY4 D;  3RK2 B;  2HG5 D;  1L4A B;  5KJ7 C;  2NPS C;  1KIL B;  4LGD E;  4WY4 B;  4W7Y A;  3HD7 C;  1L4A A;  3RK2 C;  1L4A C;  5CCG D;  1KIL A;  2NPS B;  1URQ D;  2HFE D;  4WY4 A;  3RK3 C;  3PP5 A;  4WY4 C;  3HD7 B;  1SFC D;  5CCH D;  2M8R A;  4JF7 A;  4W7Z A;  2N1T D;  5KJ7 A;  2NPS A;  3B5N D;  3HTK B;  1XTG B;  1HVV A;  3RK3 B;  3HD7 A;  3M0D C;  5CCG A;  2N1T B;  5CCG C;  3B5N B;  1N7S D;  3VOP A;  1URQ C;  4OH8 B;  1JTH B;  1SFC C;  2WZ7 A;  2N1T A;  3B5N A;  5CCH C;  2N1T C;  3B5N C;  2YMY A;  3RL0 D;  1URQ B;  1GL2 D;  1SFC B;  1KIL D;  1URQ A;  1N7S C;  2PP6 A;  2KOG A;  1T3J A;  1NHL A;  1SFC A;  1GL2 B;  3KYQ A;  5CCH A;  3P8C E;  5KJ7 D;  2NPS D;  1N7S B;  3RL0 C;  3TSI A; 
#chains in the Genus database with same CATH topology
 1OMI A;  3O6Q A;  1E5W A;  2H43 A;  2XDJ A;  3AE6 C;  2OTJ P;  2HG5 D;  1SQB G;  4TLF A;  2Q5U A;  1FS0 E;  1M1J A;  2KNC A;  3II6 A;  1HGV A;  2FYU E;  4UB8 H;  1VQ5 P;  2AXC A;  3MTU E;  3R2P A;  3H1L J;  3CX5 I;  3H1I D;  2AXT E;  2J58 A;  2OYI A;  5TJH A;  3PP5 A;  2JWA A;  1YBK A;  1L0L J;  1RY3 A;  5B5E H;  3EFG A;  3E7K A;  1VDF A;  3GLM A;  3RGU A;  1FOS F;  4D6T E;  1T3U A;  2Z4E A;  4N78 D;  2K9J A;  3CWB J;  1SQX E;  1MFZ A;  3T97 A;  1PGO A;  1NTZ J;  4ZNC A;  2PRR A;  1VF5 D;  3VOP A;  1L0N G;  1JM0 A;  2YKO A;  2FY8 A;  2JWD A;  1IO4 A;  3S9O A;  1GDT A;  2DW3 A;  2XV5 A;  3WU2 E;  1VQ9 P;  2BCC E;  1CI6 A;  3H1H J;  2IBZ I;  3CI9 A;  1NU1 E;  5BVZ A;  3FGA D;  1SQQ K;  3AE5 C;  1FJP A;  1UIX A;  1NHL A;  1T6A A;  3IR9 A;  3G4S P;  1BSH A;  5BU5 A;  3CD6 P;  1FAV A;  2E75 D;  1KQF B;  3PHL A;  1S1C X;  1MV8 A;  3L71 D;  4ZKU A;  4GOF A;  1T2K D;  3PRJ A;  1L2P A;  1SS1 A;  5APW A;  1J1D C;  3ITK A;  1H88 A;  1VQM P;  4UB6 E;  2QJP C;  1JOC A;  1KB9 D;  3RL0 B;  3L74 E;  4BXL A;  5AVW B;  4K35 A;  2NPS C;  1JY3 O;  1KTM A;  2A06 D;  1JEK A;  1HWT C;  2V7Q H;  2CK3 H;  3L73 E;  1BGY D;  4AYC A;  3CXH I;  2G3A A;  3L75 D;  3S1K A;  1P84 D;  1PFI A;  2ZXE B;  4DZO A;  1M57 D;  3VYI A;  1NWQ A;  5CCH D;  1LTA C;  2Y9Z A;  3HD7 A;  3GW6 A;  4KT0 J;  3EQ2 A;  1NTK J;  1MUU A;  1KYO E;  3M91 A;  4OH8 B;  2QM7 A;  2H7H A;  3RK3 E;  1G1J A;  4D6T G;  4M3L A;  2JEE A;  1SQX G;  5E79 H;  3M0D A;  2CPS A;  4C7N B;  2AEJ A;  3W68 A;  1N7S C;  3A2A A;  2KOG A;  1YJN P;  2BCC G;  3FWL A;  1FZC B;  3MP7 B;  2FFD A;  2FFD C;  1DH3 A;  1NU1 G;  2Q1K A;  3V2P A;  2FBW C;  2C9N Y;  2P10 A;  1SQV J;  2W8Z A;  3RL0 g;  3HE5 A;  3VMA A;  2JDI H;  4YPC A;  3GF3 A;  4BRY B;  2E75 B;  1KQL A;  1IFP A;  3L72 E;  2P1J A;  5AW0 B;  2HLO A;  1DD3 A;  5KJ7 C;  2KS1 B;  1IFD A;  1M1K Q;  1JY2 N;  3IN6 A;  3MZW B;  1RF1 A;  3L74 G;  5CMZ A;  1PGQ A;  1URQ D;  2D2C C;  2WVR A;  1H0T A;  1JB0 J;  1N86 A;  4WVZ A;  1DIP A;  1G2C B;  3TK1 A;  5AVZ B;  4ASW A;  2N1T D;  3CC2 P;  3B5N D;  1SQQ D;  3A0B E;  3NTN A;  4IL6 H;  3L73 G;  4OGQ D;  3A0H H;  1KC8 Q;  2XZR A;  3H25 A;  3OAK A;  5CCG A;  5CCG C;  2O01 J;  3IF4 A;  1J1E B;  1CZQ A;  5L8R J;  4I1L A;  2WZ7 A;  1PPJ D;  3CLQ A;  2GM4 A;  2WSF H;  1VL2 A;  3VMY A;  3L35 A;  3BAS A;  4I7Z B;  1LTG C;  3BCC D;  2PP6 A;  1T3J A;  3H1I E;  2Z5I A;  3AE1 C;  2KYV A;  3KYQ A;  4LLH A;  1PP9 D;  3WUT A;  3Q5R A;  3G3Z A;  5AVV B;  2R3S A;  4HB1 A;  3P8M C;  3H1L G;  2R44 A;  1MZ9 A;  3CX5 H;  1ZRT D;  4N78 E;  2FXO A;  2K1A A;  1IFI A;  2WQY C;  1LWU B;  4JYB A;  5KLV K;  2K37 A;  4B86 A;  4C7N A;  3CWB G;  2SPZ A;  1L0L K;  1GW4 A;  1NTZ G;  1W5C E;  2QJK C;  1VQP P;  1FJK A;  1N73 B;  1FZE A;  3L72 G;  2POH A;  5TIS E;  2IYP A;  1HBW A;  3P8C D;  5CHX A;  2WPS A;  3PH0 A;  1FOS E;  1MKM A;  4JF7 A;  2XNX A;  4W7Z A;  3Q3D A;  3G71 P;  1S5L E;  1WRG A;  2H88 C;  4BRY A;  3MUD A;  2WIT A;  1FZB A;  1LNQ A;  4N3Y B;  2N1T B;  3B5N B;  3L71 E;  3TYY A;  3U1A A;  1RH5 B;  3AEC C;  2KS1 A;  4OGQ B;  5AW5 B;  4ASV A;  2WSC H;  1KQS O;  1JTH B;  1KB9 E;  2YO2 A;  2OTL P;  5DJT B;  4YXW H;  4ZKP A;  1BCC D;  2A06 E;  1LTJ C;  1VQO P;  2K88 A;  1JY2 P;  3GHG B;  3E1R A;  1BGY E;  1Q2N A;  5DJU B;  1OFC X;  3L75 E;  3O6Q B;  3LW5 J;  1P84 E;  2P58 A;  5CCH A;  3VTP C;  3AEB C;  4XFJ A;  1OIP A;  2NPS D;  1WT6 A;  2FYU J;  2WPV B;  3TSI A;  4PD4 D;  1YI2 P;  3KPE A;  5CBN A;  3CXH H;  4YXD C;  1M1J B;  3H6P A;  2KNC B;  3HUS C;  1PL5 A;  3UIA A;  1GD2 E;  2M5A B;  2QEX P;  2BAS A;  2YKQ A;  3KDP B;  1PIX A;  1EZV G;  4D6T J;  1JCD A;  2OYI B;  1JY3 N;  1SQX J;  1CSB A;  2W83 C;  4O9B A;  2ZVO B;  3GG2 A;  1QEX A;  3F5H A;  1HUC A;  1NTM E;  1BSN A;  2K9J B;  4JPZ B;  2RMZ A;  5B66 E;  3T97 B;  2OYH A;  2OYH C;  2BCC J;  3TGU D;  1NKZ B;  1NU1 J;  3AE3 C;  5M1B A;  3HTK A;  2YIU C;  1N7S D;  4JQ0 D;  1CI6 B;  2KXP B;  1SFC C;  2A45 I;  1RE3 C;  5KLV D;  5KAI E;  2W6J H;  1SP4 A;  2OYO A;  5KTB A;  1W2E A;  1L0L D;  1URQ A;  1EDJ A;  2Y0C A;  2KSE A;  2E74 C;  3L74 J;  5AW9 B;  1SQP K;  3H1K D;  1QVG O;  1J1D B;  5KJ7 D;  2XND H;  3JCU H;  3AE2 C;  1SQQ E;  2JKV A;  3G6E P;  1NKN A;  4NPE A;  1GL2 A;  1JTH A;  3CMA P;  1GL2 C;  4W80 A;  1BGY G;  3AEE C;  3KHU A;  1AVY A;  1KIL C;  1RF0 A;  2D2C D;  2J59 M;  4EYY Q;  5AW1 B;  3L4F A;  2KLU A;  3C8V A;  1PPJ E;  1BDC A;  2OGU A;  3KXD A;  5GTI E;  1PGP A;  2YO3 A;  1L4A A;  3BAT A;  3N4X A;  1L4A C;  5CCG D;  2E42 A;  1YJ9 P;  3BCC E;  2GUS A;  3NMD A;  1R5L A;  3HD7 B;  2FYZ A;  1A02 J;  2QVA A;  2O3J A;  3BVH A;  4DT0 A;  1PP9 E;  2J5U A;  4IFM A;  3RK3 B;  2M5A A;  3BRT B;  1SQB K;  1NTM G;  3CME P;  1ZRT E;  1Y47 A;  3CCS P;  1S2E A;  4DJG A;  3HE4 A;  3E1I A;  1Q81 Q;  3CCL P;  1QVF O;  1W2B O;  1JY3 P;  1IK7 A;  2FFD B;  2H89 C;  1EXI A;  4PJ0 E;  1GU5 A;  3L72 J;  1NAY A;  2WMM A;  3P8C E;  4H13 C;  1XTC C;  3HE5 B;  1HGZ A;  1J2J B;  3A5T A;  2ZYA A;  5APV A;  1L0N K;  3HRN A;  3CCV P;  2ZT9 C;  1YTZ T;  1QL1 A;  3B8E B;  1N8R Q;  2ZJS E;  2O1K A;  4OVN F;  3V2Q A;  1ZW0 A;  1U7M A;  2Y9Y A;  2WWW A;  3CPW O;  1RF1 B;  4PV1 C;  2D2C B;  4IL6 X;  1H0T B;  1BE3 E;  5APS A;  1DEB A;  3V2N A;  4XE5 B;  1BCC E;  1GTW A;  2QJY C;  3PJS K;  4WY4 A;  4WY4 C;  5GTH E;  1M7L A;  4U3F D;  1JCC A;  1QGK B;  2NPS A;  2OAR A;  1KN7 A;  1JMB A;  3M0A A;  1SQP D;  1USE A;  2V4H A;  2WSE J;  3BCC G;  4PD4 E;  5KAF H;  3H1I J;  5H2F E;  3AEF C;  2KB7 P;  3V6I A;  1U7J A;  1AJY A;  1QL2 A;  2G8Y A;  2FYU G;  2ITA A;  2P2U A;  2M3B A;  1YYC A;  3V4Q A;  2YMY A;  2K9Y A;  2ZYD A;  1PGJ A;  3KZI H;  4N6J A;  1E79 H;  1OW6 A;  5AVX B;  4GDO A;  4IOI H;  1ZR2 A;  2P67 A;  4NPD A;  1VF5 B;  5AVS B;  3TGU E;  5AVR B;  2V7Q J;  1NJI Q;  5AW2 B;  3GMA A;  3H32 A;  1FE6 A;  1N7S A;  1NOH A;  5K5G B;  3RBX A;  1YHQ P;  1KZU B;  1SQB D;  2R5D A;  1LP1 A;  1S9K D;  2IDB A;  2KI7 B;  3FXD A;  4MN4 C;  1WMK A;  4L75 A;  2PAJ A;  3P32 A;  1MFT A;  3MD0 A;  5KLV E;  3L71 J;  3IAO A;  2KIK A;  3AE9 C;  3EWK A;  1SFC D;  1Y8A A;  2A45 H;  2N9B A;  5KJ7 A;  1LTT C;  3I56 P;  1ZOY C;  1IZN B;  3H1K E;  1BE3 G;  2ZAE B;  1HVV A;  1BCC G;  2R32 A;  1OXZ A;  4UB8 E;  2BEZ F;  4A7P A;  2O01 H;  4RKU J;  1FBM A;  1BGY J;  4C46 A;  1KYO I;  1L0N D;  4YTP C;  2E74 D;  3L75 J;  3CC4 P;  5B5E E;  2I1K A;  2YXR B;  2QSI A;  2LXB A;  1EDL A;  3CX5 D;  1GL2 D;  3SWF A;  1KIL D;  2IPP A;  3IFM A;  2E76 C;  3M06 A;  3SFE C;  1GU4 A;  1USD A;  3F89 A;  3RL0 C;  4HKZ H;  1BDD A;  2Q3I A;  2Q3E A;  2WPR A;  2JJL A;  1L4A D;  1JUN A;  2LXC B;  3JC2 2;  1NTM J;  2QA4 P;  3TGU G;  2IBZ D;  1CW5 A;  1YQ3 C;  1JMM A;  1DD4 A;  4I6M C;  2OYH B;  2WT7 B;  3A7O A;  5BU8 B;  4GKG A;  1RE4 A;  3FX0 A;  1RE4 C;  5EFW B;  2KZJ A;  2R5B A;  1JNM A;  2YIU B;  3HTK B;  5KLV G;  1AQ5 A;  1H8A A;  1GK4 A;  2KUB A;  4L73 A;  3PLN A;  5KLI C;  1LGH B;  1NTZ K;  2I1J A;  4H13 D;  3BRV B;  3Q2Y A;  1YIJ P;  1SQQ J;  2E74 B;  1URQ B;  3CXH D;  2KZI A;  3CL3 D;  1YIT P;  2Z5H A;  2ZT9 D;  2L91 A;  2GA1 A;  1GW3 A;  3LW5 H;  1GL2 B;  3SFD C;  1Z56 A;  4U3F E;  3U1C A;  5AVQ B;  2RKL A;  4PV1 D;  5E79 E;  1LTJ A;  1Q86 Q;  1EZV I;  1OW7 A;  4L76 A;  2AXT H;  1EQ7 A;  1EDK A;  1FZF A;  3BCC J;  3ABV C;  2FYN C;  2Q6Q A;  2B89 A;  4WY4 D;  3TNU A;  1LT9 C;  1L4A B;  1EXJ A;  2IYO A;  1PP9 J;  2PFX A;  1OVR A;  3H1J D;  2N9Y B;  1OX3 A;  1VQ7 P;  3H1I G;  1FU1 A;  3HUS A;  3KQG A;  4IFF A;  4EDF A;  3AEG C;  3L70 D;  3M9Q A;  3WU2 H;  3D70 A;  1J1E C;  3LIE A;  1IJD B;  3VP8 A;  1K8A Q;  3L73 D;  2FKW B;  3P7K A;  1IFJ A;  1FZA A;  5APQ A;  3HE4 B;  4H0L C;  2WSS H;  3CCR P;  3NXS A;  1AA0 A;  1M90 Q;  1KB9 I;  1OWA A;  1NTK K;  4Y28 J;  2WT7 A;  3OW2 O;  1SQB E;  2HYN A;  1GK6 A;  4IL6 E;  3A0H E;  1K9M Q;  4Y99 C;  1KYO D;  4UB6 H;  1N7L A;  5GTH H;  4R4L A;  1SFC A;  1P84 I;  2IFM A;  5AVY B;  2ZT9 B;  1LWU C;  3D6Y A;  3M9H A;  1RQU A;  1RE3 A;  1BE3 J;  3H1L D;  3L71 G;  2CPB A;  1BCC J;  4PV1 B;  4U3F G;  1SQV K;  1Q90 D;  1L0N E;  3L36 A;  1HH0 A;  1X79 B;  1NAF A;  1OZH A;  1TU3 F;  2QJY B;  2A06 G;  3CWB D;  2QJP B;  4WY4 B;  1NTZ D;  3RK2 C;  3CX5 E;  1KIL A;  3D6Z A;  5APT A;  2NPS B;  3MGN A;  1KYO H;  3L72 D;  2Q9I A;  3L75 G;  2E5T A;  2YKP A;  2LR2 A;  3QH9 A;  1T8Z A;  3JSV C;  3WUU A;  3USS A;  3V2R A;  3H1H D;  3ZDM A;  3Q5P A;  2XKM A;  1FDM A;  2NZ2 A;  3RBZ A;  1AV1 A;  3AE7 C;  2E76 D;  4IFD K;  3CC7 P;  1EC5 A;  1S3J A;  1OW8 A;  3GHG C;  1VQ8 P;  2Y0D A;  3RL0 D;  3TGU J;  2IBZ E;  1S72 P;  4RES B;  5KKZ C;  1YTZ I;  1Q7Y Q;  2E43 A;  1KV4 A;  1YQ4 C;  5AW8 B;  2ZVN B;  4DOJ A;  2BEQ D;  2FXP A;  1QX8 A;  3H32 B;  1M1J C;  1NTM K;  1K04 A;  4KJM A;  1N7S B;  1KMI Z;  1LTS C;  2RH0 A;  5KLV J;  2Q7C A;  1LP1 B;  3LID A;  3SWK A;  2OYI C;  4EIJ A;  2QIW A;  4KHX A;  4WWI A;  3A0B H;  2ZFC A;  2YMK A;  3H1K J;  1IC2 A;  2QE7 H;  1D7M A;  3C1L A;  1EZV D;  1OVU A;  5APY A;  1SLQ A;  4GOD A;  2W27 A;  1NTK D;  2R3C A;  3CXH E;  2K3R A;  1HF9 A;  1NYH A;  2B87 B;  2C0X A;  3OA7 A;  4XA4 A;  1SQQ G;  1XTG B;  3EFF K;  1G1I A;  4RJT A;  2WSE H;  5AVT B;  2RN0 A;  2QM8 A;  2O01 N;  3Q5S A;  1LTI C;  2JR8 A;  4EI2 A;  3Q1M A;  1PPJ G;  3C9I A;  1VQN P;  2E76 B;  5C39 A;  4AQR D;  2HOD A;  5CJ0 A;  1SQV D;  2L5G B;  1U57 A;  2HPC A;  3H1J E;  2Y0E A;  3MIW A;  4K3A A;  1VQ4 P;  4H44 C;  1PP9 G;  2IBZ G;  2KSJ A;  4BWN A;  3L70 E;  1S4X A;  4Z1M H;  5CBO A;  2KK7 A;  1ZXG A;  2FYU K;  5TIS H;  2E5Y A;  4LC1 A;  2MKV A;  4R4M A;  3WUV A;  1S5L H;  1GMJ A;  3JCU E;  3HD7 C;  2NRG A;  3AED C;  4ZMD A;  1LJ2 A;  4H0L D;  3RK3 C;  1SQX K;  1KB9 H;  1JO5 A;  2QJK B;  4CPG A;  2KP8 A;  3CCQ P;  1PV3 A;  4RO0 A;  4U7J A;  3AEA C;  5CJ4 A;  1N2D C;  5KLI B;  1AVO A;  3M0D C;  4PD4 I;  3H1L E;  1NTM D;  1KFN A;  1NU1 K;  1ZV8 A;  1P84 H;  1L0L E;  4U3F J;  4WB4 A;  2P7J A;  3A3Y B;  1IK9 A;  1DX7 A;  1ZME C;  2YNY A;  2B87 A;  2M0B A;  1SQP J;  3CWB E;  2AEM A;  1NTZ E;  1K05 A;  3CCM P;  2OQQ A;  4GOE A;  2WPQ A;  5AW4 B;  1LTJ B;  3N7N A;  5APX A;  3VN0 A;  4TT3 H;  1ZN5 A;  3WMM 0;  2FYN B;  1VQ6 P;  3H1H E;  3H1J G;  1LT9 B;  3RK2 D;  3TNU B;  1RF1 C;  3VP9 A;  3CCE P;  2H8P D;  3M9B A;  3CCU P;  3L70 G;  5B66 H;  1KD1 Q;  1EDI A;  3MHV A;  4DCK A;  1X22 A;  5APU A;  2IX7 C;  3U59 A;  3HUS B;  1IFM A;  2ZYG A;  3R4Y A;  3AE4 C;  2UWJ E;  1NVO A;  1LTB C;  2W90 A;  1SQB J;  3NFQ A;  4H0L B;  5KAI H;  4I2L C;  1RQV A;  2JP3 A;  2C9L Y;  1AQT A;  2B88 A;  4Y99 B;  3I5C A;  3V4W A;  2FYU D;  3V5B A;  3QWO C;  3L37 A;  2WSF J;  2QG4 A;  4JYC A;  1ZR4 A;  1EZV E;  1SFC B;  2YXQ B;  1X0T A;  1NTK E;  1FZG A;  5KAF E;  1VF5 C;  1L0L G;  3SSU A;  1RHZ B;  1L0N J;  3H1K G;  1ZP0 C;  2O1J A;  4D6T D;  5AW7 B;  1SQX D;  5GTI H;  3B71 A;  3PTZ A;  1FZC A;  1PZQ A;  3GF7 A;  1FZC C;  1KOR A;  1H89 A;  3KZI E;  3CCJ P;  3RK2 B;  2BCC D;  3H1H G;  1KIL B;  1FC2 C;  1HJ0 A;  1NU1 D;  4HH2 A;  5AVU B;  3MUD C;  2E75 C;  2HR3 A;  1ZLL A;  1FDI A;  2IFN A;  1R5S A;  1SQV E;  1SQP E;  1T2K C;  1HTL C;  4NPF X;  3O8Z A;  1Y9B A;  2HFE D;  3I55 P;  1LT9 A;  3AE8 C;  2M8R A;  2AEF A;  1VQK P;  1BE3 D;  1YJW P;  3VMZ A;  1K73 Q;  1G2C A;  3L74 D;  2IZ1 A;  1DEE G;  4PJ0 H;  1AFO A;  2C0W A;  2WSC J;  5CCH C;  4H44 D;  5KKZ B;  3FWN A;  4JBZ A;  1GZL A;  1X8Y A;  1KQG B;  1A02 F;  2GUV A;  1NGM B;  1M8O B;  4OWF A;  1X9V A;  2XU6 A;  4I7Z C;  1M56 D;  3D71 A;  3FXE A;  4C7R A;  3HD7 D;  1FDO A;  1S9K E;  1NTK G;  5AW6 B;  4QMA A;  3W67 A;  4H13 B;  1SVF A;  3TF5 A;  2PGD A;  2KLV A;  4HYT B;  3RK3 D;  3B4S A;  3K5B A;  1JY2 O;  1LWU A;  2ZXX A;  4LGD E;  4W7Y A;  3TDK A;  4PD4 H;  2FXM A;  2B9B A;  5H2F H;  1UII A;  4EOT A;  5AW3 B;  2WTY A;  1VPC A;  1OVV A;  1N73 A;  1KFM A;  4L74 A;  1N73 C;  1SQV G;  2VRS A;  1SQP G;  2JO1 A;  2MJZ A;  4AUW A;  2OTK E;  4WBA A;  3H1J J;  4GT1 A;  4HJG H;  1URQ C;  4GIF A;  2HOD B;  2LKM A;  1KIL E;  2I8D A;  2N1T A;  3B5N A;  2W6B A;  2N1T C;  2HPC B;  3L70 J;  3B5N C;  3OJA B;  2QRX A;  4OGQ C;  1R8E A;  1IFN A;  3L73 J;  2W6A A;  1NH4 A;  4H44 B;  3G9R A;  1RF0 C;  2A45 G;  1NO4 A;  1HJB A;  1QLE D;  3SWY A;  2M3E A;  2IZ0 A;  3S4R A;  1LT1 A;  3GHG A;  1S5L X;  1VQL P;  3VMX A;  1Q82 Q; 
#chains in the Genus database with same CATH homology
 2Q3I A;  1E5W A;  2WPR A;  3KPE A;  2JJL A;  2H43 A;  1L4A D;  1JUN A;  2XDJ A;  1M1J B;  3H6P A;  2FYU K;  3HUS C;  3UIA A;  1GD2 E;  2HG5 D;  4LC1 A;  2Q5U A;  2BAS A;  2YKQ A;  3KDP B;  1M1J A;  3II6 A;  1JCD A;  1HGV A;  1CW5 A;  2OYI B;  3HD7 C;  1JMM A;  1JY3 N;  1CSB A;  4O9B A;  3MTU E;  3R2P A;  4I6M C;  2OYH B;  2WT7 B;  3A7O A;  2J58 A;  5BU8 B;  4GKG A;  2OYI A;  3RK3 C;  1HUC A;  3PP5 A;  1RE4 A;  1SQX K;  1RE4 C;  1RY3 A;  3EFG A;  1VDF A;  2R5B A;  1JO5 A;  1JNM A;  2OYH A;  2KP8 A;  2OYH C;  1FOS F;  3HTK B;  1T3U A;  5CJ4 A;  1AQ5 A;  2Z4E A;  1NKZ B;  1N2D C;  4N78 D;  1H8A A;  3M0D C;  1GK4 A;  1MFZ A;  3T97 A;  3HTK A;  1KFN A;  1N7S D;  3VOP A;  1NU1 K;  1CI6 B;  2YKO A;  1ZV8 A;  1IO4 A;  1LGH B;  1NTZ K;  1SFC C;  1GDT A;  2I1J A;  2A45 I;  3BRV B;  2XV5 A;  4WB4 A;  2P7J A;  3A3Y B;  1IK9 A;  1DX7 A;  1CI6 A;  2YNY A;  1RE3 C;  1URQ B;  3CI9 A;  5BVZ A;  1SP4 A;  3CL3 D;  2Z5H A;  5KTB A;  1W2E A;  1SQQ K;  1URQ A;  2WPQ A;  5AW9 B;  1SQP K;  5AW4 B;  1GW3 A;  1LTJ B;  1FJP A;  1NHL A;  3LW5 H;  1GL2 B;  3N7N A;  5APX A;  3IR9 A;  3VN0 A;  5BU5 A;  1J1D B;  1Z56 A;  5KJ7 D;  3U1C A;  5AVQ B;  1ZN5 A;  3WMM 0;  1FAV A;  1NKN A;  1LTJ A;  1GL2 A;  1MV8 A;  4ZKU A;  1JTH A;  1LT9 B;  1GL2 C;  4W80 A;  3RK2 D;  3TNU B;  1T2K D;  5APW A;  1J1D C;  1KIL C;  1RF1 C;  1H88 A;  1EQ7 A;  3VP9 A;  1FZF A;  1RF0 A;  2J59 M;  1JOC A;  2H8P D;  3RL0 B;  3M9B A;  4WY4 D;  3TNU A;  1LT9 C;  5AVW B;  5AW1 B;  1L4A B;  3L4F A;  2NPS C;  1JY3 O;  5APU A;  2IX7 C;  3U59 A;  3HUS B;  2YO3 A;  1HWT C;  1L4A A;  3BAT A;  1IFM A;  3N4X A;  1L4A C;  4AYC A;  5CCG D;  2E42 A;  1FU1 A;  3HUS A;  2GUS A;  3NMD A;  3KQG A;  4IFF A;  1PFI A;  2ZXE B;  3HD7 B;  4DZO A;  2FYZ A;  3VYI A;  3M9Q A;  1NWQ A;  5CCH D;  1A02 J;  1LTB C;  1J1E C;  3NFQ A;  3LIE A;  1IJD B;  3VP8 A;  3BVH A;  1LTA C;  4IFM A;  3RK3 B;  3HD7 A;  4I2L C;  3BRT B;  2FKW B;  3P7K A;  3EQ2 A;  2C9L Y;  1IFJ A;  1SQB K;  1FZA A;  5APQ A;  3HE4 B;  1MUU A;  3M91 A;  4OH8 B;  2QM7 A;  3NXS A;  2H7H A;  4Y99 B;  3I5C A;  1G1J A;  3V4W A;  1OWA A;  1NTK K;  4M3L A;  2JEE A;  3HE4 A;  3E1I A;  3V5B A;  2WT7 A;  2HYN A;  3L37 A;  1GK6 A;  4JYC A;  1ZR4 A;  3M0D A;  4Y99 C;  2CPS A;  1SFC B;  1JY3 P;  4C7N B;  2FFD B;  1FZG A;  1N7L A;  1N7S C;  3A2A A;  2KOG A;  1GU5 A;  1SFC A;  2IFM A;  2O1J A;  1FZC B;  5AVY B;  3P8C E;  2FFD A;  1XTC C;  3HE5 B;  5AW7 B;  2FFD C;  1LWU C;  1DH3 A;  1HGZ A;  3V2P A;  3M9H A;  1RE3 A;  1J2J B;  3A5T A;  5APV A;  1L0N K;  2C9N Y;  2CPB A;  1FZC A;  3HRN A;  1FZC C;  3HE5 A;  1YTZ T;  1QL1 A;  3B8E B;  2O1K A;  1H89 A;  1KQL A;  3V2Q A;  1SQV K;  3RK2 B;  3L36 A;  1HH0 A;  2P1J A;  1X79 B;  5AW0 B;  2HLO A;  1NAF A;  2WWW A;  5KJ7 C;  1KIL B;  1RF1 B;  4HH2 A;  5AVU B;  1IFD A;  4WY4 B;  1JY2 N;  1ZLL A;  2IFN A;  5APS A;  1DEB A;  3V2N A;  3RK2 C;  4XE5 B;  1T2K C;  1GTW A;  1KIL A;  1RF1 A;  5CMZ A;  1HTL C;  5APT A;  2NPS B;  3MGN A;  2Q9I A;  1URQ D;  3O8Z A;  2HFE D;  4WY4 A;  4WY4 C;  1N86 A;  1M7L A;  1G2C B;  1LT9 A;  3TK1 A;  1JCC A;  2YKP A;  5AVZ B;  2M8R A;  1T8Z A;  2N1T D;  2NPS A;  3B5N D;  3V2R A;  2OAR A;  3M0A A;  3VMZ A;  3NTN A;  2XKM A;  1FDM A;  1G2C A;  2XZR A;  3OAK A;  5CCG A;  5CCG C;  1J1E B;  4IFD K;  1CZQ A;  1AFO A;  2KB7 P;  2C0W A;  4I1L A;  2WZ7 A;  3GHG C;  5CCH C;  1QL2 A;  3CLQ A;  2GM4 A;  2P2U A;  2M3B A;  1YYC A;  3V4Q A;  2YMY A;  2WSF H;  1GZL A;  3RL0 D;  3VMY A;  1X8Y A;  1A02 F;  2GUV A;  3L35 A;  3BAS A;  4RES B;  1LTG C;  1YTZ I;  2E43 A;  2PP6 A;  4N6J A;  1T3J A;  5AVX B;  5AW8 B;  1X9V A;  2XU6 A;  2Z5I A;  4DOJ A;  2KYV A;  3KYQ A;  4LLH A;  3H32 B;  1M1J C;  1ZR2 A;  2P67 A;  1NTM K;  3G3Z A;  5AVV B;  1N7S B;  5AVS B;  1LTS C;  3HD7 D;  4C7R A;  5AVR B;  3P8M C;  1S9K E;  5AW2 B;  5AW6 B;  1MZ9 A;  4N78 E;  3H32 A;  2Q7C A;  1SVF A;  1IFI A;  1LWU B;  2KLV A;  1N7S A;  3LID A;  4HYT B;  1NOH A;  4JYB A;  3RK3 D;  2OYI C;  4EIJ A;  5KLV K;  4KHX A;  1KZU B;  4B86 A;  2R5D A;  2ZFC A;  4C7N A;  1JY2 O;  1LWU A;  1IC2 A;  1S9K D;  5APY A;  4LGD E;  1L0L K;  1SLQ A;  4W7Y A;  1GW4 A;  2W27 A;  2PAJ A;  3P32 A;  3MD0 A;  2FXM A;  2R3C A;  1FJK A;  1N73 B;  1FZE A;  2POH A;  1HBW A;  3P8C D;  4EOT A;  5CHX A;  2WPS A;  1FOS E;  5AW3 B;  1SFC D;  2A45 H;  2C0X A;  2WTY A;  4JF7 A;  1VPC A;  2N9B A;  2XNX A;  3OA7 A;  1LTT C;  4W7Z A;  4XA4 A;  5KJ7 A;  1N73 A;  1KFM A;  1XTG B;  1WRG A;  1N73 C;  3MUD A;  2WIT A;  1HVV A;  1FZB A;  2R32 A;  2VRS A;  1G1I A;  2MJZ A;  1OXZ A;  4AUW A;  2WSE H;  4WBA A;  5AVT B;  4GT1 A;  2O01 H;  4N3Y B;  2N1T B;  3B5N B;  3TYY A;  2QM8 A;  3U1A A;  1FBM A;  4C46 A;  5AW5 B;  1URQ C;  4GIF A;  2HOD B;  2LKM A;  1LTI C;  2WSC H;  1JTH B;  2I1K A;  2N1T A;  3B5N A;  2YO2 A;  2W6B A;  2N1T C;  2HPC B;  3B5N C;  3C9I A;  4AQR D;  2HOD A;  3OJA B;  5CJ0 A;  1IFN A;  4ZKP A;  2L5G B;  1LTJ C;  2W6A A;  1NH4 A;  1GL2 D;  1JY2 P;  2HPC A;  3GHG B;  3SWF A;  1KIL D;  2IPP A;  3IFM A;  1RF0 C;  3M06 A;  3MIW A;  2A45 G;  1NO4 A;  1HJB A;  3SWY A;  3GHG A;  5CCH A;  3VTP C;  1GU4 A;  2NPS D;  2KSJ A;  1WT6 A;  3VMX A;  3RL0 C;  3TSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...