1SFFA

Structure of gamma-aminobutyrate aminotransferase complex with aminooxyacetate
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
425
structure length
425
Chain Sequence
NSNKELMQRRSQAIPRGVGQIHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHPKVVAAVEAQLKKLSHTCFQVLAYEPYLELCEIMNQKVPGDFAKKTLLVTTGSEAVENAVKIARAATKRSGTIAFSGAYHGRTHYTLALTGKVNPYSAGMGLMPGHVYRALYPCPLHGISEDDAIASIHRIFKNDAAPEDIAAIVIEPVQGEGGFYASSPAFMQRLRALCDEHGIMLIADEVQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLGGTYAGNPIACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHPEIGDVRGLGAMIAIELFEDGDHNKPDAKLTAEIVARARDKGLILLSCGPYYNVLRILVPLTIEDAQIRQGLEIISQCFDEAKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-aminobutyrate aminotransferase
publication title Crystal structures of unbound and aminooxyacetate-bound Escherichia coli gamma-aminobutyrate aminotransferase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 149
structure length 425
sequence length 425
chains with identical sequence B, C, D
ec nomenclature ec 2.6.1.19: 4-aminobutyrate--2-oxoglutarate transaminase.
pdb deposition date 2004-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00202 Aminotran_3 Aminotransferase class-III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1sffA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1sffA01
1KKJA 3FDBA 2PB2A 2HUFA 2HZPA 1DFOA 4RKDA 2VMNA 2BIAA 1RVUA 3JZLA 1AKCA 2CH2A 2AY4A 1AIAA 1BW0A 2AY7A 4ZLVA 1OHWA 2AY9A 5G4JA 4OC9A 4JEWA 2V0YA 1EG5A 2BI1A 2FM1A 3MADA 3QN6A 3FFRA 3QI6A 1IVRA 4XEWA 3ZRQA 4GE9A 3WX9A 1BJOA 3GBXA 5DJ1A 1D7RA 2OATA 3E2YA 3RCHA 3MAFA 3E2ZB 3ZZKA 1M6SA 4BQ0A 2CTZA 2W7LA 1AJSB 1KL2A 4CBRA 1S09A 1AX4A 3GWPA 4IY7A 1MAPA 5BJ3A 3NRAA 3NYUA 3KGXA 1ASBA 1M32A 4ZSWA 3E6GA 1SPAA 4JF1A 1GC4A 3GETA 1ARSA 1W7MA 2CFBA 2AY5A 2BI9A 1XI9A 1G7WA 1WKGA 2VMTA 4ZASA 2PO3A 3HMUA 5M4BA 4R5ZA 3PIUA 3Q8NA 2VMPA 3EIBA 2CJGA 1IAYA 4I8AA 4MY5A 5F9SA 1KL1A 3FQ8A 1OXOA 2GB3A 4WXFA 1AHFA 4IXZA 2VGUA 5FT6A 4GDYA 4ADCA 1YJZA 2Z1ZA 2CSTA 3GSBA 1OHVA 3K40A 4A6RA 4ATQA 2BWNA 4XJMA 1O69A 2D7YA 3DXWA 1IUGA 1AKAA 4LC3A 2YRRA 3AOWA 4KYOA 1ASCA 4UHMA 3JWBA 1AJSA 4WYDA 4RITA 1V2DA 1X2AA 3OKSA 2C0RA 4OCAA 3VOMA 1T3IA 4PVFA 3TCMA 3VK2A 4WXBA 4ADBA 3ZRPA 1ARGA 2YKUA 4MQQA 5M46A 3EI5A 4ITGA 2CH1A 3EZSA 2JJGA 2WK7A 4IYOA 1RV4A 3B8XA 4LW4A 2GMSA 1WYUA 3EI9A 1ZOBA 1OATA 3NNKA 3E77A 3NX3A 4B98A 4ISYA 3E2FA 1GD9A 1ZC9A 2W7HA 2X5FA 4F5LA 1OHYA 1AICA 3LV2A 1G7XA 2ZYJA 3A9YA 4PFFA 1W7LA 5HDMA 2X3LA 1I41A 1M4NA 2AY6A 3PD6A 4JF0A 2WK9A 5LH9A 3MKJA 2ZUKA 1J04A 2DGMA 3BCBA 4GSAA 1SZKA 1TOGA 2BI5A 1IX7A 3ASAA 4ATPA 2FYFA 1G4XA 4KXKA 3QHXA 1WYVB 3CQ5A 2QB3A 3DR7A 3I4JA 3TATA 2EPJA 4NOGA 1DGEA 2OKJA 4WB0B 2YKVA 5EFSA 3WY7A 5EUNA 2VLFA 1UU2A 2BIEA 3HQTA 3IHJA 4IXOA 3F6TA 3FD0A 2ZY3A 3JU7A 3GR9A 4OBUA 1BQDA 4XQ2A 2G6WA 3VP6A 2O0RA 2ZY2A 3AEOA 1BT4A 3BC8A 2W7FA 3G7QA 4WYCA 5DX5A 3RBLA 4JE5A 1GDEA 3WZFA 1CZEA 2E7JA 4RLGA 2BKWA 3MAUA 1PG8A 3N75A 2C44A 2ZSLA 4TV7A 3WCNA 3JWAA 1BJ4A 3EI6A 1QISA 3DRDA 2D66A 2VGSA 4Y0DA 3PAAA 5EUDA 4AZJA 1ECXA 1O61A 2ZP7A 1AIBA 1S08A 2JISA 4MQRA 4BMKA 3FZ7A 3AV7A 2ZY5A 3EUCA 1C0NA 1ORDA 3BCXA 1P3WA 3EI8A 1CS1A 1TASA 3QPGA 4XAUA 1ASNA 1YAAA 1ZODA 2VMWA 3VK4A 3FRKA 4BA4A 4MGRA 4L0OA 2W7MA 3WKRA 1YIYA 2VI8A 4UHOA 3LVJA 1V2EA 2YCTA 1DJ9A 3DU4A 4RAEA 1D2FA 1GEXA 2W7DA 3H14A 3GZDC 4PFNA 2ZJGA 3HL2A 4A72A 3JW9A 4WYFA 1GEWA 2E54A 1ARIA 3LVMA 4K2MA 4M2JA 5EAAA 4N0BA 2EZ1A 2HORA 1IJIA 1QZ9A 2BHXA 3TQXA 2PB0A 1AHEA 1IX6A 1MDXA 1FG7A 1CZCA 1O4SA 3GZDA 3P1TA 3KGWA 2QA3A 2D63A 2CJDA 1D7VA 1DJUA 4ADEA 2EO5A 4CVQA 1QITA 2CJHA 2OKKA 4W1XA 1GCKA 2Q7WA 3K28A 4EB7A 1W7NA 3AOVA 1FG3A 3NDNA 1TPLA 5JAYA 2O7CA 3FQ7A 3ASBA 2VMQA 1CQ7A 1QJ3A 2BI2A 3WGCA 4RKCA 4P7YA 3R4TA 1V72A 1FC4A 3LY1A 5E5IA 3UWCA 2VGWA 3E9KA 4HVKA 1C9CA 2W7EA 1AHYA 4ZSYA 2Z9UA 1M7YA 3IF2A 3JTXA 5LHAA 3F0HA 5G2PA 4RM1A 3DXVA 3RI6A 1MAQA 3FVUA 3PDBB 5I92A 2JJFA 1B9IA 4MQPA 2DGLA 4O6ZA 3F9TA 3ELPA 4ZM4A 3DZZA 1MDZA 1CQ8A 1CQ6A 2W8JA 4ADDA 3E2ZA 2C7TA 4XJOA 2Z9XA 1AAWA 3FCRA 4Q76A 4CXQA 4H51A 3PA9A 5BJ4A 2W8UA 1ASAA 4MKJA 2GQNA 1E5FA 1GBNA 3R9AA 3BCAA 3N0LA 4K2BA 4M2MA 1C7GA 1AHGA 5AX8A 2VMOA 3I5TA 4F5IA 4M2KA 5D95A 3NU8A 3PDXA 2BI3A 3KE3A 4DBCA 4F4EA 1ASFA 2W7GA 2VGVA 3BN1A 2EZ2A 3FVXA 5HXXA 4UHNA 2BIGA 1U08A 1IBJA 3EZ1A 1KKPA 2W8TA 3W1IA 4CBSA 4F5FA 3WGBA 4U2HA 1C7NA 1CL1A 1AJRA 3DR4A 1N31A 2QMAA 1EJIA 3RQ1A 1JS6A 2JJHA 2YKYA 3WKSA 1GEYA 1LC8A 3BWNC 3NYSA 1QJ5A 2VLHA 1KMKA 3FSLA 4A0RA 2YOBA 2RFVA 3ZZJA 4A0FA 2V1PA 4LNMA 1J32A 2DKJA 5FT4A 4LNJA 2YKXA 4RJ0A 4ZWMA 1WKHA 2XH1A 3CQ4A 4Q75A 4W5KA 3VAXA 1AMRA 5M4DA 2HUIA 3AENB 4UQVA 1PMOA 3BWNA 3LVLB 2QLRA 1AAMA 3GJUA 5G4IA 2VI9A 4HF8A 3AELA 3W1JA 2VMUA 1LS3A 4Q31A 1DTYA 3LVKA 4JEZA 4WLHA 2BWPA 1SF2A 1TOJA 4XJPA 2BWOA 2VGTA 3TFUA 1DKAA 2D5YA 3OP7A 2X5DA 4W1VA 2HUUA 1D7UA 3N5MA 1IX8A 4FFCA 2D61A 5D5SA 3FZ6A 2CY8A 2VGZA 1B5PA 1GC3A 1LKCA 1WYVA 4MSOA 1ASLA 3ZRRA 1LW4A 2GMUA 5DB5A 3W1HA 2W7JA 3A2BA 2YCPA 3D6KA 4WB0A 1AY8A 3LWSA 4Q6RA 5EIGB 3CAIA 3NUBA 1DGDA 4AO4A 4LNLA 5TF5A 4LW2A 5DJ9A 1LW5A 1Y4IA 2E7IA 2DKBA 1MLYA 2VMXA 3HDOA 3RBFA 1C7OA 2AY3A 4EB5A 1AMAA 2OGAA 1AMSA 2NMPA 2R5CB 2XBNA 4XJLA 3AATA 4DQ6A 2FNIA 4IW7A 3A9ZA 1B9HA 1GC2A 4ZDOA 2R0TA 1LC5A 1RV3A 3EIAA 2WK8A 3P6KA 4A0GA 4GEBA 4N0WA 3A9XA 4Y0HA 4WD2A 5IWQA 4QGRA 1YIZA 2FQ6A 4A6UA 4A6TA 2VMZA 5EIGA 4WXGA 2EH6A 3B1EA 1BJOB 4F5GA 2YHKA 1SVVA 3A8UX 3ATHA 4TN4A 2W8VA 3RCHB 1TARA 3MAFB 4E1OA 1JG8A 1B5OA 2W7IA 4ZWVA 1N8PA 3AEMC 4W1WA 3G0TA 1VP4A 3BV0A 1TOIA 2YCNA 4MKKA 4AO9A 3FZ8A 4W91A 3QBOA 2JJEA 2WKAA 3FVSA 1E5EA 2JGTA 4AH3A 4TMRA 2Z67A 2VYCA 1LC7A 3FQAA 3NUIA 3T32A 5FT8A 5M49A 1VEFA 1EQBA 1UU0A 3ACZA 2DOUA 2VMYA 3AEMA 2ZY4A 1DJEA 1S06A 2F8JA 3QGUA 1BJNA 2AEUA 2FNUA 3COGA 3HBXA 3PGYA 4EFFA 3B46A 3DC1A 2R2NA 4OMAA 3B1DA 1TOEA 1OXPA 4A0HA 1I29A 4BA5A 3FFHA 4U1TA 5J8QA 2Z9WA 1ARHA 1ARTA 1I43A 3MC6C 2JG2A 1S07A 4ZDPA 1YOOA 1AY4A 1BJWA 1KMJA 2AATA 3GZCA 2DGKA 2VMRA 4RIZA 3I16A 1QGNA 1W3UA 4ITXA 1YNUA 1BQAA 1X0MA 3EI7A 4XK1A 4IYOB 4OYTA 1UU1A 3ECDA 1WYUB 3FTBA 4E3QA 2E7UA 2X8UA 3DYDA 4FL0A 4IX8A 1TATA 2HP1A 3MC6A 3USFA 1Z3ZA 2BYLA 4F5HA 1H1CA 3G8MA 4OT8A 1W23A 2TPLA 3NYTA 3UAKA 5FT5A 1O62A 7AATA 3M5UA 1JF9A 4ZDLA 3PD6B 2QBTA 3HLMA 3B1CA 4OBVA 2VMSA 4KAMA 1ELQA 2HOZA 2ZC0A 1QIRA 2ZSMA 5E3KA 3PDBA 1V2FA 4Y0IA 3RUYA 5K8BA 3PPLA 2AEVA 1UKJA 5EUEA 1ASGA 3MEBA 5F8VA 2VIAA 2O1BA 1XEYA 3HT4A 1YJSA 2HP2A 3BB8A 1AMQA 4GE7A 4PIWA 2HOXA 4R5FA 4UOYA 4JEVA 1ASEA 1CJ0A 5E4ZA 5G2QA 2W7KA 1AKBA 1BS0A 3CBFA 1PMMA 2CANA 2VMVA 4WYAA 1MGVA 2AY2A 1M0OA 2OQXA 3AEJC 3ELEA 4CXRA 4R2NA 1MDOA 1JS3A 1X29A 1G4VA 1D7SA 1ELUA 3BS8A 5HHYA 1C4KA 1PFFA 3BWOA 4JEXA 4WBTA 4ZM3A 1X28A 1LK9A 2DR1A 3HVYA 1RVYA 1H0CA 4DGTA 1M0QA 2GSAA 1WSTA 3L44A 4OTLA 2R5EA 4A00A 2AY8A 4ZAHA 1WYTB 3FKDA 4JEYA 4K2IA 5EAVA 1IAXA 3AEJA 1ASMA 1VJOA 3NTJA 4EMYA 2W8WA 2D65A 4WYEA 2D64A 3DODA 3UE8A 4WLJA 3WCOA 2HOYA 2CINA 1GC0A 3AEPA 4WYGA 1AY5A 3TFTA 4JE5D 3LG0A 1SFFA 2BYJA 2QB2A 4WP0A 4AZKA 3AENA 4F5JA 4J8LA 2EGYA 4IXSA 2Z1YA 3II0A 2Z9VA 1SZSA 3ISLA 4W8IA 5G09A 3VK3A 4E3RA 3CQ6A 3K7YA 3WLXA 2FN6A 4R8DA 5EQCA 2ORDA 2OGEA 3MBBA 3QM2A 1B8GA 1WYTA 2AY1A 2YRIA 1ASDA 3FDDA 4E77A 1S0AA 3NU7A 4BHDA 2VIBA 2Z61A 4AOAA 9AATA 4GE4A 1MLZA 2CB1A 5C6UA 1SZUA 1CL2A 4P3MA 1M0NA 1YJYA 4EU1A 8AATA 1I48A 2D7ZA 1BKGA 1AHXA 3KKIA 1B4XA 3PJ0A 2Z20A 4RJYA 3L8AA 1TOKA 5G0AA 4F5MA 1M0PA 1Z7DA 3H7FA 4F5KA 2R5CA 2C81A 4GRXA 4J5UA 4B9BA 1N2TA
chains in the Genus database with same CATH superfamily
1KKJA 3FDBA 2PB2A 2HUFA 2HZPA 1DFOA 4RKDA 2VMNA 2BIAA 1RVUA 3JZLA 1AKCA 2CH2A 2AY4A 1AIAA 1BW0A 2AY7A 4ZLVA 1OHWA 2AY9A 5G4JA 4OC9A 4JEWA 2V0YA 1EG5A 2BI1A 2FM1A 3MADA 3QN6A 3FFRA 3QI6A 1IVRA 4XEWA 3ZRQA 4GE9A 3WX9A 1BJOA 3GBXA 5DJ1A 1D7RA 2OATA 3E2YA 3RCHA 3MAFA 3E2ZB 3ZZKA 1M6SA 4BQ0A 2CTZA 2W7LA 1AJSB 1KL2A 4CBRA 1S09A 1AX4A 3GWPA 4IY7A 1MAPA 5BJ3A 3NRAA 3NYUA 3KGXA 1ASBA 1M32A 4ZSWA 3E6GA 1SPAA 4JF1A 1GC4A 3GETA 1ARSA 1W7MA 2CFBA 2AY5A 2BI9A 1XI9A 1G7WA 1WKGA 2VMTA 4ZASA 2PO3A 3HMUA 5M4BA 4R5ZA 3PIUA 3Q8NA 2VMPA 3EIBA 2CJGA 1IAYA 4I8AA 4MY5A 5F9SA 1KL1A 3FQ8A 1OXOA 2GB3A 4WXFA 1AHFA 4IXZA 2VGUA 5FT6A 4GDYA 4ADCA 1YJZA 2Z1ZA 2CSTA 3GSBA 1OHVA 3K40A 4A6RA 4ATQA 2BWNA 4XJMA 1O69A 2D7YA 3DXWA 1IUGA 1AKAA 4LC3A 2YRRA 3AOWA 4KYOA 1ASCA 4UHMA 3JWBA 1AJSA 4WYDA 4RITA 1V2DA 1X2AA 3OKSA 2C0RA 4OCAA 3VOMA 1T3IA 4PVFA 3TCMA 3VK2A 4WXBA 4ADBA 3ZRPA 1ARGA 2YKUA 4MQQA 5M46A 3EI5A 4ITGA 2CH1A 3EZSA 3N4RA 2JJGA 2WK7A 4IYOA 1RV4A 3B8XA 4LW4A 2GMSA 1WYUA 3EI9A 1ZOBA 1OATA 3NNKA 3E77A 3NX3A 4B98A 4ISYA 3E2FA 1GD9A 1ZC9A 2W7HA 2X5FA 4F5LA 1OHYA 1AICA 3LV2A 1G7XA 2ZYJA 3A9YA 4PFFA 1W7LA 5HDMA 2X3LA 1I41A 1M4NA 2AY6A 3PD6A 4JF0A 2WK9A 5LH9A 4H63Q 3MKJA 2ZUKA 1J04A 2DGMA 3BCBA 4GSAA 1SZKA 1TOGA 2BI5A 1IX7A 3ASAA 4ATPA 2FYFA 1G4XA 4KXKA 3QHXA 2QSRA 1WYVB 3CQ5A 2QB3A 3DR7A 3I4JA 3TATA 2EPJA 4NOGA 1DGEA 2OKJA 4WB0B 2YKVA 5EFSA 3WY7A 5EUNA 2VLFA 1UU2A 2BIEA 3HQTA 3IHJA 4IXOA 3F6TA 3FD0A 2ZY3A 3JU7A 3GR9A 4OBUA 1BQDA 4XQ2A 2G6WA 3VP6A 2O0RA 2ZY2A 3AEOA 1BT4A 3BC8A 2W7FA 3G7QA 4WYCA 5DX5A 3RBLA 4JE5A 1GDEA 3WZFA 1CZEA 2E7JA 4RLGA 2BKWA 3MAUA 1PG8A 3N75A 2C44A 2ZSLA 4TV7A 3WCNA 3JWAA 1BJ4A 3EI6A 1QISA 3DRDA 2D66A 2VGSA 4Y0DA 3PAAA 5EUDA 4AZJA 3N4SA 1ECXA 1O61A 2ZP7A 1AIBA 1S08A 2JISA 4MQRA 4BMKA 3FZ7A 3AV7A 2ZY5A 3EUCA 1C0NA 1ORDA 3BCXA 1P3WA 3EI8A 1CS1A 1TASA 3QPGA 4XAUA 1ASNA 1YAAA 1ZODA 2VMWA 3VK4A 3FRKA 4BA4A 4MGRA 4L0OA 2W7MA 3WKRA 1YIYA 2VI8A 4UHOA 3LVJA 1V2EA 2YCTA 1DJ9A 3DU4A 4RAEA 2KFPA 1D2FA 1GEXA 2W7DA 3H14A 3GZDC 4PFNA 2ZJGA 3HL2A 4A72A 3JW9A 4WYFA 1GEWA 2E54A 1ARIA 3LVMA 4K2MA 4M2JA 5EAAA 4N0BA 2EZ1A 2HORA 1IJIA 1QZ9A 2BHXA 3TQXA 2PB0A 1AHEA 1IX6A 1MDXA 1FG7A 1CZCA 1O4SA 3N7NA 3GZDA 3P1TA 3KGWA 2QA3A 2D63A 2CJDA 1D7VA 1DJUA 4ADEA 2EO5A 4CVQA 1QITA 2CJHA 2OKKA 4W1XA 1GCKA 2Q7WA 3K28A 4EB7A 1W7NA 3AOVA 1FG3A 3NDNA 1TPLA 5JAYA 2O7CA 3FQ7A 3ASBA 2VMQA 1CQ7A 1QJ3A 2BI2A 3WGCA 4RKCA 4P7YA 3R4TA 1V72A 1FC4A 3LY1A 5E5IA 3UWCA 2VGWA 3E9KA 4HVKA 1C9CA 2W7EA 1AHYA 4ZSYA 2Z9UA 1M7YA 3IF2A 3JTXA 5LHAA 3F0HA 5G2PA 4RM1A 3DXVA 3RI6A 1MAQA 3FVUA 3PDBB 5I92A 2JJFA 1B9IA 4MQPA 2DGLA 4O6ZA 3F9TA 3ELPA 4ZM4A 3DZZA 1MDZA 1CQ8A 1CQ6A 2W8JA 4ADDA 3E2ZA 2C7TA 4XJOA 2Z9XA 1AAWA 3FCRA 4Q76A 4CXQA 4H51A 3PA9A 5BJ4A 2W8UA 1ASAA 4MKJA 2GQNA 1E5FA 1GBNA 3R9AA 3BCAA 3N0LA 4K2BA 4M2MA 1C7GA 1AHGA 5AX8A 2VMOA 3I5TA 4F5IA 4M2KA 5D95A 3NU8A 3PDXA 2BI3A 3KE3A 4DBCA 4F4EA 1ASFA 2W7GA 2VGVA 3BN1A 2EZ2A 3FVXA 5HXXA 4UHNA 2BIGA 1U08A 1IBJA 3EZ1A 1KKPA 2W8TA 3W1IA 4CBSA 4F5FA 2WB6A 3WGBA 4U2HA 1C7NA 1CL1A 1AJRA 3DR4A 5KTBA 1N31A 2QMAA 1EJIA 3RQ1A 4K05A 1JS6A 2JJHA 2YKYA 3WKSA 1GEYA 1LC8A 3BWNC 3NYSA 1QJ5A 2VLHA 1KMKA 3FSLA 4A0RA 2YOBA 2RFVA 3ZZJA 4A0FA 2V1PA 4LNMA 1J32A 2DKJA 5FT4A 4LNJA 2YKXA 4RJ0A 4ZWMA 1WKHA 2XH1A 3CQ4A 4Q75A 4W5KA 3VAXA 1AMRA 5M4DA 2HUIA 3AENB 4UQVA 1PMOA 3BWNA 3LVLB 2QLRA 1AAMA 3GJUA 5G4IA 2VI9A 4HF8A 3AELA 3W1JA 2VMUA 1LS3A 4Q31A 1DTYA 3LVKA 4JEZA 4WLHA 2BWPA 1SF2A 1TOJA 4XJPA 2BWOA 2VGTA 3TFUA 1DKAA 2D5YA 3OP7A 2X5DA 4W1VA 2HUUA 1D7UA 3N5MA 1IX8A 4FFCA 2D61A 5D5SA 3FZ6A 2CY8A 2VGZA 1B5PA 1GC3A 1LKCA 1WYVA 4MSOA 1ASLA 3ZRRA 1LW4A 2GMUA 5DB5A 3W1HA 2W7JA 3A2BA 2YCPA 3D6KA 4WB0A 1AY8A 3LWSA 4Q6RA 5EIGB 3CAIA 3NUBA 1DGDA 4AO4A 4LNLA 5TF5A 4LW2A 5DJ9A 1LW5A 1Y4IA 2E7IA 2DKBA 1MLYA 2VMXA 3HDOA 3RBFA 1C7OA 2AY3A 4EB5A 1AMAA 2OGAA 1AMSA 2NMPA 2R5CB 2XBNA 4XJLA 3AATA 4DQ6A 2FNIA 4IW7A 3A9ZA 1B9HA 1KAFA 1GC2A 4ZDOA 2R0TA 1LC5A 2FKIA 1RV3A 3EIAA 2WK8A 3P6KA 4A0GA 4GEBA 4N0WA 3A9XA 4Y0HA 4WD2A 5IWQA 4QGRA 1YIZA 2FQ6A 4A6UA 4A6TA 2VMZA 5EIGA 4WXGA 2EH6A 3B1EA 1BJOB 4F5GA 2YHKA 1SVVA 3A8UX 3ATHA 4TN4A 2W8VA 3RCHB 1TARA 3MAFB 4E1OA 1JG8A 1B5OA 2W7IA 4ZWVA 1N8PA 3AEMC 4W1WA 3G0TA 1VP4A 3BV0A 1TOIA 2YCNA 4MKKA 4AO9A 3FZ8A 4W91A 3QBOA 2JJEA 2WKAA 3FVSA 1E5EA 2JGTA 4AH3A 4TMRA 2Z67A 2VYCA 1LC7A 3FQAA 3NUIA 3T32A 5FT8A 5M49A 1VEFA 1EQBA 1UU0A 3ACZA 2DOUA 2VMYA 3AEMA 2ZY4A 1DJEA 1S06A 2F8JA 3QGUA 1BJNA 2AEUA 2FNUA 3COGA 3HBXA 3PGYA 4EFFA 3H9XA 3B46A 3DC1A 2R2NA 4OMAA 3B1DA 1TOEA 1OXPA 4A0HA 1I29A 4BA5A 3FFHA 4U1TA 5J8QA 2Z9WA 1ARHA 1ARTA 1I43A 3MC6C 2JG2A 1S07A 4ZDPA 1YOOA 1AY4A 1BJWA 1KMJA 2AATA 3GZCA 2DGKA 2VMRA 2EYQA 4RIZA 3I16A 1QGNA 1W3UA 4ITXA 1YNUA 1BQAA 1X0MA 3EI7A 4XK1A 4IYOB 4OYTA 1UU1A 3ECDA 1WYUB 3FTBA 4E3QA 2E7UA 2X8UA 3DYDA 4FL0A 4IX8A 1TATA 2HP1A 3MC6A 3USFA 1Z3ZA 2BYLA 4F5HA 1H1CA 3G8MA 4OT8A 1W23A 2TPLA 3NYTA 3UAKA 5FT5A 1O62A 7AATA 3M5UA 1JF9A 4ZDLA 3PD6B 2QBTA 3HLMA 3B1CA 4OBVA 2VMSA 4KAMA 1ELQA 2HOZA 2ZC0A 1QIRA 2ZSMA 5E3KA 3PDBA 1V2FA 4Y0IA 3RUYA 5K8BA 3PPLA 2AEVA 1UKJA 5EUEA 1ASGA 3MEBA 5F8VA 2VIAA 2O1BA 1XEYA 3HT4A 1YJSA 2HP2A 3BB8A 1AMQA 4GE7A 4PIWA 2HOXA 4R5FA 4UOYA 4JEVA 1ASEA 1CJ0A 5E4ZA 5G2QA 2W7KA 1AKBA 1BS0A 3CBFA 1PMMA 2CANA 2VMVA 4WYAA 1MGVA 2AY2A 1M0OA 2OQXA 3AEJC 3ELEA 4CXRA 4R2NA 1MDOA 1JS3A 1X29A 1G4VA 1D7SA 1ELUA 3BS8A 5HHYA 1C4KA 1PFFA 3BWOA 4JEXA 4WBTA 4ZM3A 1X28A 1LK9A 2DR1A 3HVYA 1RVYA 1H0CA 4DGTA 1M0QA 2GSAA 1WSTA 3L44A 4OTLA 2R5EA 4A00A 2AY8A 4ZAHA 1WYTB 3FKDA 4JEYA 4K2IA 5EAVA 1IAXA 3AEJA 1ASMA 1VJOA 3NTJA 4EMYA 2W8WA 2D65A 4WYEA 2D64A 3DODA 3UE8A 4WLJA 3WCOA 2HOYA 2CINA 1GC0A 3AEPA 4WYGA 1AY5A 3TFTA 4JE5D 3LG0A 1SFFA 2BYJA 2QB2A 4WP0A 4AZKA 3AENA 4F5JA 4J8LA 2EGYA 4IXSA 2Z1YA 3II0A 2Z9VA 1SZSA 3ISLA 4W8IA 5G09A 3VK3A 4E3RA 3CQ6A 3K7YA 3WLXA 2FN6A 4R8DA 5EQCA 2ORDA 2OGEA 3MBBA 3QM2A 1B8GA 1WYTA 2A1VA 2AY1A 2YRIA 1ASDA 3FDDA 4E77A 1S0AA 3NU7A 4BHDA 3N4XA 2VIBA 2Z61A 4AOAA 9AATA 4GE4A 1MLZA 2CB1A 5C6UA 1SZUA 1CL2A 4P3MA 1M0NA 1YJYA 4EU1A 8AATA 1I48A 2D7ZA 1BKGA 1AHXA 3KKIA 1B4XA 3PJ0A 2Z20A 4RJYA 3L8AA 1TOKA 5G0AA 4F5MA 1M0PA 1Z7DA 3H7FA 4F5KA 2G7JA 2R5CA 2C81A 4GRXA 4J5UA 4B9BA 1N2TA
chains in the Genus database with same CATH topology
1KKJA 3FDBA 2PB2A 2HUFA 2HZPA 1DFOA 4RKDA 2VMNA 2BIAA 1RVUA 3JZLA 1AKCA 2CH2A 2AY4A 1AIAA 1BW0A 2AY7A 4ZLVA 1OHWA 2AY9A 5G4JA 4OC9A 4JEWA 2V0YA 1EG5A 2BI1A 2FM1A 3MADA 3QN6A 3FFRA 3QI6A 1IVRA 4XEWA 3ZRQA 4GE9A 3WX9A 1BJOA 3GBXA 5DJ1A 1D7RA 2OATA 3E2YA 3RCHA 3MAFA 3E2ZB 3ZZKA 1M6SA 4BQ0A 2CTZA 2W7LA 1AJSB 1KL2A 4CBRA 1S09A 1AX4A 3GWPA 4IY7A 1MAPA 5BJ3A 3NRAA 3NYUA 3KGXA 1ASBA 1M32A 4ZSWA 3E6GA 1SPAA 4JF1A 1GC4A 3GETA 1ARSA 1W7MA 2CFBA 2AY5A 2BI9A 1XI9A 1G7WA 1WKGA 2VMTA 4ZASA 2PO3A 3HMUA 5M4BA 4R5ZA 3PIUA 3Q8NA 2VMPA 3EIBA 2CJGA 1IAYA 4I8AA 4MY5A 5F9SA 1KL1A 3FQ8A 1OXOA 2GB3A 4WXFA 1AHFA 4IXZA 2VGUA 5FT6A 4GDYA 4ADCA 1YJZA 2Z1ZA 2CSTA 3GSBA 1OHVA 3K40A 4A6RA 4ATQA 2BWNA 4XJMA 1O69A 2D7YA 3DXWA 1IUGA 1AKAA 4LC3A 2YRRA 3AOWA 4KYOA 1ASCA 4UHMA 3JWBA 1AJSA 4WYDA 4RITA 1V2DA 1X2AA 3OKSA 2C0RA 4OCAA 3VOMA 1T3IA 4PVFA 3TCMA 3VK2A 4WXBA 4ADBA 3ZRPA 1ARGA 2YKUA 4MQQA 5M46A 3EI5A 4ITGA 2CH1A 3EZSA 3N4RA 2JJGA 2WK7A 4IYOA 1RV4A 3B8XA 4LW4A 2GMSA 1WYUA 3EI9A 1ZOBA 1OATA 3NNKA 3E77A 3NX3A 4B98A 4ISYA 3E2FA 1GD9A 1ZC9A 2W7HA 2X5FA 4F5LA 1OHYA 1AICA 3LV2A 1G7XA 2ZYJA 3A9YA 4PFFA 1W7LA 5HDMA 2X3LA 1I41A 1M4NA 2AY6A 3PD6A 4JF0A 2WK9A 5LH9A 4H63Q 3MKJA 2ZUKA 1J04A 2DGMA 3BCBA 4GSAA 1SZKA 1TOGA 2BI5A 1IX7A 3ASAA 4ATPA 2FYFA 1G4XA 4KXKA 3QHXA 2QSRA 1WYVB 3CQ5A 2QB3A 3DR7A 3I4JA 3TATA 2EPJA 4NOGA 1DGEA 2OKJA 4WB0B 2YKVA 5EFSA 3WY7A 5EUNA 2VLFA 1UU2A 2BIEA 3HQTA 3IHJA 4IXOA 3F6TA 3FD0A 2ZY3A 3JU7A 3GR9A 4OBUA 1BQDA 4XQ2A 2G6WA 3VP6A 2O0RA 2ZY2A 3AEOA 1BT4A 3BC8A 2W7FA 3G7QA 4WYCA 5DX5A 3RBLA 4JE5A 1GDEA 3WZFA 1CZEA 2E7JA 4RLGA 2BKWA 3MAUA 1PG8A 3N75A 2C44A 2ZSLA 4TV7A 3WCNA 3JWAA 1BJ4A 3EI6A 1QISA 3DRDA 2D66A 2VGSA 4Y0DA 3PAAA 5EUDA 4AZJA 3N4SA 1ECXA 1O61A 2ZP7A 1AIBA 1S08A 2JISA 4MQRA 4BMKA 3FZ7A 3AV7A 2ZY5A 3EUCA 1C0NA 1ORDA 3BCXA 1P3WA 3EI8A 1CS1A 1TASA 3QPGA 4XAUA 1ASNA 1YAAA 1ZODA 2VMWA 3VK4A 3FRKA 4BA4A 4MGRA 4L0OA 2W7MA 3WKRA 1YIYA 2VI8A 4UHOA 3LVJA 1V2EA 2YCTA 1DJ9A 3DU4A 4RAEA 2KFPA 1D2FA 1GEXA 2W7DA 3H14A 3GZDC 4PFNA 2ZJGA 3HL2A 4A72A 3JW9A 4WYFA 1GEWA 2E54A 1ARIA 3LVMA 4K2MA 4M2JA 5EAAA 4N0BA 2EZ1A 2HORA 1IJIA 1QZ9A 2BHXA 3TQXA 2PB0A 1AHEA 1IX6A 1MDXA 1FG7A 1CZCA 1O4SA 3N7NA 3GZDA 3P1TA 3KGWA 2QA3A 2D63A 2CJDA 1D7VA 1DJUA 4ADEA 2EO5A 4CVQA 1QITA 2CJHA 2OKKA 4W1XA 1GCKA 2Q7WA 3K28A 4EB7A 1W7NA 3AOVA 1FG3A 3NDNA 1TPLA 5JAYA 2O7CA 3FQ7A 3ASBA 2VMQA 1CQ7A 1QJ3A 2BI2A 3WGCA 4RKCA 4P7YA 3R4TA 1V72A 1FC4A 3LY1A 5E5IA 3UWCA 2VGWA 3E9KA 4HVKA 1C9CA 2W7EA 1AHYA 4ZSYA 2Z9UA 1M7YA 3IF2A 3JTXA 5LHAA 3F0HA 5G2PA 4RM1A 3DXVA 3RI6A 1MAQA 3FVUA 3PDBB 5I92A 2JJFA 1B9IA 4MQPA 2DGLA 4O6ZA 3F9TA 3ELPA 4ZM4A 3DZZA 1MDZA 1CQ8A 1CQ6A 2W8JA 4ADDA 3E2ZA 2C7TA 4XJOA 2Z9XA 1AAWA 3FCRA 4Q76A 4CXQA 4H51A 3PA9A 5BJ4A 2W8UA 1ASAA 4MKJA 2GQNA 1E5FA 1GBNA 3R9AA 3BCAA 3N0LA 4K2BA 4M2MA 1C7GA 1AHGA 5AX8A 2VMOA 3I5TA 4F5IA 4M2KA 5D95A 3NU8A 3PDXA 2BI3A 3KE3A 4DBCA 4F4EA 1ASFA 2W7GA 2VGVA 3BN1A 2EZ2A 3FVXA 5HXXA 4UHNA 2BIGA 1U08A 1IBJA 3EZ1A 1KKPA 2W8TA 3W1IA 4CBSA 4F5FA 2WB6A 3WGBA 4U2HA 1C7NA 1CL1A 1AJRA 3DR4A 5KTBA 1N31A 2QMAA 1EJIA 3RQ1A 4K05A 1JS6A 2JJHA 2YKYA 3WKSA 1GEYA 1LC8A 3BWNC 3NYSA 1QJ5A 2VLHA 1KMKA 3FSLA 4A0RA 2YOBA 2RFVA 3ZZJA 4A0FA 2V1PA 4LNMA 1J32A 2DKJA 5FT4A 4LNJA 2YKXA 4RJ0A 4ZWMA 1WKHA 2XH1A 3CQ4A 4Q75A 4W5KA 3VAXA 1AMRA 5M4DA 2HUIA 3AENB 4UQVA 1PMOA 3BWNA 3LVLB 2QLRA 1AAMA 3GJUA 5G4IA 2VI9A 4HF8A 3AELA 3W1JA 2VMUA 1LS3A 4Q31A 1DTYA 3LVKA 4JEZA 4WLHA 2BWPA 1SF2A 1TOJA 4XJPA 2BWOA 2VGTA 3TFUA 1DKAA 2D5YA 3OP7A 2X5DA 4W1VA 2HUUA 1D7UA 3N5MA 1IX8A 4FFCA 2D61A 5D5SA 3FZ6A 2CY8A 2VGZA 1B5PA 1GC3A 1LKCA 1WYVA 4MSOA 1ASLA 3ZRRA 1LW4A 2GMUA 5DB5A 3W1HA 2W7JA 3A2BA 2YCPA 3D6KA 4WB0A 1AY8A 3LWSA 4Q6RA 5EIGB 3CAIA 3NUBA 1DGDA 4AO4A 4LNLA 5TF5A 4LW2A 5DJ9A 1LW5A 1Y4IA 2E7IA 2DKBA 1MLYA 2VMXA 3HDOA 3RBFA 1C7OA 2AY3A 4EB5A 1AMAA 2OGAA 1AMSA 2NMPA 2R5CB 2XBNA 4XJLA 3AATA 4DQ6A 2FNIA 4IW7A 3A9ZA 1B9HA 1GC2A 4ZDOA 2R0TA 1LC5A 2FKIA 1RV3A 3EIAA 2WK8A 3P6KA 4A0GA 4GEBA 4N0WA 3A9XA 4Y0HA 4WD2A 5IWQA 4QGRA 1YIZA 2FQ6A 4A6UA 4A6TA 2VMZA 5EIGA 4WXGA 2EH6A 3B1EA 1BJOB 4F5GA 2YHKA 1SVVA 3A8UX 3ATHA 4TN4A 2W8VA 3RCHB 1TARA 3MAFB 4E1OA 1JG8A 1B5OA 2W7IA 4ZWVA 1N8PA 3AEMC 4W1WA 3G0TA 1VP4A 3BV0A 1TOIA 2YCNA 4MKKA 4AO9A 3FZ8A 4W91A 3QBOA 2JJEA 2WKAA 3FVSA 1E5EA 2JGTA 4AH3A 4TMRA 2Z67A 2VYCA 1LC7A 3FQAA 3NUIA 3T32A 5FT8A 5M49A 1VEFA 1EQBA 1UU0A 3ACZA 2DOUA 2VMYA 3AEMA 2ZY4A 1DJEA 1S06A 2F8JA 3QGUA 1BJNA 2AEUA 2FNUA 3COGA 3HBXA 3PGYA 4EFFA 3H9XA 3B46A 3DC1A 2R2NA 4OMAA 3B1DA 1TOEA 1OXPA 4A0HA 1I29A 4BA5A 3FFHA 4U1TA 5J8QA 2Z9WA 1ARHA 1ARTA 1I43A 3MC6C 2JG2A 1S07A 4ZDPA 1YOOA 1AY4A 1BJWA 1KMJA 2AATA 3GZCA 2DGKA 2VMRA 2EYQA 4RIZA 3I16A 1QGNA 1W3UA 4ITXA 1YNUA 1BQAA 1X0MA 3EI7A 4XK1A 4IYOB 4OYTA 1UU1A 3ECDA 1WYUB 3FTBA 4E3QA 2E7UA 2X8UA 3DYDA 4FL0A 4IX8A 1TATA 2HP1A 3MC6A 3USFA 1Z3ZA 2BYLA 4F5HA 1H1CA 3G8MA 4OT8A 1W23A 2TPLA 3NYTA 3UAKA 5FT5A 1O62A 7AATA 3M5UA 1JF9A 4ZDLA 3PD6B 2QBTA 3HLMA 3B1CA 4OBVA 2VMSA 4KAMA 1ELQA 2HOZA 2ZC0A 1QIRA 2ZSMA 5E3KA 3PDBA 1V2FA 4Y0IA 3RUYA 5K8BA 3PPLA 2AEVA 1UKJA 5EUEA 1ASGA 3MEBA 5F8VA 2VIAA 2O1BA 1XEYA 3HT4A 1YJSA 2HP2A 3BB8A 1AMQA 4GE7A 4PIWA 2HOXA 4R5FA 4UOYA 4JEVA 1ASEA 1CJ0A 5E4ZA 5G2QA 2W7KA 1AKBA 1BS0A 3CBFA 1PMMA 2CANA 2VMVA 4WYAA 1MGVA 2AY2A 1M0OA 2OQXA 3AEJC 3ELEA 4CXRA 4R2NA 1MDOA 1JS3A 1X29A 1G4VA 1D7SA 1ELUA 3BS8A 5HHYA 1C4KA 1PFFA 3BWOA 4JEXA 4WBTA 4ZM3A 1X28A 1LK9A 2DR1A 3HVYA 1RVYA 1H0CA 4DGTA 1M0QA 2GSAA 1WSTA 3L44A 4OTLA 2R5EA 4A00A 2AY8A 4ZAHA 1WYTB 3FKDA 4JEYA 4K2IA 5EAVA 1IAXA 3AEJA 1ASMA 1VJOA 3NTJA 4EMYA 2W8WA 2D65A 4WYEA 2D64A 3DODA 3UE8A 4WLJA 3WCOA 2HOYA 2CINA 1GC0A 3AEPA 4WYGA 1AY5A 3TFTA 4JE5D 3LG0A 1SFFA 2BYJA 2QB2A 4WP0A 4AZKA 3AENA 4F5JA 4J8LA 2EGYA 4IXSA 2Z1YA 3II0A 2Z9VA 1SZSA 3ISLA 4W8IA 5G09A 3VK3A 4E3RA 3CQ6A 3K7YA 3WLXA 2FN6A 4R8DA 5EQCA 2ORDA 2OGEA 3MBBA 3QM2A 1B8GA 1WYTA 2A1VA 2AY1A 2YRIA 1ASDA 3FDDA 4E77A 1S0AA 3NU7A 4BHDA 3N4XA 2VIBA 2Z61A 4AOAA 9AATA 4GE4A 1MLZA 2CB1A 5C6UA 1SZUA 1CL2A 4P3MA 1M0NA 1YJYA 4EU1A 8AATA 1I48A 2D7ZA 1BKGA 1AHXA 3KKIA 1B4XA 3PJ0A 2Z20A 4RJYA 3L8AA 1TOKA 5G0AA 4F5MA 1M0PA 1Z7DA 3H7FA 4F5KA 2G7JA 2R5CA 2C81A 4GRXA 4J5UA 4B9BA 1N2TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KKJ A;  3FDB A;  2PB2 A;  2HUF A;  2HZP A;  1DFO A;  4RKD A;  2VMN A;  2BIA A;  1RVU A;  3JZL A;  1AKC A;  2CH2 A;  2AY4 A;  1AIA A;  1BW0 A;  2AY7 A;  4ZLV A;  1OHW A;  2AY9 A;  5G4J A;  4OC9 A;  4JEW A;  2V0Y A;  1EG5 A;  2BI1 A;  2FM1 A;  3MAD A;  3QN6 A;  3FFR A;  3QI6 A;  1IVR A;  4XEW A;  3ZRQ A;  4GE9 A;  3WX9 A;  1BJO A;  3GBX A;  5DJ1 A;  1D7R A;  2OAT A;  3E2Y A;  3RCH A;  3MAF A;  3E2Z B;  3ZZK A;  1M6S A;  4BQ0 A;  2CTZ A;  2W7L A;  1AJS B;  1KL2 A;  4CBR A;  1S09 A;  1AX4 A;  3GWP A;  4IY7 A;  1MAP A;  5BJ3 A;  3NRA A;  3NYU A;  3KGX A;  1ASB A;  1M32 A;  4ZSW A;  3E6G A;  1SPA A;  4JF1 A;  1GC4 A;  3GET A;  1ARS A;  1W7M A;  2CFB A;  2AY5 A;  2BI9 A;  1XI9 A;  1G7W A;  1WKG A;  2VMT A;  4ZAS A;  2PO3 A;  3HMU A;  5M4B A;  4R5Z A;  3PIU A;  3Q8N A;  2VMP A;  3EIB A;  2CJG A;  1IAY A;  4I8A A;  4MY5 A;  5F9S A;  1KL1 A;  3FQ8 A;  1OXO A;  2GB3 A;  4WXF A;  1AHF A;  4IXZ A;  2VGU A;  5FT6 A;  4GDY A;  4ADC A;  1YJZ A;  2Z1Z A;  2CST A;  3GSB A;  1OHV A;  3K40 A;  4A6R A;  4ATQ A;  2BWN A;  4XJM A;  1O69 A;  2D7Y A;  3DXW A;  1IUG A;  1AKA A;  4LC3 A;  2YRR A;  3AOW A;  4KYO A;  1ASC A;  4UHM A;  3JWB A;  1AJS A;  4WYD A;  4RIT A;  1V2D A;  1X2A A;  3OKS A;  2C0R A;  4OCA A;  3VOM A;  1T3I A;  4PVF A;  3TCM A;  3VK2 A;  4WXB A;  4ADB A;  3ZRP A;  1ARG A;  2YKU A;  4MQQ A;  5M46 A;  3EI5 A;  4ITG A;  2CH1 A;  3EZS A;  2JJG A;  2WK7 A;  4IYO A;  1RV4 A;  3B8X A;  4LW4 A;  2GMS A;  1WYU A;  3EI9 A;  1ZOB A;  1OAT A;  3NNK A;  3E77 A;  3NX3 A;  4B98 A;  4ISY A;  3E2F A;  1GD9 A;  1ZC9 A;  2W7H A;  2X5F A;  4F5L A;  1OHY A;  1AIC A;  3LV2 A;  1G7X A;  2ZYJ A;  3A9Y A;  4PFF A;  1W7L A;  5HDM A;  2X3L A;  1I41 A;  1M4N A;  2AY6 A;  3PD6 A;  4JF0 A;  2WK9 A;  5LH9 A;  3MKJ A;  2ZUK A;  1J04 A;  2DGM A;  3BCB A;  4GSA A;  1SZK A;  1TOG A;  2BI5 A;  1IX7 A;  3ASA A;  4ATP A;  2FYF A;  1G4X A;  4KXK A;  3QHX A;  1WYV B;  3CQ5 A;  2QB3 A;  3DR7 A;  3I4J A;  3TAT A;  2EPJ A;  4NOG A;  1DGE A;  2OKJ A;  4WB0 B;  2YKV A;  5EFS A;  3WY7 A;  5EUN A;  2VLF A;  1UU2 A;  2BIE A;  3HQT A;  3IHJ A;  4IXO A;  3F6T A;  3FD0 A;  2ZY3 A;  3JU7 A;  3GR9 A;  4OBU A;  1BQD A;  4XQ2 A;  2G6W A;  3VP6 A;  2O0R A;  2ZY2 A;  3AEO A;  1BT4 A;  3BC8 A;  2W7F A;  3G7Q A;  4WYC A;  5DX5 A;  3RBL A;  4JE5 A;  1GDE A;  3WZF A;  1CZE A;  2E7J A;  4RLG A;  2BKW A;  3MAU A;  1PG8 A;  3N75 A;  2C44 A;  2ZSL A;  4TV7 A;  3WCN A;  3JWA A;  1BJ4 A;  3EI6 A;  1QIS A;  3DRD A;  2D66 A;  2VGS A;  4Y0D A;  3PAA A;  5EUD A;  4AZJ A;  1ECX A;  1O61 A;  2ZP7 A;  1AIB A;  1S08 A;  2JIS A;  4MQR A;  4BMK A;  3FZ7 A;  3AV7 A;  2ZY5 A;  3EUC A;  1C0N A;  1ORD A;  3BCX A;  1P3W A;  3EI8 A;  1CS1 A;  1TAS A;  3QPG A;  4XAU A;  1ASN A;  1YAA A;  1ZOD A;  2VMW A;  3VK4 A;  3FRK A;  4BA4 A;  4MGR A;  4L0O A;  2W7M A;  3WKR A;  1YIY A;  2VI8 A;  4UHO A;  3LVJ A;  1V2E A;  2YCT A;  1DJ9 A;  3DU4 A;  4RAE A;  1D2F A;  1GEX A;  2W7D A;  3H14 A;  3GZD C;  4PFN A;  2ZJG A;  3HL2 A;  4A72 A;  3JW9 A;  4WYF A;  1GEW A;  2E54 A;  1ARI A;  3LVM A;  4K2M A;  4M2J A;  5EAA A;  4N0B A;  2EZ1 A;  2HOR A;  1IJI A;  1QZ9 A;  2BHX A;  3TQX A;  2PB0 A;  1AHE A;  1IX6 A;  1MDX A;  1FG7 A;  1CZC A;  1O4S A;  3GZD A;  3P1T A;  3KGW A;  2QA3 A;  2D63 A;  2CJD A;  1D7V A;  1DJU A;  4ADE A;  2EO5 A;  4CVQ A;  1QIT A;  2CJH A;  2OKK A;  4W1X A;  1GCK A;  2Q7W A;  3K28 A;  4EB7 A;  1W7N A;  3AOV A;  1FG3 A;  3NDN A;  1TPL A;  5JAY A;  2O7C A;  3FQ7 A;  3ASB A;  2VMQ A;  1CQ7 A;  1QJ3 A;  2BI2 A;  3WGC A;  4RKC A;  4P7Y A;  3R4T A;  1V72 A;  1FC4 A;  3LY1 A;  5E5I A;  3UWC A;  2VGW A;  3E9K A;  4HVK A;  1C9C A;  2W7E A;  1AHY A;  4ZSY A;  2Z9U A;  1M7Y A;  3IF2 A;  3JTX A;  5LHA A;  3F0H A;  5G2P A;  4RM1 A;  3DXV A;  3RI6 A;  1MAQ A;  3FVU A;  3PDB B;  5I92 A;  2JJF A;  1B9I A;  4MQP A;  2DGL A;  4O6Z A;  3F9T A;  3ELP A;  4ZM4 A;  3DZZ A;  1MDZ A;  1CQ8 A;  1CQ6 A;  2W8J A;  4ADD A;  3E2Z A;  2C7T A;  4XJO A;  2Z9X A;  1AAW A;  3FCR A;  4Q76 A;  4CXQ A;  4H51 A;  3PA9 A;  5BJ4 A;  2W8U A;  1ASA A;  4MKJ A;  2GQN A;  1E5F A;  1GBN A;  3R9A A;  3BCA A;  3N0L A;  4K2B A;  4M2M A;  1C7G A;  1AHG A;  5AX8 A;  2VMO A;  3I5T A;  4F5I A;  4M2K A;  5D95 A;  3NU8 A;  3PDX A;  2BI3 A;  3KE3 A;  4DBC A;  4F4E A;  1ASF A;  2W7G A;  2VGV A;  3BN1 A;  2EZ2 A;  3FVX A;  5HXX A;  4UHN A;  2BIG A;  1U08 A;  1IBJ A;  3EZ1 A;  1KKP A;  2W8T A;  3W1I A;  4CBS A;  4F5F A;  3WGB A;  4U2H A;  1C7N A;  1CL1 A;  1AJR A;  3DR4 A;  1N31 A;  2QMA A;  1EJI A;  3RQ1 A;  1JS6 A;  2JJH A;  2YKY A;  3WKS A;  1GEY A;  1LC8 A;  3BWN C;  3NYS A;  1QJ5 A;  2VLH A;  1KMK A;  3FSL A;  4A0R A;  2YOB A;  2RFV A;  3ZZJ A;  4A0F A;  2V1P A;  4LNM A;  1J32 A;  2DKJ A;  5FT4 A;  4LNJ A;  2YKX A;  4RJ0 A;  4ZWM A;  1WKH A;  2XH1 A;  3CQ4 A;  4Q75 A;  4W5K A;  3VAX A;  1AMR A;  5M4D A;  2HUI A;  3AEN B;  4UQV A;  1PMO A;  3BWN A;  3LVL B;  2QLR A;  1AAM A;  3GJU A;  5G4I A;  2VI9 A;  4HF8 A;  3AEL A;  3W1J A;  2VMU A;  1LS3 A;  4Q31 A;  1DTY A;  3LVK A;  4JEZ A;  4WLH A;  2BWP A;  1SF2 A;  1TOJ A;  4XJP A;  2BWO A;  2VGT A;  3TFU A;  1DKA A;  2D5Y A;  3OP7 A;  2X5D A;  4W1V A;  2HUU A;  1D7U A;  3N5M A;  1IX8 A;  4FFC A;  2D61 A;  5D5S A;  3FZ6 A;  2CY8 A;  2VGZ A;  1B5P A;  1GC3 A;  1LKC A;  1WYV A;  4MSO A;  1ASL A;  3ZRR A;  1LW4 A;  2GMU A;  5DB5 A;  3W1H A;  2W7J A;  3A2B A;  2YCP A;  3D6K A;  4WB0 A;  1AY8 A;  3LWS A;  4Q6R A;  5EIG B;  3CAI A;  3NUB A;  1DGD A;  4AO4 A;  4LNL A;  5TF5 A;  4LW2 A;  5DJ9 A;  1LW5 A;  1Y4I A;  2E7I A;  2DKB A;  1MLY A;  2VMX A;  3HDO A;  3RBF A;  1C7O A;  2AY3 A;  4EB5 A;  1AMA A;  2OGA A;  1AMS A;  2NMP A;  2R5C B;  2XBN A;  4XJL A;  3AAT A;  4DQ6 A;  2FNI A;  4IW7 A;  3A9Z A;  1B9H A;  1GC2 A;  4ZDO A;  2R0T A;  1LC5 A;  1RV3 A;  3EIA A;  2WK8 A;  3P6K A;  4A0G A;  4GEB A;  4N0W A;  3A9X A;  4Y0H A;  4WD2 A;  5IWQ A;  4QGR A;  1YIZ A;  2FQ6 A;  4A6U A;  4A6T A;  2VMZ A;  5EIG A;  4WXG A;  2EH6 A;  3B1E A;  1BJO B;  4F5G A;  2YHK A;  1SVV A;  3A8U X;  3ATH A;  4TN4 A;  2W8V A;  3RCH B;  1TAR A;  3MAF B;  4E1O A;  1JG8 A;  1B5O A;  2W7I A;  4ZWV A;  1N8P A;  3AEM C;  4W1W A;  3G0T A;  1VP4 A;  3BV0 A;  1TOI A;  2YCN A;  4MKK A;  4AO9 A;  3FZ8 A;  4W91 A;  3QBO A;  2JJE A;  2WKA A;  3FVS A;  1E5E A;  2JGT A;  4AH3 A;  4TMR A;  2Z67 A;  2VYC A;  1LC7 A;  3FQA A;  3NUI A;  3T32 A;  5FT8 A;  5M49 A;  1VEF A;  1EQB A;  1UU0 A;  3ACZ A;  2DOU A;  2VMY A;  3AEM A;  2ZY4 A;  1DJE A;  1S06 A;  2F8J A;  3QGU A;  1BJN A;  2AEU A;  2FNU A;  3COG A;  3HBX A;  3PGY A;  4EFF A;  3B46 A;  3DC1 A;  2R2N A;  4OMA A;  3B1D A;  1TOE A;  1OXP A;  4A0H A;  1I29 A;  4BA5 A;  3FFH A;  4U1T A;  5J8Q A;  2Z9W A;  1ARH A;  1ART A;  1I43 A;  3MC6 C;  2JG2 A;  1S07 A;  4ZDP A;  1YOO A;  1AY4 A;  1BJW A;  1KMJ A;  2AAT A;  3GZC A;  2DGK A;  2VMR A;  4RIZ A;  3I16 A;  1QGN A;  1W3U A;  4ITX A;  1YNU A;  1BQA A;  1X0M A;  3EI7 A;  4XK1 A;  4IYO B;  4OYT A;  1UU1 A;  3ECD A;  1WYU B;  3FTB A;  4E3Q A;  2E7U A;  2X8U A;  3DYD A;  4FL0 A;  4IX8 A;  1TAT A;  2HP1 A;  3MC6 A;  3USF A;  1Z3Z A;  2BYL A;  4F5H A;  1H1C A;  3G8M A;  4OT8 A;  1W23 A;  2TPL A;  3NYT A;  3UAK A;  5FT5 A;  1O62 A;  7AAT A;  3M5U A;  1JF9 A;  4ZDL A;  3PD6 B;  2QBT A;  3HLM A;  3B1C A;  4OBV A;  2VMS A;  4KAM A;  1ELQ A;  2HOZ A;  2ZC0 A;  1QIR A;  2ZSM A;  5E3K A;  3PDB A;  1V2F A;  4Y0I A;  3RUY A;  5K8B A;  3PPL A;  2AEV A;  1UKJ A;  5EUE A;  1ASG A;  3MEB A;  5F8V A;  2VIA A;  2O1B A;  1XEY A;  3HT4 A;  1YJS A;  2HP2 A;  3BB8 A;  1AMQ A;  4GE7 A;  4PIW A;  2HOX A;  4R5F A;  4UOY A;  4JEV A;  1ASE A;  1CJ0 A;  5E4Z A;  5G2Q A;  2W7K A;  1AKB A;  1BS0 A;  3CBF A;  1PMM A;  2CAN A;  2VMV A;  4WYA A;  1MGV A;  2AY2 A;  1M0O A;  2OQX A;  3AEJ C;  3ELE A;  4CXR A;  4R2N A;  1MDO A;  1JS3 A;  1X29 A;  1G4V A;  1D7S A;  1ELU A;  3BS8 A;  5HHY A;  1C4K A;  1PFF A;  3BWO A;  4JEX A;  4WBT A;  4ZM3 A;  1X28 A;  1LK9 A;  2DR1 A;  3HVY A;  1RVY A;  1H0C A;  4DGT A;  1M0Q A;  2GSA A;  1WST A;  3L44 A;  4OTL A;  2R5E A;  4A00 A;  2AY8 A;  4ZAH A;  1WYT B;  3FKD A;  4JEY A;  4K2I A;  5EAV A;  1IAX A;  3AEJ A;  1ASM A;  1VJO A;  3NTJ A;  4EMY A;  2W8W A;  2D65 A;  4WYE A;  2D64 A;  3DOD A;  3UE8 A;  4WLJ A;  3WCO A;  2HOY A;  2CIN A;  1GC0 A;  3AEP A;  4WYG A;  1AY5 A;  3TFT A;  4JE5 D;  3LG0 A;  1SFF A;  2BYJ A;  2QB2 A;  4WP0 A;  4AZK A;  3AEN A;  4F5J A;  4J8L A;  2EGY A;  4IXS A;  2Z1Y A;  3II0 A;  2Z9V A;  1SZS A;  3ISL A;  4W8I A;  5G09 A;  3VK3 A;  4E3R A;  3CQ6 A;  3K7Y A;  3WLX A;  2FN6 A;  4R8D A;  5EQC A;  2ORD A;  2OGE A;  3MBB A;  3QM2 A;  1B8G A;  1WYT A;  2AY1 A;  2YRI A;  1ASD A;  3FDD A;  4E77 A;  1S0A A;  3NU7 A;  4BHD A;  2VIB A;  2Z61 A;  4AOA A;  9AAT A;  4GE4 A;  1MLZ A;  2CB1 A;  5C6U A;  1SZU A;  1CL2 A;  4P3M A;  1M0N A;  1YJY A;  4EU1 A;  8AAT A;  1I48 A;  2D7Z A;  1BKG A;  1AHX A;  3KKI A;  1B4X A;  3PJ0 A;  2Z20 A;  4RJY A;  3L8A A;  1TOK A;  5G0A A;  4F5M A;  1M0P A;  1Z7D A;  3H7F A;  4F5K A;  2R5C A;  2C81 A;  4GRX A;  4J5U A;  4B9B A;  1N2T A; 
#chains in the Genus database with same CATH topology
 1KKJ A;  3FDB A;  2PB2 A;  2HUF A;  2HZP A;  1DFO A;  4RKD A;  2VMN A;  2BIA A;  1RVU A;  3JZL A;  1AKC A;  2CH2 A;  2AY4 A;  1AIA A;  1BW0 A;  2AY7 A;  4ZLV A;  1OHW A;  2AY9 A;  5G4J A;  4OC9 A;  4JEW A;  2V0Y A;  1EG5 A;  2BI1 A;  2FM1 A;  3MAD A;  3QN6 A;  3FFR A;  3QI6 A;  1IVR A;  4XEW A;  3ZRQ A;  4GE9 A;  3WX9 A;  1BJO A;  3GBX A;  5DJ1 A;  1D7R A;  2OAT A;  3E2Y A;  3RCH A;  3MAF A;  3E2Z B;  3ZZK A;  1M6S A;  4BQ0 A;  2CTZ A;  2W7L A;  1AJS B;  1KL2 A;  4CBR A;  1S09 A;  1AX4 A;  3GWP A;  4IY7 A;  1MAP A;  5BJ3 A;  3NRA A;  3NYU A;  3KGX A;  1ASB A;  1M32 A;  4ZSW A;  3E6G A;  1SPA A;  4JF1 A;  1GC4 A;  3GET A;  1ARS A;  1W7M A;  2CFB A;  2AY5 A;  2BI9 A;  1XI9 A;  1G7W A;  1WKG A;  2VMT A;  4ZAS A;  2PO3 A;  3HMU A;  5M4B A;  4R5Z A;  3PIU A;  3Q8N A;  2VMP A;  3EIB A;  2CJG A;  1IAY A;  4I8A A;  4MY5 A;  5F9S A;  1KL1 A;  3FQ8 A;  1OXO A;  2GB3 A;  4WXF A;  1AHF A;  4IXZ A;  2VGU A;  5FT6 A;  4GDY A;  4ADC A;  1YJZ A;  2Z1Z A;  2CST A;  3GSB A;  1OHV A;  3K40 A;  4A6R A;  4ATQ A;  2BWN A;  4XJM A;  1O69 A;  2D7Y A;  3DXW A;  1IUG A;  1AKA A;  4LC3 A;  2YRR A;  3AOW A;  4KYO A;  1ASC A;  4UHM A;  3JWB A;  1AJS A;  4WYD A;  4RIT A;  1V2D A;  1X2A A;  3OKS A;  2C0R A;  4OCA A;  3VOM A;  1T3I A;  4PVF A;  3TCM A;  3VK2 A;  4WXB A;  4ADB A;  3ZRP A;  1ARG A;  2YKU A;  4MQQ A;  5M46 A;  3EI5 A;  4ITG A;  2CH1 A;  3EZS A;  3N4R A;  2JJG A;  2WK7 A;  4IYO A;  1RV4 A;  3B8X A;  4LW4 A;  2GMS A;  1WYU A;  3EI9 A;  1ZOB A;  1OAT A;  3NNK A;  3E77 A;  3NX3 A;  4B98 A;  4ISY A;  3E2F A;  1GD9 A;  1ZC9 A;  2W7H A;  2X5F A;  4F5L A;  1OHY A;  1AIC A;  3LV2 A;  1G7X A;  2ZYJ A;  3A9Y A;  4PFF A;  1W7L A;  5HDM A;  2X3L A;  1I41 A;  1M4N A;  2AY6 A;  3PD6 A;  4JF0 A;  2WK9 A;  5LH9 A;  4H63 Q;  3MKJ A;  2ZUK A;  1J04 A;  2DGM A;  3BCB A;  4GSA A;  1SZK A;  1TOG A;  2BI5 A;  1IX7 A;  3ASA A;  4ATP A;  2FYF A;  1G4X A;  4KXK A;  3QHX A;  2QSR A;  1WYV B;  3CQ5 A;  2QB3 A;  3DR7 A;  3I4J A;  3TAT A;  2EPJ A;  4NOG A;  1DGE A;  2OKJ A;  4WB0 B;  2YKV A;  5EFS A;  3WY7 A;  5EUN A;  2VLF A;  1UU2 A;  2BIE A;  3HQT A;  3IHJ A;  4IXO A;  3F6T A;  3FD0 A;  2ZY3 A;  3JU7 A;  3GR9 A;  4OBU A;  1BQD A;  4XQ2 A;  2G6W A;  3VP6 A;  2O0R A;  2ZY2 A;  3AEO A;  1BT4 A;  3BC8 A;  2W7F A;  3G7Q A;  4WYC A;  5DX5 A;  3RBL A;  4JE5 A;  1GDE A;  3WZF A;  1CZE A;  2E7J A;  4RLG A;  2BKW A;  3MAU A;  1PG8 A;  3N75 A;  2C44 A;  2ZSL A;  4TV7 A;  3WCN A;  3JWA A;  1BJ4 A;  3EI6 A;  1QIS A;  3DRD A;  2D66 A;  2VGS A;  4Y0D A;  3PAA A;  5EUD A;  4AZJ A;  3N4S A;  1ECX A;  1O61 A;  2ZP7 A;  1AIB A;  1S08 A;  2JIS A;  4MQR A;  4BMK A;  3FZ7 A;  3AV7 A;  2ZY5 A;  3EUC A;  1C0N A;  1ORD A;  3BCX A;  1P3W A;  3EI8 A;  1CS1 A;  1TAS A;  3QPG A;  4XAU A;  1ASN A;  1YAA A;  1ZOD A;  2VMW A;  3VK4 A;  3FRK A;  4BA4 A;  4MGR A;  4L0O A;  2W7M A;  3WKR A;  1YIY A;  2VI8 A;  4UHO A;  3LVJ A;  1V2E A;  2YCT A;  1DJ9 A;  3DU4 A;  4RAE A;  2KFP A;  1D2F A;  1GEX A;  2W7D A;  3H14 A;  3GZD C;  4PFN A;  2ZJG A;  3HL2 A;  4A72 A;  3JW9 A;  4WYF A;  1GEW A;  2E54 A;  1ARI A;  3LVM A;  4K2M A;  4M2J A;  5EAA A;  4N0B A;  2EZ1 A;  2HOR A;  1IJI A;  1QZ9 A;  2BHX A;  3TQX A;  2PB0 A;  1AHE A;  1IX6 A;  1MDX A;  1FG7 A;  1CZC A;  1O4S A;  3N7N A;  3GZD A;  3P1T A;  3KGW A;  2QA3 A;  2D63 A;  2CJD A;  1D7V A;  1DJU A;  4ADE A;  2EO5 A;  4CVQ A;  1QIT A;  2CJH A;  2OKK A;  4W1X A;  1GCK A;  2Q7W A;  3K28 A;  4EB7 A;  1W7N A;  3AOV A;  1FG3 A;  3NDN A;  1TPL A;  5JAY A;  2O7C A;  3FQ7 A;  3ASB A;  2VMQ A;  1CQ7 A;  1QJ3 A;  2BI2 A;  3WGC A;  4RKC A;  4P7Y A;  3R4T A;  1V72 A;  1FC4 A;  3LY1 A;  5E5I A;  3UWC A;  2VGW A;  3E9K A;  4HVK A;  1C9C A;  2W7E A;  1AHY A;  4ZSY A;  2Z9U A;  1M7Y A;  3IF2 A;  3JTX A;  5LHA A;  3F0H A;  5G2P A;  4RM1 A;  3DXV A;  3RI6 A;  1MAQ A;  3FVU A;  3PDB B;  5I92 A;  2JJF A;  1B9I A;  4MQP A;  2DGL A;  4O6Z A;  3F9T A;  3ELP A;  4ZM4 A;  3DZZ A;  1MDZ A;  1CQ8 A;  1CQ6 A;  2W8J A;  4ADD A;  3E2Z A;  2C7T A;  4XJO A;  2Z9X A;  1AAW A;  3FCR A;  4Q76 A;  4CXQ A;  4H51 A;  3PA9 A;  5BJ4 A;  2W8U A;  1ASA A;  4MKJ A;  2GQN A;  1E5F A;  1GBN A;  3R9A A;  3BCA A;  3N0L A;  4K2B A;  4M2M A;  1C7G A;  1AHG A;  5AX8 A;  2VMO A;  3I5T A;  4F5I A;  4M2K A;  5D95 A;  3NU8 A;  3PDX A;  2BI3 A;  3KE3 A;  4DBC A;  4F4E A;  1ASF A;  2W7G A;  2VGV A;  3BN1 A;  2EZ2 A;  3FVX A;  5HXX A;  4UHN A;  2BIG A;  1U08 A;  1IBJ A;  3EZ1 A;  1KKP A;  2W8T A;  3W1I A;  4CBS A;  4F5F A;  2WB6 A;  3WGB A;  4U2H A;  1C7N A;  1CL1 A;  1AJR A;  3DR4 A;  5KTB A;  1N31 A;  2QMA A;  1EJI A;  3RQ1 A;  4K05 A;  1JS6 A;  2JJH A;  2YKY A;  3WKS A;  1GEY A;  1LC8 A;  3BWN C;  3NYS A;  1QJ5 A;  2VLH A;  1KMK A;  3FSL A;  4A0R A;  2YOB A;  2RFV A;  3ZZJ A;  4A0F A;  2V1P A;  4LNM A;  1J32 A;  2DKJ A;  5FT4 A;  4LNJ A;  2YKX A;  4RJ0 A;  4ZWM A;  1WKH A;  2XH1 A;  3CQ4 A;  4Q75 A;  4W5K A;  3VAX A;  1AMR A;  5M4D A;  2HUI A;  3AEN B;  4UQV A;  1PMO A;  3BWN A;  3LVL B;  2QLR A;  1AAM A;  3GJU A;  5G4I A;  2VI9 A;  4HF8 A;  3AEL A;  3W1J A;  2VMU A;  1LS3 A;  4Q31 A;  1DTY A;  3LVK A;  4JEZ A;  4WLH A;  2BWP A;  1SF2 A;  1TOJ A;  4XJP A;  2BWO A;  2VGT A;  3TFU A;  1DKA A;  2D5Y A;  3OP7 A;  2X5D A;  4W1V A;  2HUU A;  1D7U A;  3N5M A;  1IX8 A;  4FFC A;  2D61 A;  5D5S A;  3FZ6 A;  2CY8 A;  2VGZ A;  1B5P A;  1GC3 A;  1LKC A;  1WYV A;  4MSO A;  1ASL A;  3ZRR A;  1LW4 A;  2GMU A;  5DB5 A;  3W1H A;  2W7J A;  3A2B A;  2YCP A;  3D6K A;  4WB0 A;  1AY8 A;  3LWS A;  4Q6R A;  5EIG B;  3CAI A;  3NUB A;  1DGD A;  4AO4 A;  4LNL A;  5TF5 A;  4LW2 A;  5DJ9 A;  1LW5 A;  1Y4I A;  2E7I A;  2DKB A;  1MLY A;  2VMX A;  3HDO A;  3RBF A;  1C7O A;  2AY3 A;  4EB5 A;  1AMA A;  2OGA A;  1AMS A;  2NMP A;  2R5C B;  2XBN A;  4XJL A;  3AAT A;  4DQ6 A;  2FNI A;  4IW7 A;  3A9Z A;  1B9H A;  1KAF A;  1GC2 A;  4ZDO A;  2R0T A;  1LC5 A;  2FKI A;  1RV3 A;  3EIA A;  2WK8 A;  3P6K A;  4A0G A;  4GEB A;  4N0W A;  3A9X A;  4Y0H A;  4WD2 A;  5IWQ A;  4QGR A;  1YIZ A;  2FQ6 A;  4A6U A;  4A6T A;  2VMZ A;  5EIG A;  4WXG A;  2EH6 A;  3B1E A;  1BJO B;  4F5G A;  2YHK A;  1SVV A;  3A8U X;  3ATH A;  4TN4 A;  2W8V A;  3RCH B;  1TAR A;  3MAF B;  4E1O A;  1JG8 A;  1B5O A;  2W7I A;  4ZWV A;  1N8P A;  3AEM C;  4W1W A;  3G0T A;  1VP4 A;  3BV0 A;  1TOI A;  2YCN A;  4MKK A;  4AO9 A;  3FZ8 A;  4W91 A;  3QBO A;  2JJE A;  2WKA A;  3FVS A;  1E5E A;  2JGT A;  4AH3 A;  4TMR A;  2Z67 A;  2VYC A;  1LC7 A;  3FQA A;  3NUI A;  3T32 A;  5FT8 A;  5M49 A;  1VEF A;  1EQB A;  1UU0 A;  3ACZ A;  2DOU A;  2VMY A;  3AEM A;  2ZY4 A;  1DJE A;  1S06 A;  2F8J A;  3QGU A;  1BJN A;  2AEU A;  2FNU A;  3COG A;  3HBX A;  3PGY A;  4EFF A;  3H9X A;  3B46 A;  3DC1 A;  2R2N A;  4OMA A;  3B1D A;  1TOE A;  1OXP A;  4A0H A;  1I29 A;  4BA5 A;  3FFH A;  4U1T A;  5J8Q A;  2Z9W A;  1ARH A;  1ART A;  1I43 A;  3MC6 C;  2JG2 A;  1S07 A;  4ZDP A;  1YOO A;  1AY4 A;  1BJW A;  1KMJ A;  2AAT A;  3GZC A;  2DGK A;  2VMR A;  2EYQ A;  4RIZ A;  3I16 A;  1QGN A;  1W3U A;  4ITX A;  1YNU A;  1BQA A;  1X0M A;  3EI7 A;  4XK1 A;  4IYO B;  4OYT A;  1UU1 A;  3ECD A;  1WYU B;  3FTB A;  4E3Q A;  2E7U A;  2X8U A;  3DYD A;  4FL0 A;  4IX8 A;  1TAT A;  2HP1 A;  3MC6 A;  3USF A;  1Z3Z A;  2BYL A;  4F5H A;  1H1C A;  3G8M A;  4OT8 A;  1W23 A;  2TPL A;  3NYT A;  3UAK A;  5FT5 A;  1O62 A;  7AAT A;  3M5U A;  1JF9 A;  4ZDL A;  3PD6 B;  2QBT A;  3HLM A;  3B1C A;  4OBV A;  2VMS A;  4KAM A;  1ELQ A;  2HOZ A;  2ZC0 A;  1QIR A;  2ZSM A;  5E3K A;  3PDB A;  1V2F A;  4Y0I A;  3RUY A;  5K8B A;  3PPL A;  2AEV A;  1UKJ A;  5EUE A;  1ASG A;  3MEB A;  5F8V A;  2VIA A;  2O1B A;  1XEY A;  3HT4 A;  1YJS A;  2HP2 A;  3BB8 A;  1AMQ A;  4GE7 A;  4PIW A;  2HOX A;  4R5F A;  4UOY A;  4JEV A;  1ASE A;  1CJ0 A;  5E4Z A;  5G2Q A;  2W7K A;  1AKB A;  1BS0 A;  3CBF A;  1PMM A;  2CAN A;  2VMV A;  4WYA A;  1MGV A;  2AY2 A;  1M0O A;  2OQX A;  3AEJ C;  3ELE A;  4CXR A;  4R2N A;  1MDO A;  1JS3 A;  1X29 A;  1G4V A;  1D7S A;  1ELU A;  3BS8 A;  5HHY A;  1C4K A;  1PFF A;  3BWO A;  4JEX A;  4WBT A;  4ZM3 A;  1X28 A;  1LK9 A;  2DR1 A;  3HVY A;  1RVY A;  1H0C A;  4DGT A;  1M0Q A;  2GSA A;  1WST A;  3L44 A;  4OTL A;  2R5E A;  4A00 A;  2AY8 A;  4ZAH A;  1WYT B;  3FKD A;  4JEY A;  4K2I A;  5EAV A;  1IAX A;  3AEJ A;  1ASM A;  1VJO A;  3NTJ A;  4EMY A;  2W8W A;  2D65 A;  4WYE A;  2D64 A;  3DOD A;  3UE8 A;  4WLJ A;  3WCO A;  2HOY A;  2CIN A;  1GC0 A;  3AEP A;  4WYG A;  1AY5 A;  3TFT A;  4JE5 D;  3LG0 A;  1SFF A;  2BYJ A;  2QB2 A;  4WP0 A;  4AZK A;  3AEN A;  4F5J A;  4J8L A;  2EGY A;  4IXS A;  2Z1Y A;  3II0 A;  2Z9V A;  1SZS A;  3ISL A;  4W8I A;  5G09 A;  3VK3 A;  4E3R A;  3CQ6 A;  3K7Y A;  3WLX A;  2FN6 A;  4R8D A;  5EQC A;  2ORD A;  2OGE A;  3MBB A;  3QM2 A;  1B8G A;  1WYT A;  2A1V A;  2AY1 A;  2YRI A;  1ASD A;  3FDD A;  4E77 A;  1S0A A;  3NU7 A;  4BHD A;  3N4X A;  2VIB A;  2Z61 A;  4AOA A;  9AAT A;  4GE4 A;  1MLZ A;  2CB1 A;  5C6U A;  1SZU A;  1CL2 A;  4P3M A;  1M0N A;  1YJY A;  4EU1 A;  8AAT A;  1I48 A;  2D7Z A;  1BKG A;  1AHX A;  3KKI A;  1B4X A;  3PJ0 A;  2Z20 A;  4RJY A;  3L8A A;  1TOK A;  5G0A A;  4F5M A;  1M0P A;  1Z7D A;  3H7F A;  4F5K A;  2G7J A;  2R5C A;  2C81 A;  4GRX A;  4J5U A;  4B9B A;  1N2T A; 
#chains in the Genus database with same CATH homology
 1KKJ A;  3FDB A;  2PB2 A;  2HUF A;  2HZP A;  1DFO A;  4RKD A;  2VMN A;  2BIA A;  1RVU A;  3JZL A;  1AKC A;  2CH2 A;  2AY4 A;  1AIA A;  1BW0 A;  2AY7 A;  4ZLV A;  1OHW A;  2AY9 A;  5G4J A;  4OC9 A;  4JEW A;  2V0Y A;  1EG5 A;  2BI1 A;  2FM1 A;  3MAD A;  3QN6 A;  3FFR A;  3QI6 A;  1IVR A;  4XEW A;  3ZRQ A;  4GE9 A;  3WX9 A;  1BJO A;  3GBX A;  5DJ1 A;  1D7R A;  2OAT A;  3E2Y A;  3RCH A;  3MAF A;  3E2Z B;  3ZZK A;  1M6S A;  4BQ0 A;  2CTZ A;  2W7L A;  1AJS B;  1KL2 A;  4CBR A;  1S09 A;  1AX4 A;  3GWP A;  4IY7 A;  1MAP A;  5BJ3 A;  3NRA A;  3NYU A;  3KGX A;  1ASB A;  1M32 A;  4ZSW A;  3E6G A;  1SPA A;  4JF1 A;  1GC4 A;  3GET A;  1ARS A;  1W7M A;  2CFB A;  2AY5 A;  2BI9 A;  1XI9 A;  1G7W A;  1WKG A;  2VMT A;  4ZAS A;  2PO3 A;  3HMU A;  5M4B A;  4R5Z A;  3PIU A;  3Q8N A;  2VMP A;  3EIB A;  2CJG A;  1IAY A;  4I8A A;  4MY5 A;  5F9S A;  1KL1 A;  3FQ8 A;  1OXO A;  2GB3 A;  4WXF A;  1AHF A;  4IXZ A;  2VGU A;  5FT6 A;  4GDY A;  4ADC A;  1YJZ A;  2Z1Z A;  2CST A;  3GSB A;  1OHV A;  3K40 A;  4A6R A;  4ATQ A;  2BWN A;  4XJM A;  1O69 A;  2D7Y A;  3DXW A;  1IUG A;  1AKA A;  4LC3 A;  2YRR A;  3AOW A;  4KYO A;  1ASC A;  4UHM A;  3JWB A;  1AJS A;  4WYD A;  4RIT A;  1V2D A;  1X2A A;  3OKS A;  2C0R A;  4OCA A;  3VOM A;  1T3I A;  4PVF A;  3TCM A;  3VK2 A;  4WXB A;  4ADB A;  3ZRP A;  1ARG A;  2YKU A;  4MQQ A;  5M46 A;  3EI5 A;  4ITG A;  2CH1 A;  3EZS A;  3N4R A;  2JJG A;  2WK7 A;  4IYO A;  1RV4 A;  3B8X A;  4LW4 A;  2GMS A;  1WYU A;  3EI9 A;  1ZOB A;  1OAT A;  3NNK A;  3E77 A;  3NX3 A;  4B98 A;  4ISY A;  3E2F A;  1GD9 A;  1ZC9 A;  2W7H A;  2X5F A;  4F5L A;  1OHY A;  1AIC A;  3LV2 A;  1G7X A;  2ZYJ A;  3A9Y A;  4PFF A;  1W7L A;  5HDM A;  2X3L A;  1I41 A;  1M4N A;  2AY6 A;  3PD6 A;  4JF0 A;  2WK9 A;  5LH9 A;  4H63 Q;  3MKJ A;  2ZUK A;  1J04 A;  2DGM A;  3BCB A;  4GSA A;  1SZK A;  1TOG A;  2BI5 A;  1IX7 A;  3ASA A;  4ATP A;  2FYF A;  1G4X A;  4KXK A;  3QHX A;  2QSR A;  1WYV B;  3CQ5 A;  2QB3 A;  3DR7 A;  3I4J A;  3TAT A;  2EPJ A;  4NOG A;  1DGE A;  2OKJ A;  4WB0 B;  2YKV A;  5EFS A;  3WY7 A;  5EUN A;  2VLF A;  1UU2 A;  2BIE A;  3HQT A;  3IHJ A;  4IXO A;  3F6T A;  3FD0 A;  2ZY3 A;  3JU7 A;  3GR9 A;  4OBU A;  1BQD A;  4XQ2 A;  2G6W A;  3VP6 A;  2O0R A;  2ZY2 A;  3AEO A;  1BT4 A;  3BC8 A;  2W7F A;  3G7Q A;  4WYC A;  5DX5 A;  3RBL A;  4JE5 A;  1GDE A;  3WZF A;  1CZE A;  2E7J A;  4RLG A;  2BKW A;  3MAU A;  1PG8 A;  3N75 A;  2C44 A;  2ZSL A;  4TV7 A;  3WCN A;  3JWA A;  1BJ4 A;  3EI6 A;  1QIS A;  3DRD A;  2D66 A;  2VGS A;  4Y0D A;  3PAA A;  5EUD A;  4AZJ A;  3N4S A;  1ECX A;  1O61 A;  2ZP7 A;  1AIB A;  1S08 A;  2JIS A;  4MQR A;  4BMK A;  3FZ7 A;  3AV7 A;  2ZY5 A;  3EUC A;  1C0N A;  1ORD A;  3BCX A;  1P3W A;  3EI8 A;  1CS1 A;  1TAS A;  3QPG A;  4XAU A;  1ASN A;  1YAA A;  1ZOD A;  2VMW A;  3VK4 A;  3FRK A;  4BA4 A;  4MGR A;  4L0O A;  2W7M A;  3WKR A;  1YIY A;  2VI8 A;  4UHO A;  3LVJ A;  1V2E A;  2YCT A;  1DJ9 A;  3DU4 A;  4RAE A;  2KFP A;  1D2F A;  1GEX A;  2W7D A;  3H14 A;  3GZD C;  4PFN A;  2ZJG A;  3HL2 A;  4A72 A;  3JW9 A;  4WYF A;  1GEW A;  2E54 A;  1ARI A;  3LVM A;  4K2M A;  4M2J A;  5EAA A;  4N0B A;  2EZ1 A;  2HOR A;  1IJI A;  1QZ9 A;  2BHX A;  3TQX A;  2PB0 A;  1AHE A;  1IX6 A;  1MDX A;  1FG7 A;  1CZC A;  1O4S A;  3N7N A;  3GZD A;  3P1T A;  3KGW A;  2QA3 A;  2D63 A;  2CJD A;  1D7V A;  1DJU A;  4ADE A;  2EO5 A;  4CVQ A;  1QIT A;  2CJH A;  2OKK A;  4W1X A;  1GCK A;  2Q7W A;  3K28 A;  4EB7 A;  1W7N A;  3AOV A;  1FG3 A;  3NDN A;  1TPL A;  5JAY A;  2O7C A;  3FQ7 A;  3ASB A;  2VMQ A;  1CQ7 A;  1QJ3 A;  2BI2 A;  3WGC A;  4RKC A;  4P7Y A;  3R4T A;  1V72 A;  1FC4 A;  3LY1 A;  5E5I A;  3UWC A;  2VGW A;  3E9K A;  4HVK A;  1C9C A;  2W7E A;  1AHY A;  4ZSY A;  2Z9U A;  1M7Y A;  3IF2 A;  3JTX A;  5LHA A;  3F0H A;  5G2P A;  4RM1 A;  3DXV A;  3RI6 A;  1MAQ A;  3FVU A;  3PDB B;  5I92 A;  2JJF A;  1B9I A;  4MQP A;  2DGL A;  4O6Z A;  3F9T A;  3ELP A;  4ZM4 A;  3DZZ A;  1MDZ A;  1CQ8 A;  1CQ6 A;  2W8J A;  4ADD A;  3E2Z A;  2C7T A;  4XJO A;  2Z9X A;  1AAW A;  3FCR A;  4Q76 A;  4CXQ A;  4H51 A;  3PA9 A;  5BJ4 A;  2W8U A;  1ASA A;  4MKJ A;  2GQN A;  1E5F A;  1GBN A;  3R9A A;  3BCA A;  3N0L A;  4K2B A;  4M2M A;  1C7G A;  1AHG A;  5AX8 A;  2VMO A;  3I5T A;  4F5I A;  4M2K A;  5D95 A;  3NU8 A;  3PDX A;  2BI3 A;  3KE3 A;  4DBC A;  4F4E A;  1ASF A;  2W7G A;  2VGV A;  3BN1 A;  2EZ2 A;  3FVX A;  5HXX A;  4UHN A;  2BIG A;  1U08 A;  1IBJ A;  3EZ1 A;  1KKP A;  2W8T A;  3W1I A;  4CBS A;  4F5F A;  2WB6 A;  3WGB A;  4U2H A;  1C7N A;  1CL1 A;  1AJR A;  3DR4 A;  5KTB A;  1N31 A;  2QMA A;  1EJI A;  3RQ1 A;  4K05 A;  1JS6 A;  2JJH A;  2YKY A;  3WKS A;  1GEY A;  1LC8 A;  3BWN C;  3NYS A;  1QJ5 A;  2VLH A;  1KMK A;  3FSL A;  4A0R A;  2YOB A;  2RFV A;  3ZZJ A;  4A0F A;  2V1P A;  4LNM A;  1J32 A;  2DKJ A;  5FT4 A;  4LNJ A;  2YKX A;  4RJ0 A;  4ZWM A;  1WKH A;  2XH1 A;  3CQ4 A;  4Q75 A;  4W5K A;  3VAX A;  1AMR A;  5M4D A;  2HUI A;  3AEN B;  4UQV A;  1PMO A;  3BWN A;  3LVL B;  2QLR A;  1AAM A;  3GJU A;  5G4I A;  2VI9 A;  4HF8 A;  3AEL A;  3W1J A;  2VMU A;  1LS3 A;  4Q31 A;  1DTY A;  3LVK A;  4JEZ A;  4WLH A;  2BWP A;  1SF2 A;  1TOJ A;  4XJP A;  2BWO A;  2VGT A;  3TFU A;  1DKA A;  2D5Y A;  3OP7 A;  2X5D A;  4W1V A;  2HUU A;  1D7U A;  3N5M A;  1IX8 A;  4FFC A;  2D61 A;  5D5S A;  3FZ6 A;  2CY8 A;  2VGZ A;  1B5P A;  1GC3 A;  1LKC A;  1WYV A;  4MSO A;  1ASL A;  3ZRR A;  1LW4 A;  2GMU A;  5DB5 A;  3W1H A;  2W7J A;  3A2B A;  2YCP A;  3D6K A;  4WB0 A;  1AY8 A;  3LWS A;  4Q6R A;  5EIG B;  3CAI A;  3NUB A;  1DGD A;  4AO4 A;  4LNL A;  5TF5 A;  4LW2 A;  5DJ9 A;  1LW5 A;  1Y4I A;  2E7I A;  2DKB A;  1MLY A;  2VMX A;  3HDO A;  3RBF A;  1C7O A;  2AY3 A;  4EB5 A;  1AMA A;  2OGA A;  1AMS A;  2NMP A;  2R5C B;  2XBN A;  4XJL A;  3AAT A;  4DQ6 A;  2FNI A;  4IW7 A;  3A9Z A;  1B9H A;  1GC2 A;  4ZDO A;  2R0T A;  1LC5 A;  2FKI A;  1RV3 A;  3EIA A;  2WK8 A;  3P6K A;  4A0G A;  4GEB A;  4N0W A;  3A9X A;  4Y0H A;  4WD2 A;  5IWQ A;  4QGR A;  1YIZ A;  2FQ6 A;  4A6U A;  4A6T A;  2VMZ A;  5EIG A;  4WXG A;  2EH6 A;  3B1E A;  1BJO B;  4F5G A;  2YHK A;  1SVV A;  3A8U X;  3ATH A;  4TN4 A;  2W8V A;  3RCH B;  1TAR A;  3MAF B;  4E1O A;  1JG8 A;  1B5O A;  2W7I A;  4ZWV A;  1N8P A;  3AEM C;  4W1W A;  3G0T A;  1VP4 A;  3BV0 A;  1TOI A;  2YCN A;  4MKK A;  4AO9 A;  3FZ8 A;  4W91 A;  3QBO A;  2JJE A;  2WKA A;  3FVS A;  1E5E A;  2JGT A;  4AH3 A;  4TMR A;  2Z67 A;  2VYC A;  1LC7 A;  3FQA A;  3NUI A;  3T32 A;  5FT8 A;  5M49 A;  1VEF A;  1EQB A;  1UU0 A;  3ACZ A;  2DOU A;  2VMY A;  3AEM A;  2ZY4 A;  1DJE A;  1S06 A;  2F8J A;  3QGU A;  1BJN A;  2AEU A;  2FNU A;  3COG A;  3HBX A;  3PGY A;  4EFF A;  3H9X A;  3B46 A;  3DC1 A;  2R2N A;  4OMA A;  3B1D A;  1TOE A;  1OXP A;  4A0H A;  1I29 A;  4BA5 A;  3FFH A;  4U1T A;  5J8Q A;  2Z9W A;  1ARH A;  1ART A;  1I43 A;  3MC6 C;  2JG2 A;  1S07 A;  4ZDP A;  1YOO A;  1AY4 A;  1BJW A;  1KMJ A;  2AAT A;  3GZC A;  2DGK A;  2VMR A;  2EYQ A;  4RIZ A;  3I16 A;  1QGN A;  1W3U A;  4ITX A;  1YNU A;  1BQA A;  1X0M A;  3EI7 A;  4XK1 A;  4IYO B;  4OYT A;  1UU1 A;  3ECD A;  1WYU B;  3FTB A;  4E3Q A;  2E7U A;  2X8U A;  3DYD A;  4FL0 A;  4IX8 A;  1TAT A;  2HP1 A;  3MC6 A;  3USF A;  1Z3Z A;  2BYL A;  4F5H A;  1H1C A;  3G8M A;  4OT8 A;  1W23 A;  2TPL A;  3NYT A;  3UAK A;  5FT5 A;  1O62 A;  7AAT A;  3M5U A;  1JF9 A;  4ZDL A;  3PD6 B;  2QBT A;  3HLM A;  3B1C A;  4OBV A;  2VMS A;  4KAM A;  1ELQ A;  2HOZ A;  2ZC0 A;  1QIR A;  2ZSM A;  5E3K A;  3PDB A;  1V2F A;  4Y0I A;  3RUY A;  5K8B A;  3PPL A;  2AEV A;  1UKJ A;  5EUE A;  1ASG A;  3MEB A;  5F8V A;  2VIA A;  2O1B A;  1XEY A;  3HT4 A;  1YJS A;  2HP2 A;  3BB8 A;  1AMQ A;  4GE7 A;  4PIW A;  2HOX A;  4R5F A;  4UOY A;  4JEV A;  1ASE A;  1CJ0 A;  5E4Z A;  5G2Q A;  2W7K A;  1AKB A;  1BS0 A;  3CBF A;  1PMM A;  2CAN A;  2VMV A;  4WYA A;  1MGV A;  2AY2 A;  1M0O A;  2OQX A;  3AEJ C;  3ELE A;  4CXR A;  4R2N A;  1MDO A;  1JS3 A;  1X29 A;  1G4V A;  1D7S A;  1ELU A;  3BS8 A;  5HHY A;  1C4K A;  1PFF A;  3BWO A;  4JEX A;  4WBT A;  4ZM3 A;  1X28 A;  1LK9 A;  2DR1 A;  3HVY A;  1RVY A;  1H0C A;  4DGT A;  1M0Q A;  2GSA A;  1WST A;  3L44 A;  4OTL A;  2R5E A;  4A00 A;  2AY8 A;  4ZAH A;  1WYT B;  3FKD A;  4JEY A;  4K2I A;  5EAV A;  1IAX A;  3AEJ A;  1ASM A;  1VJO A;  3NTJ A;  4EMY A;  2W8W A;  2D65 A;  4WYE A;  2D64 A;  3DOD A;  3UE8 A;  4WLJ A;  3WCO A;  2HOY A;  2CIN A;  1GC0 A;  3AEP A;  4WYG A;  1AY5 A;  3TFT A;  4JE5 D;  3LG0 A;  1SFF A;  2BYJ A;  2QB2 A;  4WP0 A;  4AZK A;  3AEN A;  4F5J A;  4J8L A;  2EGY A;  4IXS A;  2Z1Y A;  3II0 A;  2Z9V A;  1SZS A;  3ISL A;  4W8I A;  5G09 A;  3VK3 A;  4E3R A;  3CQ6 A;  3K7Y A;  3WLX A;  2FN6 A;  4R8D A;  5EQC A;  2ORD A;  2OGE A;  3MBB A;  3QM2 A;  1B8G A;  1WYT A;  2A1V A;  2AY1 A;  2YRI A;  1ASD A;  3FDD A;  4E77 A;  1S0A A;  3NU7 A;  4BHD A;  3N4X A;  2VIB A;  2Z61 A;  4AOA A;  9AAT A;  4GE4 A;  1MLZ A;  2CB1 A;  5C6U A;  1SZU A;  1CL2 A;  4P3M A;  1M0N A;  1YJY A;  4EU1 A;  8AAT A;  1I48 A;  2D7Z A;  1BKG A;  1AHX A;  3KKI A;  1B4X A;  3PJ0 A;  2Z20 A;  4RJY A;  3L8A A;  1TOK A;  5G0A A;  4F5M A;  1M0P A;  1Z7D A;  3H7F A;  4F5K A;  2G7J A;  2R5C A;  2C81 A;  4GRX A;  4J5U A;  4B9B A;  1N2T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...