1SFIA

High resolution structure of a potent, cyclic protease inhibitor from sunflower seeds
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title High-resolution structure of a potent, cyclic proteinase inhibitor from sunflower seeds.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 59
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1998-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sfiA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sfiA02
3A82A 4O9VA 1FDPA 4Y76A 3MNCA 2BD8A 4HZHA 2KAIA 4Q80A 1TONA 2Q6GA 4AFZA 1NROH 1RTFB 4JMYA 2HVXA 2CF9H 4FUJA 2RCEA 1SGFA 1EJNA 1W12U 2HLCA 1VITH 1Z8GA 2KAIB 1PPZA 1B0EA 1ZLRA 1EP5A 2ZF0H 1O5GH 3KNXA 3LGVA 1OSSA 2PGQB 2BTCE 1Z71A 1AY6H 4NWKA 5C20A 1ZMLA 3ZVEA 4BTTB 2J38A 1LTOA 3MWIU 2XC5A 3STJA 2UUYA 2Q6FA 3FP6E 1QB9A 3LONA 2A4GA 1AN1E 2WUCA 4ISHH 1GDQA 2FI4E 4DIHH 1EPTA 3B9FH 4O97A 4BNRA 3NWUA 1UCYK 4OS5A 1A5HA 2OC1A 4ASHA 1S85A 3SNBA 1ELTA 2CV3A 3SUEA 1GBDA 1EPTB 3ODFA 4OS7A 3A86A 2PUQH 3CS0A 2BY9X 1C5NH 5K0HA 1BQYA 4FXGH 4INKA 3A7ZA 3GCHB 3T25A 5EU8A 1DXPA 1CQQA 4GAWA 2BZAA 3KF2A 1EJAA 3TPIZ 1SMFE 1LPKB 3LDXH 1T8OA 2WPMS 1ZR0A 1JRSA 4AORA 4WMFA 5L2YH 2BD2A 1O5BB 3TH2H 2TGDA 3AAVA 5EODA 4UFGH 3URCA 3NKKA 3LGWA 1ZOMA 5F03A 1DUEA 4ZMAH 1O35A 3TK9A 5GPIB 3HPTB 3SV8A 4GLYA 4A6LA 2ZGCA 2ZECA 5DK1A 1SGFG 4B73A 4FUDA 3VGCC 2A5IA 2ZC9H 4DW2U 1V2KT 3GICB 1AB9B 1P0SH 3O8DA 1C1PA 1WCZA 2F9VA 2P94A 4A5TS 5EPNA 3ATLA 3TJOA 2RDLA 1GCTC 4TWYA 2Y7XA 1RGQA 3KQEA 2AGIX 2C8ZB 3S9BA 1EXFA 5EQQA 1EATA 3MYWA 1L1JA 2ANMH 5A09A 8KME2 3SU3A 4ZKOU 4THNH 1ANCA 1FIZA 1O3AA 1WTGH 3T2NA 3GCNA 2QIQA 4ZKSU 1TGTA 1OOKB 1ZRBA 1LHGH 3FVFB 2IJOB 3A87A 2BD5A 2ODQA 3P8OA 1GHBF 1MTUA 2FX6A 1TOCB 5GIBA 3UY9A 3MH4A 1SGNE 1AWHB 2FWWA 1THPB 1GI6A 1DANH 1PQ8A 1TNHA 2JH0D 3TLOA 2FMJA 4CRGA 1GHBG 4X1QU 1GHAF 1HV7A 3KL6A 2GZ7A 1MUEB 2ZEBA 3RXPA 1PPCE 4IC5A 2G4UA 3A8BA 2FOFA 1ESBA 1GMCF 3H7TA 5C1XA 1SLVB 1GHAG 2A4OA 1ZTLA 5DKMA 2BY5X 1QGFA 4AX9H 5PTPA 1LKBA 1TLDA 2Z9GA 2HWLB 1GMCG 1ZJDA 1EAIA 3LU9B 1T8MA 2SGDE 3ZZBA 2F9PA 3OTJE 1OYTH 2H6MA 4J2YB 1AFQB 4MNWA 1L0ZA 3V12A 2ZPQA 1F0RA 1TALA 2SGQE 2W7UA 2XCFA 1MTNC 2ASUB 3M5NA 5A8YA 3LKWA 1TFXA 1S81A 1XUGA 3VB4A 3U1JB 4FU7A 1DUAA 3GISB 4X6MA 2CHAB 3E0PB 1O38A 4WH6A 1TRNA 4ABAA 2GP9B 1X7AC 4CRBA 1GI4A 1GJ8B 1YCPK 4NA8A 2VB0A 5DPAA 4YOJA 4NCYA 4R0IA 1A3BH 4KP0A 1TX7A 1H9HE 5DP4A 1QJ1B 1HJ8A 2ZDVH 3T26A 5FAHA 3F9FA 3ZVGA 2JETC 3RU4E 1O32A 2QV1A 1GBCA 1MU8B 1B7XB 1D3DB 3ZVCA 1HAZB 1LPZB 5JYIA 1BMAA 3M3VA 1C1MA 5J4SA 1W2KH 3RXHA 1EASA 1O2QA 2FOEA 2ZGXH 2AS9A 2RG3A 3RP2A 1F0TA 4A92A 5FPYA 2WV5A 4KTUA 3VB6A 1S0QA 3LH1A 1OWDA 4NSVA 5HGGA 2C8YB 1DX5M 3TK6A 1XUIA 3LGUA 4H4FA 1O2KA 4Y8ZA 1SGQE 1GI3A 3GY4A 3ZZ9A 1GBEA 3DFLA 3BTFE 4GVUA 2G81E 1O31A 1BZXE 1YPJH 4DGJA 1O3FA 2XCNA 3SJOA 1BJVA 1KLIH 1D3QB 3W95A 1GHYH 1QR3E 3RMOH 3LC3A 2F9UA 1ZSKA 1MU6B 1AKSB 1XUJA 2BDCA 3A8AA 4GCHF 1VZQH 1C2EA 1P03A 1V2UT 1A0LA 3HK3B 3T62A 1E35B 1EKBB 4AG1A 1V2LT 4WY3A 4X2WA 1UTMA 2VJ1A 2P8OB 4GCHG 4DG4A 2ANWA 4NIYA 3GDSA 4TPIZ 2FTLE 2GD4B 4NA9H 2PTNA 5HYOA 2EI7A 3GY3A 3UREA 2YNBA 3SU1A 3PMBB 1KLTA 2VGCB 1GCDA 2Y5GA 2PGBB 4ZHAA 2V3HH 1MZDA 1HAXB 1FN8A 1AE8H 2AFQB 1DITH 5BPEA 6ESTA 5IDKA 3ATMA 3SV9A 1CT2E 4ABGA 1PPBH 1C2JA 4Y8YA 1A5IA 1ABIH 1P10A 1XXDA 2Y82A 1BUIA 5DP3A 3UTUH 3SI3H 2AMPA 1NN6A 2VINA 3A84A 4DIIH 1UTOA 5HMAA 4FU9A 1Q3XA 2QCYA 1OWHA 2ZKSA 4Q7YA 2THFB 1GG6B 4Y0YE 1NFXA 1MD8A 4F4OC 4ZXXH 1SGYE 1BRUP 2W3IA 1VJAU 2QXGA 2TGPZ 5ABWA 1EQ9A 1ZHMA 3S7HB 3P95A 2FDAA 1ELAA 1O2NA 2ZCHP 3VXEH 1HAGE 3SV7A 2HNTE 3HATH 4ISOA 1C1UH 1KTTB 4B2BA 3Q3XA 1NO9H 4X2VA 4LXBH 2F3CE 2ZPSA 4CHAB 3UNSA 1K2I1 1UCYH 1Y3UA 1UCYE 2F9NA 2VIQA 2Z7FE 5DJ7A 4KTSA 2NU1E 3A7WA 3BEFB 3BN9A 1TGSZ 2A45B 2V35A 1GBJA 2JKHA 4DURA 1V2RT 1ZSJA 1MQ6A 3M35A 1RD3B 1DWEH 2PKSC 2Y80A 4ZHLU 1JXPA 1UTNA 3UNQA 4Y6DA 1QBNA 3CS7A 1NTPA 2WV4A 3BG4B 4HI3A 2AYWA 2VIVA 1BTPA 1H9LB 3ZZ7A 1WYKA 3RXSA 3P92A 1P06A 1C5OH 1DWBH 1YF4A 2JH5D 3GOVB 3HGNA 4AYVB 2UUFB 1A0HB 1UO6A 5JBAS 5FHTA 2CMYA 5JDUB 1DFPA 4DT7B 3EA9A 2VWLA 3M7QA 1MMJN 1TAWA 4X1RU 1YYY1 4I7YH 2VWNA 3UNRA 3U8OH 3E91A 1UK4A 4TYDA 1CA0C 2TPIZ 4YOGA 3ZVBA 7LPRA 1W7GH 5DGJA 2C90B 1PQ7A 4ZKNU 4AFQA 1SGTA 3ZVFA 1TNIA 7ESTE 2OQ5A 4K60A 2Y5HA 5EGMA 3TVJB 4NG9H 4X8SH 1GI9B 3SI4H 1SQOA 1L4DA 1UK3A 3TIUA 1C9PA 1EZSC 3OX7U 3D23A 2D26C 4WJG2 1IQLA 2BD7A 1TB6H 4Y7AA 1V6DA 2FOBA 1TRYA 1T8LA 2C4FH 2D2DA 2ZFSA 1AE5A 1YPHE 2IPHA 2P3TB 3LGYA 3UIRA 2GCTC 1AFEH 3A88A 1PPHE 2J94A 3RXIA 2VIDA 1CBWC 4IN1A 4MPVA 2Z9LA 4X2YA 3T28A 4J1YA 3STIA 2UWOA 1VR1H 3SZNA 4BOHA 1N8OC 4ZKRU 1F5RA 1C5XB 3S0NA 4GHQA 2QGRA 1P2JA 1EB2A 4NGAH 1NRSH 3ZZCA 3D49H 1UK2A 4OS1A 2BVXH 1UJ1A 4MPWA 9ESTA 2K1QA 1C5UA 2GZ8A 1P9SA 3N7OA 2WPJS 3RXRA 1KXEA 1LVMA 1CSOE 3SU4A 1AIXH 1Z8JB 1LCYA 2WPLS 3LJOA 1KLJH 2BLOA 1BTYA 1QBVH 1GJ9B 4ABFA 1GI2A 1C5SA 1Z7KA 4XBDA 1TYNA 2ZDKA 1N6YA 2FP7B 4KKDA 1C4Y2 1P2KA 1UVTH 5CE1A 3SORA 4VGCC 5FX5A 1YCPH 1UHBA 1YLDA 2ZHQH 3FP7E 1MQ5A 3B23B 3G01A 2VIOA 1O2ZA 2B9LA 3ZZ3A 2ZQ2A 1BTUA 1AMHA 2ZU5A 1GJBB 3TH4H 3RMLH 2HOBA 4O3TA 2A7CA 1SVPA 3D62A 5B6OA 1AI8H 1RIWB 3UR9A 1UHBB 2AMQA 2UUKB 2ZHDA 4ZUHA 1YPEH 4IMQA 1MH0A 2GMTC 2XTTB 3MNBA 2PTCE 2YOLA 4F49A 4X8VH 3ZVAA 2STBE 3HK6B 1TQ0B 4AN7A 3BTKE 2O8MA 4UEHH 1O5AB 2EC9H 1C5TA 5AF9H 4DCDA 3DFJA 4D8NA 3QX5H 3DA9B 4MTBA 3BEUA 4RKOB 1TPOA 3MO9A 3TH3H 1EZQA 1LHFH 3NK8A 1J17T 1LQDB 5AVDA 2PWXA 5EW2H 3QZQA 4MLFB 1NRRH 1DE7H 3SNCA 4XDEA 1QB1A 3IWMA 1D3TB 2BVSH 2OBOA 1ELCA 3SHAH 1EX3A 1C2HA 2ILNA 2CN0H 3SJ8A 3MTYA 4U01A 3U8RH 2C8WB 1S82A 3SNDA 1O3KA 1E36B 1Y5BT 1BBRH 2OUAA 4K2YA 2JH6D 2Z3CA 1V2QT 1O30A 2BDIA 2XXLA 1XKBC 3SQHE 3UWJH 3SU5A 5LPRA 5L6NH 1GHZA 4IN2A 1ARBA 3SUFA 1TWXB 2RA3A 3DT0H 5LH8A 1CGHA 1LO6A 1KXAA 1O2LA 1GL1A 1TGCA 4I33A 3PO1C 1ELGA 2FYRA 3QZRA 5A0BA 1OP8A 2G8TA 4Q2KA 3E16B 2XWAA 5EG4A 2LNCA 1QURH 1DICA 4BAOB 1MKWK 4Q7ZA 1GVKB 1O3EA 3H7OA 2W26A 3RC5A 1Y3XA 2WUBA 1AUTC 2PR3A 5DP5A 4JYTA 2PW8H 3KQCA 4Z0KA 2QC2A 3K9XB 1BIOA 1DDJA 3DUXH 3M5LA 1P57B 3M3TA 1NY22 1CHGA 3PTNA 4CH2B 4FUBA 4FUCA 4ISNA 3TJNA 4ABIA 1PQAA 3V3MA 1QA7A 1TNLA 1AO5A 4A7IB 3ZZ6A 2GT8A 1O36A 3M7UA 2O8UA 1OS8A 4WF8A 4X1NU 3RXCA 1KSNA 5E0JA 3QWCH 3TNSA 3SU0A 3VB3A 3ZYEA 2A4RA 3KHVA 5E0GA 1V2OT 4XSKU 1TBRH 4YESB 1XM1A 1VGCC 2ODPA 2ZZUH 2BOKA 1Z6JH 1UVUH 3MU1A 1BMNH 3SV2H 3GCOA 2WPKS 3EA8A 5FCKA 3SU2A 4WH8A 1O2PA 1C5LH 1DY9A 1HDTH 5FCRA 2P59A 1DWCH 5FBIA 2EI8A 2ZGHA 1RJXB 1F0SA 1Y3VA 1NFWA 2BM2A 1FY5A 4BAQB 4NWLA 3A7VA 3UQOA 3RXDA 1VCPA 1KXDA 5HXFA 2OC0A 1HRTH 3PLPA 1ZTKA 2B0FA 3PB1E 3SQEE 1ARCA 2ZWLH 4TY7A 2Z9JA 1TX6A 1QBOA 1P3CA 1BHXF 1SGIB 1TMTH 1UVSH 1W0YH 1BRBE 4IMZA 4XE4A 3QLPH 4UFFH 1ETRH 4Y11E 2FYQA 3MI4A 1C2LA 2BQ7B 5E2PA 2WPHS 1G3DA 2GDDA 4CR9A 1HBTH 3A7XA 1YPKH 4D7FA 1EAWA 1DVAH 4JK5A 1SHYA 1A3EH 1YPHC 4NIWA 5DP7A 4E7RG 2IOTA 1IQNA 1TBQH 1D6RA 2HRVA 3P8NA 1A4WH 4AZ2B 5FPTA 2ANKH 1NESE 2FS8A 1NS3A 2FOGA 1GMHF 1ZZZA 1FPCH 2UWLA 3GY7A 4NIVA 1P02A 1ZPBA 1BTXA 3CP7A 2NU2E 4BTIB 3PLBA 1AVWA 3U8TH 6CHAC 2BX3A 1GMHG 1MTVA 4YOIA 8ESTE 2VVUA 1YGCH 1U6QA 1O3PB 1LHEH 1GGDB 3W94A 1HXFH 1ELFA 5AFZH 4IGDA 2A1DB 1LPGB 1EAXA 1A61H 1QQ4A 1C5YB 5CHAB 4LZ1H 2EEKA 2TRMA 2FLRH 3TGJE 1ANEA 2WPIS 4I8JA 5EXNA 5JB9S 4MNYA 2ZDNA 3A89A 2BD9A 1RTKA 3SJKA 3LH3A 5EPYA 4E05H 4YM9A 1W8BH 3I77A 1HAVA 4SGAE 5GCHF 3MU4A 4MG3A 1C5VA 1QY6A 2VH0A 1AHTH 1WOFA 1PYTC 4ESTE 2O8LA 3AASA 3RXBA 2Y81A 1GBBA 5FPSA 1AVXA 1HAVB 1HIAA 1O2MA 1TGBA 3F6UH 5GCHG 1KTSB 2ZCLP 1D6WA 1O3NA 4CH8B 1SOTA 4Y10E 1RS0A 2FODA 3BF6H 2ZPRA 2BDBA 1O2SA 5HM2A 1HIAB 5TCCA 1GL0E 3LGTA 1C1TA 1LDTT 3GDVA 2OBQA 1K28D 2GV6A 1WTHD 1G9IE 3ATIA 1M9UA 3BIUH 2GGVB 3K6ZA 1C5WB 5GXPA 2GTBA 3M3SA 2BMGB 3SW2B 3EDXB 2BDAA 3QTVH 1V2TT 3SHCH 2VVCA 3KIDU 1FQ3A 4I8HA 2XNIA 4UD9H 4AFSA 1O2WA 2R3UA 1FY8E 1IHTH 5DP8A 3ZZDA 4B75A 2STAE 3TGKE 1EAUA 1SPJA 4U30A 1NRPH 5EXLA 1A7SA 3A83A 1O3BA 3SU6A 2A32A 3MU8A 2QYIA 1BBRK 3UUZA 2P93A 1EPTC 1IAUA 1ABJH 1SHHB 3GYMA 4LK4A 3NZIA 3Q77A 4MNXA 3SNAA 1EOLA 2FOHA 3GCHC 1O5CB 4WVPE 3V13A 3V7TA 2FLBH 6GCHF 1MTWA 1C5RA 2A2QH 2AMDA 1MKXK 5K7RA 1K1JA 2GZ9A 2OC8A 1P2MA 2ZIQH 1WAYB 3M5OA 2FOMB 1XXFA 4ABDA 2NU3E 6GCHG 4Y8XA 1TQ7B 4GSOA 2Z3EA 2A2XH 3PMJA 3M7TA 1O2TA 1GJAB 4ISLA 3DHKH 5C2ZA 1GHXH 1HAYB 2NU4E 3E6PH 1SBWA 4K5ZA 1QRZA 1C1QA 1GVZA 1C2MA 2YNAA 4JCNA 1MCVA 2A7HA 1SL3A 4E06H 1G2LA 1K22H 4O3UA 1O2VA 3RXJA 1K1MA 1QFKH 4CBNA 3KCGH 4AB8A 1AB9C 1OPHB 5E8EH 1O5FH 2R0KA 2H1UA 1YPGH 1H8DH 1F2SE 5ESBA 2QA9E 1O2GH 4I8GA 3RU4T 4BANB 3GY2A 3RC4A 2BYAX 3ZZ4A 3U9AH 2A0QB 3UOUA 5BRRE 2RA0A 1JOUB 3QDZB 4XFQA 4NSYA 2TGTA 1UVPA 4LZ4B 2ZP0H 5T6DA 5LPEA 1O3GA 1TMBH 2TGAA 4X6OA 1HJAB 3GYLB 3T5FH 1JRTA 1GDUA 2PV9B 4A1VA 4X0WU 2BB4A 1ZSLA 1SB1H 2BQWB 1AQ7A 1T31A 1GI7B 1CO7E 1MKWH 3MO6A 1QCPA 1THSH 4KTCA 3EGKH 4JZIA 1MCTA 2F83A 1G30B 4HGCA 1V2ST 1IQJA 1OXGA 1DY8A 2ZFTA 1AD8H 1ZHRA 3EYDA 2G5VA 5ETXA 1T7CA 4NIXA 1XUHA 1IQFA 2P16A 1GVLA 3A7TA 1SSXA 5CMXH 4OS2A 5AFYH 3FANA 2V6NA 1XX9A 2Z94A 3VFEA 3K2UA 1AGJA 2XWBI 3O8BA 5GJ4B 1PQ5A 3LOXA 1WU1A 2G52A 2IN2A 2AGGX 3LJJA 3RXTA 1KDQA 1XVOA 3QK1A 1BRAA 1GBAA 2NWNA 2ZHFH 3MFJA 3EE0B 4FVBA 1FY4A 1GBKA 3RU4D 1AFQC 1C9TA 1FMGA 1YBWA 2R9PA 1P09A 3RXVA 5A0AE 1BT7A 2BD4A 2CGAA 1GI5A 1C2KA 1ORFA 4YZUA 4I8LA 1ZTJA 3BTWE 3MHWU 1VJ9U 2CHAC 1GJ5H 2R2WU 1C1RA 3A81A 5DO4H 1FY3A 1K9OE 3QTOH 3BTQE 1GJ6A 3RLWH 1JMOH 3QUMP 2Z6BD 4MPXA 1ID5H 1T8NA 3VB5A 2Z3DA 2H9HA 3FFGA 3M61U 2QN5T 1MAYA 3GY5A 1V2NT 2H5DA 1BOQA 2GX4A 3PMAB 1XVMA 1P05A 4A1TA 2C3SA 4ZH8A 4MPUA 1TMUH 3BTTE 2XC4A 1O5EH 1PPFE 5F8XA 1V2PT 2VU8E 4TY6A 1DOJA 1DSTA 2ZCKP 3TU7H 1GJDB 1J8AA 3E8LA 1FAKH 1O39A 2A31A 4I31A 1N1LA 1TPPA 3VGCB 1IQHA 1THRH 2H5CA 1ACBE 1RTLA 1A5GH 2J95A 1G3EA 1GCTB 1DLKB 3SGAE 1CU1A 3ESTA 2C93B 2QY0B 2O8TA 5DP9A 1EP6A 3T27A 4AOQA 1E0FD 2J9NA 5H4IB 1WBGB 3SJIA 2P95A 4B2AA 1EJMA 1J15A 1D9IA 1FUJA 1V2JT 2ZQ1A 3F9GA 2FM2A 4FVDA 1SFQB 4YT7H 4R8TB 2P3UB 3ENSB 1KYNA 1O3OA 3GCTF 4ZROA 2ZG0H 1GJ7B 3UWIA 1W13U 1W3CA 1T32A 5C1UA 1BITA 4UFEH 2OC7A 1O3MA 3CENA 1HAHH 3VPKA 5EQRA 4RKJB 4DOQA 2P8OC 1LQEA 3BTHE 5F6MA 1H1BA 1TIOA 2XRCA 1A1RA 4IS5A 1OP2A 3GCTG 2J34A 1ELBA 4NA7A 1S5SA 2OTVA 1MBQA 3RM2H 5ESTE 4D9RA 3DD2H 2VWMA 2ULLA 2Z9IA 3AW1A 2OLGA 2VGCC 4PROA 1G3BA 4Y71A 1C5PA 4MVNA 2QXIA 1ELEE 1VCWA 2SGAA 1QJ7B 1ZYOA 5JPMH 2OINA 3QGNB 3UOPA 2LPRA 1FI8A 4OGYA 3RMNH 1LVOA 1TPSA 3E1XB 1Q2WA 3RMMH 3SUGA 1E37B 3UR6A 3AAUA 4NZLA 1F0UA 2VVVA 4JZDH 1Y5UT 3KGPA 1TPAE 3F1SB 4XBCA 2ZO3H 2SFAA 5C1YA 1C2IA 1GHWH 1GG6C 1MTNB 1GHVH 1YKTA 2PLXA 3NXPA 3M36A 3A7YA 3PLKA 1G32B 4HFPB 2ZGBH 4H6TA 1S6FA 2ZDMA 4ISIH 4JYVH 3EQ0H 1TRMA 3PWBA 1SGPE 2XYAA 2ZHWH 2C8XB 2SNWA 1OWJA 4FUHA 1TA2A 1A46H 5A2MH 2ANYA 3OY6U 1O3HA 2ZDLA 1YC0A 1UTJA 4CRDA 2FXRA 2BHGA 2FI5E 1L1NA 2CXVA 4CHAC 2AIQA 1OWIA 1LVBA 2QXJA 4WWYA 3RXOA 1K1LA 2JETB 3BTDE 1BBRE 3OYPA 4UFDH 4BAKB 2V3OH 1HPGA 1UTQA 1GJCB 2Q6DA 2F91A 3BG8A 3FZZA 3MNSA 1PJPA 1OWKA 3E90B 1HNEE 4K3JA 2UWPA 3A85A 2Y7ZA 4AGJA 2D8WA 1MKXH 1AWFH 3BG4C 1UVOA 3V0XA 2ZU3A 3OSYA 1HAIH 2G5NA 1NZQH 1AZZA 1H9IE 3LC5A 2GKVE 1NFYA 3A8DA 4UE7H 3RM0H 4BTUB 4Q7XA 2HNTC 1DS2E 2R2MB 1LHDH 1BTWA 1DT2A 1ETSH 1C1SA 4X8TH 2BY6X 4K1SA 4ZHMU 1MBMA 2ZTYA 3M37A 3TGIE 1FAXA 4BAMB 1BHXB 1FN6A 3MNXA 1GBFA 4Y7BA 4B76A 4GPGA 1RXPA 1K21H 4U2WA 1ZPCA 1SI5H 1T4UH 4WXIA 1GI8B 2VNTA 1WUNH 1SGEE 1FONA 4A1XA 4NFFA 2BQ6B 4CBOA 1SGRE 1PPEE 2ODYB 1G2MA 1C1OA 1C4U2 3RXGA 4K8YA 5E0HA 2HPQH 1GBHA 3MH7A 2PSXA 3U69H 1SGCA 1NFUA 1NRQH 2ZGJA 2TIOA 2BD3A 1QL9A 1GWAA 3I78A 6LPRA 1MZAA 1O5DH 1W0ZU 1P8VC 1V2WT 1BTZA 2B8OH 1OWEA 3MU0A 5A0CA 3NPSA 2BXTH 1N6XA 1J16A 3RXKA 3K6YA 4I8KA 2PHBA 4ABBA 4O03A 4CR5A 1D3PB 3PTBA 1ANDA 2ZTZA 3KN2A 1GMDF 1QRWA 3TNTA 1ESTA 5T6GA 3ZZ8A 2XBWA 2FZZA 2VWOA 2AGEX 1EZUC 4K8BA 2I6QA 3O8RA 1FV9A 1PPGE 1GMDG 1PYTD 2HGTH 1VCQA 2BXUH 1ELDE 1OP0A 4IC6A 1UTKA 1BMLA 2O8WA 4DJZB 1W11U 3LPRA 1ZHPA 2ZI2H 1E34B 2H2ZA 1FZZA 2R3YA 5JBTA 4X8UH 5FX6A 1SGDE 1GDNA 2J4IA 3OU0A 4YT6H 3TITA 3ZVDA 1FXYA 1MAXA 4CRCA 1Y3YA 1O2HA 1TNKA 4RN6A 1AUJA 1F5LA 4LOYH 1HAPH 3ZZ5A 4TPYA 1VITF 3MMGA 4D76A 2FTMA 1HB0B 2A4QA 2GVFA 8GCHF 4OS4A 5E2OA 5FXLA 2F9OA 1VITG 1GPZA 1KIGH 1RFNA 3GDUA 1H8IH 4KGAA 3TJUA 3S9CA 1INCA 1HYLA 1O3LA 2XBVA 8GCHG 3P8GA 1CVWH 1DWDH 1BB0B 1IQKA 4MQAA 1O3DA 2ZU1A 1IQIA 4K1EA 2ALVA 2PKSB 2H9TH 1HFDA 1AU8A 1RIWC 1F92A 5T3HA 1XUKA 1P2NA 1QL8A 2A7JA 1TX8A 1KXFA 4FUIA 1Z1IA 1E38B 4MDSA 1NM6A 1O3JA 1P3EA 5FBEA 2BLQA 4BXSA 1DSUA 3BTEE 3NUMA 4YTAA 1CA8B 1FNIA 1DM4B 1SG8B 1Z8IB 3ELAH 1HXEH 1QQUA 1ZGIA 1SOZA 1AVGH 1O2XA 1O2OA 4Y0ZE 2BY8X 2A5AA 1G36A 2OQUA 2XBYA 4BXWA 5C3NA 3U98H 1KXBA 3L3TA 1FIWA 1F5KU 4AYYB 3R3GB 1CGIE 4ABJA 1CA0B 3Q3YA 4QT8C 3VB7A 1AZ8A 3L33A 2CF8H 8LPRA 1T4VH 4K69A 3IG6B 2ZU2A 1TE0A 3SOSA 1K1NA 1O34A 3BIVH 2DUCA 3KQBA 2W7SA 3PYHA 3SGBE 1IQMA 2Q1JA 2ZU4A 3VXFH 1D4PB 5GDSH 4B71A 1NC6A 1C2GA 4FUFA 1OX1A 1HUTH 1TGNA 1FLEE 1ZMNA 1HGTH 1CGJE 1ZMJA 3L6PA 2BDHA 1O3CA 2GCTB 3RXFA 3GY8A 2P3FH 5DG6A 4FU8A 5T6FA 2F9BH 3F9EA 1G37A 1HJ9A 4B74A 1TNJA 1GBLA 2W3KA 1CBWB 1Z6EA 2I6SA 1ZRKA 1Z8RA 3UFAA 3Q3KA 1P2IA 3UQVA 1C5MD 4B1TA 1GI1A 3RC6A 1QL7A 4UDWH 1N8OB 1V2MT 3RXMA 2O9QA 1YM0A 2AH4X 3URDA 4FUEA 3SUDA 1O2UA 1UMAH 1C1VH 3ATWA 1A0JA 1HCGA 1AKSA 1XUFA 4ZAEA 3ZYDA 5L30H 2GT7A 1JBUH 1P9UA 5GWZA 1JWTA 5EW1H 3FAOA 1B0FA 5JB8S 1TBZH 3SJ9A 4H6SB 3ZV8A 5JBCS 3EA7A 4CRAA 4IW4E 4AB9A 3SGQE 2G55A 1C5QA 2ALPA 2OXSA 1CE5A 1JIRA 2FOAA 3BV9B 4RSPA 2J92A 4XOJA 1SQTA 1BA8B 1NRNH 3E3TA 1NU9A 4NFEA 1WQSA 1FJSA 1O2IA 3GY6A 1F7ZA 4JZEH 4VGCB 4YLUA 3HGPA 3PM3A 1QA0A 1K1PA 2ZFRH 3QO6A 1S84A 1O3IA 3PMHB 1QNJA 1C2FA 3O8CA 2BDGA 2UUJB 3E0NB 1S0RA 2ZFPH 5EQSA 2VIPA 3MOCA 5A8XA 2GMTB 2ESTE 1QB6A 3RXQA 1WSSH 2G4TA 3MH6A 4JZ1A 4X6PA 2G00A 1A2CH 2ZFQH 1ESAA 2BZ6H 2XBXA 3A80A 1SLXB 2BX4A 2FS9A 3ZZAA 3QN7A 1Y8TA 1BDAA 1NPMA 2B7DH 4ABEA 1EOJA 1IOEA 2ZTXA 1BRCE 1GBIA 3C1KA 3RXLA 1QHRB 5G4BA 2XW9A 1Q31A 3RXEA 1P01A 5C67A 1IHSH 2OCVB 1BTHH 1YPLH 4INLA 3LIWA 1HAOH 1TA6A 4K1TA 4B2CA 1O2JA 5DP6A 3WY8A 2ZA5A 4DY7B 1OYQA 1P12E 4MNVA 1W10U 5TJXA 2FX4A 1Y3WA 1YP9A 3VEQB 3QGJA 2ZFFH 3JZ2B 3LGIA 1CT4E 1SLUB 1KXCA 3T29A 3ODDA 1QJ6B 1S6HA 4AFUA 1YCPM 3RXUA 1MTSA 4M7GA 4TWWA 2FPZA 3A8CA 3PV4A 1ZGVA 1GGDC 3HKJB 4FUGA 4IBLH 3OY5U 1KDQB 1K1IA 1XMNB 2W5EA 1IQEA 1TABE 1O33A 1ZPZA 2WINI 3Q00A 4Z6AH 3PO1B 2J2UA 1IQGA 4NZQA 4SGBE 7KMEH 4U32A 1J9CH 5CHAC 2XC0A 2BY7X 5SGAE 2GV7A 1LHCH 1C1WH 7GCHF 1C5ZB 4CREA 3ZV9A 1DLEA 3F68H 1L4ZA 1W14U 3RLYH 4ZXYH 5A8ZA 7GCHG 1GBTA 1GI0A 3ATKA 3KQDA 3BTGE 2QXHA 3FP8E 2VH6A 3SNEA 3M5MA 1YPMH 3I29A 1SLWB 1H4WA 3R0FA 5LGOA 1UTLM 1Z1JA 2ZHEH 2GDEH 4GHTA 1Y5AT 3H5CB 1UTPA 3FZDA 3IITA 5LPFA 3PWCA 2OP9A 2Y5FA 3BEIB 1O37A 4JZFH 2D1JA 1BJUA 3ITIA 5JBBS 1EB1H 2BDYA 1WQVH 1V3XA 1QTFA 1VGCB 4GUXA 2QF3A 4D7GA 1WV7H 3P6ZB 4X6NA 4WMDA 2FEQH 2GCHF 4X2XA 2Z9KA 1YLCA 5I46H 5EXMA 2AEIH 1O2YA 1NU7B 1O0DH 5AHGH 1BCUH 4YO9A 3HKIB 4OGXA 1FY1A 1NT1A 3JZ1B 3MO3A 3SV6A 2SGFE 3P17H 2GCHG 4H42U 2EA3A 2FO9A 1ZJKA 2PSYA 3SN8A 4DVAU 3S69A 3K65B 5F8TA 2WYGA 2NU0E 2DE8A 4XBBA 3RDZA 1CT0E 1P2OA 5IYTA 1JIMA 1HLTH 2PUXB 2HNTF 2QAAA 4WXVA 3C27B 1C2DA 1DPOA 3RUOA 4CRFA 2R0LA 2QF0A 4BAHB 2PFEA 3S7KB 1EZXC 1DXWA 5HM9A 2CJIA 1J14A 2FESH 4I32A 3EAJA 3MH5A 5J4QA 1L2EA 1ANBA 2ZNKH 2ZDAH 5C5NA 1V2VT 1QIXB 3SBKA 1FPHH 3P8FA 5L2ZH 3AVZA 2PKAA 2AERH 2FIRH 5TCAA 1P2QA 2Y6TA 1C4V2 2SNVA 2BLVA 1QRXA 4X1PU 1SR5C 4D9QA 3TJVA 1RRKA 2H9EH 2PKAB 1TOMH 2G51A 1ELVA 3D65E 4JK6A 3F9HA 5F8ZA 4E7NA 2V0BA 1PFXC 1OKXA 2BOHB 2OD3B 3Q76A 5C5OA 2EI6A 1BMMH 1XKAC 2A5KA 4JYUH 5I25A 1KY9A 3RXAA 1K1OA 2AIPA 2TBSA 1GBMA 1SFIA 3KEEA 2SGEE 3NCLA 4HTCH 3AW0A 1P11E 1P04A 6CHAB 3U1IB 2BLWA 2B5TB 2M5TA 4Y79A 1G3CA 1LMWB 4AGKA 3SO3A 2BVRH 3B8JA 2SGPE 1Y59T 1MD7A 1SQAA 4WMEA 1CHOF 2FOCA 4X1SU 3P70B 2HPPH 2HALA 3UPEA 3BTME 5EOKA 4INHA 1LKAA 4KELA 9LPRA 1GJ4H 1W7XH 3PROA 3MU5A 1S83A 4YLQH 3BSQA 3S9AA 2VIWA 1SC8U 1TNGA 2FI3E 3LT3A 1CHOG 4ABHA 1ETTH 4UONA 1C1NA 2WYJA 1O2RA 2DE9A 3TK5A 1EUFA 1LVYA 4AG2A 1HJAC 1B5GH 4OS6A 1L1GA
chains in the Genus database with same CATH superfamily
3A82A 4O9VA 1FDPA 4Y76A 3MNCA 2BD8A 4HZHA 2KAIA 4Q80A 1TONA 2Q6GA 4AFZA 1NROH 1RTFB 4JMYA 4Q63A 2HVXA 2CF9H 4FUJA 2RCEA 1SGFA 1EJNA 1W12U 2K8IA 2HLCA 1VITH 1Z8GA 2KAIB 1PPZA 3F2FA 3F3BA 1B0EA 1ZLRA 1EP5A 2ZF0H 1O5GH 3KNXA 3LGVA 1OSSA 2YMSC 4FOUC 2PGQB 2BTCE 1Z71A 5KEDA 1AY6H 2F4LA 4NWKA 5C20A 1ZMLA 1YY3A 3ZVEA 4BTTB 2J38A 1LTOA 3MWIU 2XC5A 3STJA 2UUYA 2Q6FA 3FP6E 1QB9A 3LONA 2A4GA 1AN1E 2WUCA 4P02A 4ISHH 1GDQA 2FI4E 4DIHH 1EPTA 3B9FH 4O97A 4Q4LA 4BNRA 3NWUA 1UCYK 4OS5A 1A5HA 2OC1A 4ASHA 1S85A 3SNBA 1ELTA 2CV3A 3SUEA 1GBDA 1EPTB 3ODFA 4OS7A 3A86A 2PUQH 3CS0A 2BY9X 1C5NH 5K0HA 1BQYA 4FXGH 4INKA 3A7ZA 3GCHB 3T25A 5EU8A 1DXPA 2WHXA 1CQQA 4GAWA 2BZAA 4XD7D 3KF2A 1EJAA 3TPIZ 1SMFE 1LPKB 3LDXH 1T8OA 2WPMS 5EJZA 1ZR0A 1JRSA 2KCOA 4AORA 4WMFA 5L2YH 1SKYE 2BD2A 1O5BB 3TH2H 2TGDA 3AAVA 5EODA 4UFGH 5FL7D 3URCA 3NKKA 3LGWA 1ZOMA 5F03A 1DUEA 4ZMAH 1O35A 3TK9A 5GPIB 3HPTB 3SV8A 4GLYA 4A6LA 2ZGCA 2ZECA 5DK1A 1SGFG 4B73A 4FUDA 3VGCC 2A5IA 2ZC9H 4DW2U 1KMHB 1V2KT 3GICB 1AB9B 1P0SH 3O8DA 1C1PA 1WCZA 2QF5A 2F9VA 2P94A 4A5TS 5EPNA 3ATLA 3TJOA 2RDLA 1GCTC 4TWYA 2Y7XA 1RGQA 3KQEA 2AGIX 2KZ4A 2C8ZB 3S9BA 3GS9A 1EXFA 5EQQA 1EATA 3MYWA 1L1JA 2ANMH 5A09A 8KME2 3SU3A 4ZKOU 4THNH 1ANCA 1FIZA 1O3AA 1WTGH 3T2NA 3GCNA 2QIQA 4ZKSU 1TGTA 1OOKB 1ZRBA 1LHGH 3FVFB 2IJOB 3A87A 2BD5A 2ODQA 3P8OA 1NBMD 1GHBF 1MTUA 2FX6A 1TOCB 5GIBA 3UY9A 3MH4A 1SGNE 1AWHB 2FWWA 1THPB 3H09A 1GI6A 1DANH 1PQ8A 1TNHA 2JH0D 3TLOA 2FMJA 4CRGA 1GHBG 4X1QU 1GHAF 1HV7A 3KL6A 2GZ7A 1MUEB 2ZEBA 3RXPA 1PPCE 4IC5A 2G4UA 3A8BA 2FOFA 1ESBA 1GMCF 3H7TA 5C1XA 1SLVB 1GHAG 2A4OA 1ZTLA 5DKMA 2BY5X 2XOKD 1QGFA 4AX9H 5PTPA 1LKBA 1TLDA 2Z9GA 2HWLB 1GMCG 1ZJDA 1EAIA 3LU9B 1T8MA 2SGDE 3ZZBA 2F9PA 3OTJE 1OYTH 2H6MA 4J2YB 1AFQB 4MNWA 1L0ZA 3V12A 2ZPQA 1F0RA 1TALA 2SGQE 2W7UA 2XCFA 1MTNC 2ASUB 3M5NA 5A8YA 3LKWA 1TFXA 1S81A 1XUGA 3VB4A 3U1JB 4FU7A 1DUAA 3GISB 4X6MA 2CHAB 3E0PB 1O38A 4WH6A 1TRNA 4ABAA 2GP9B 1X7AC 4CRBA 1GI4A 1GJ8B 1YCPK 2RFKC 4NA8A 2VB0A 5DPAA 4YOJA 4NCYA 4R0IA 1A3BH 4KP0A 1TX7A 1H9HE 5DP4A 1QJ1B 1HJ8A 2ZDVH 3T26A 5FAHA 3F9FA 3ZVGA 2JETC 3RU4E 1O32A 2QV1A 1GBCA 1MU8B 1B7XB 1D3DB 3ZVCA 1HAZB 1WDIA 1LPZB 5JYIA 1BMAA 3M3VA 1C1MA 5J4SA 1W2KH 3RXHA 1EASA 1O2QA 2FOEA 2ZGXH 2AS9A 2RG3A 3RP2A 1F0TA 4A92A 5FPYA 2WV5A 4KTUA 3VB6A 1S0QA 3LH1A 1OWDA 4NSVA 5HGGA 2C8YB 1DX5M 3TK6A 1XUIA 3LGUA 4H4FA 1O2KA 4Y8ZA 1SGQE 1GI3A 3GY4A 3ZZ9A 1GBEA 3DFLA 3BTFE 4GVUA 2G81E 1O31A 1BZXE 1YPJH 4DGJA 1O3FA 2XCNA 3SJOA 1BJVA 1KLIH 5CHBA 1D3QB 3W95A 1GHYH 1QR3E 3RMOH 3LC3A 2F9UA 1ZSKA 1MU6B 1AKSB 1XUJA 2BDCA 3A8AA 3OEED 4GCHF 2QE7D 1VZQH 2J98A 1C2EA 1P03A 1V2UT 4XRNA 1A0LA 3HK3B 3T62A 1E35B 2WSSD 1EKBB 4AG1A 1V2LT 4WY3A 4X2WA 1UTMA 2VJ1A 2P8OB 4GCHG 1H8HD 2J98B 4DG4A 2ANWA 4NIYA 3GDSA 4TPIZ 1WXRA 2EY4C 2FTLE 2GD4B 4NA9H 2PTNA 5HYOA 2EI7A 3GY3A 3UREA 2YNBA 3SU1A 3PMBB 1KLTA 2VGCB 1GCDA 2Y5GA 2PGBB 4ZHAA 2V3HH 1MZDA 1HAXB 1FN8A 1AE8H 2AFQB 1DITH 5BPEA 6ESTA 5IDKA 3ATMA 3SV9A 1CT2E 4ABGA 1PPBH 1C2JA 4Y8YA 1A5IA 1ABIH 1P10A 1XXDA 2Y82A 1BUIA 5DP3A 3UTUH 3SI3H 2AMPA 1NN6A 2VINA 3A84A 4DIIH 1UTOA 5HMAA 4FU9A 1Q3XA 2QCYA 1OWHA 2ZKSA 2QF4A 4Q7YA 2THFB 1GG6B 4Y0YE 1NFXA 1MD8A 4F4OC 4ZXXH 1SGYE 1BRUP 2W3IA 1VJAU 2QXGA 2TGPZ 5ABWA 2KM0A 1EQ9A 1ZHMA 3S7HB 3P95A 2FDAA 1ELAA 1O2NA 2ZCHP 3VXEH 1HAGE 3SV7A 2HNTE 3HATH 4ISOA 1C1UH 1KTTB 4B2BA 3Q3XA 1NO9H 4X2VA 5B6LA 4LXBH 2F3CE 2ZPSA 4CHAB 3UNSA 1K2I1 1UCYH 1Y3UA 1UCYE 2F9NA 2VIQA 2Z7FE 5DJ7A 4KTSA 2NU1E 3A7WA 3BEFB 4P00A 3BN9A 1TGSZ 2A45B 2V35A 1BMFD 1GBJA 2JKHA 4ACBA 4DURA 1V2RT 1ZSJA 1MQ6A 3M35A 1RD3B 1DWEH 2PKSC 2Y80A 4ZHLU 1JXPA 1UTNA 3UNQA 4Y6DA 1QBNA 3CS7A 1NTPA 2WV4A 3BG4B 4HI3A 2AYWA 2VIVA 1BTPA 1H9LB 3ZZ7A 1WYKA 3RXSA 3P92A 1P06A 1C5OH 1DWBH 1YF4A 2JH5D 3GOVB 3HGNA 4AYVB 2UUFB 1A0HB 1UO6A 5JBAS 5FHTA 2CMYA 5JDUB 1DFPA 4DT7B 3EA9A 2VWLA 3M7QA 1MMJN 1TAWA 4X1RU 1W0JD 1YYY1 4I7YH 4M9FA 2VWNA 3UNRA 3U8OH 3F2HA 3E91A 1UK4A 4TYDA 1CA0C 2F43B 2TPIZ 4YOGA 3ZVBA 7LPRA 1W7GH 5DGJA 2C90B 2XNDD 1PQ7A 4ZKNU 4AFQA 1SGTA 3ZVFA 3FOAA 1TNIA 7ESTE 2OQ5A 4K60A 2Y5HA 5EGMA 3TVJB 4NG9H 4X8SH 1GI9B 3SI4H 1SQOA 1L4DA 1UK3A 3TIUA 1C9PA 1EZSC 3OX7U 3D23A 2D26C 4WJG2 1IQLA 2BD7A 1TB6H 4Y7AA 1V6DA 2FOBA 1TRYA 1T8LA 2C4FH 2D2DA 2ZFSA 1AE5A 1YPHE 2IPHA 2P3TB 3LGYA 3UIRA 2GCTC 1AFEH 2KFWA 3A88A 1PPHE 2J94A 3RXIA 2VIDA 1CBWC 4IN1A 4MPVA 2Z9LA 4X2YA 3T28A 4J1YA 3STIA 5HKKD 2UWOA 1VR1H 3SZNA 4BOHA 1N8OC 4ZKRU 1F5RA 1C5XB 3S0NA 4GHQA 2QGRA 1P2JA 1EB2A 4NGAH 3PRDA 1NRSH 3ZZCA 3D49H 1UK2A 4OS1A 5KGOA 2BVXH 1UJ1A 4MPWA 9ESTA 2K1QA 1C5UA 2GZ8A 1P9SA 3N7OA 3UB0A 1QZ8A 2WPJS 3RXRA 1KXEA 1LVMA 1CSOE 3SU4A 1AIXH 1Z8JB 1LCYA 2WPLS 3LJOA 1KLJH 2BLOA 1BTYA 3OTPA 1QBVH 1GJ9B 3F2GA 4ABFA 1GI2A 1C5SA 1Z7KA 4XBDA 1TYNA 2ZDKA 1N6YA 2FP7B 4KKDA 1C4Y2 1P2KA 1UVTH 5CE1A 3SORA 4VGCC 5FX5A 1YCPH 1UHBA 1YLDA 2ZHQH 3FP7E 1MQ5A 3B23B 3G01A 2VIOA 1O2ZA 2B9LA 3ZZ3A 2ZQ2A 1BTUA 1AMHA 2ZU5A 1GJBB 3TH4H 3RMLH 2HOBA 4O3TA 2A7CA 1SVPA 3D62A 5B6OA 1AI8H 1RIWB 3UR9A 1UHBB 2AMQA 2UUKB 2ZHDA 4ZUHA 1YPEH 4IMQA 1MH0A 2GMTC 2XTTB 3MNBA 2PTCE 2YOLA 4F49A 4X8VH 3ZVAA 2STBE 3HK6B 1TQ0B 4AN7A 3BTKE 2O8MA 4UEHH 1O5AB 2EC9H 1C5TA 5AF9H 4DCDA 3DFJA 4D8NA 3QX5H 3DA9B 4MTBA 3VG8A 3BEUA 4RKOB 1TPOA 3MO9A 3TH3H 1EZQA 3N99A 1LHFH 3NK8A 1J17T 1LQDB 5AVDA 2PWXA 5EW2H 3QZQA 4MLFB 1NRRH 1DE7H 3EE7A 3SNCA 2AHME 4XDEA 1QB1A 3IWMA 1D3TB 2BVSH 2OBOA 1ELCA 3SHAH 1EX3A 1C2HA 2ILNA 3OAAD 2CN0H 3SJ8A 3MTYA 4U01A 2JDID 3U8RH 2C8WB 1S82A 3SNDA 1O3KA 1E36B 4FETA 1Y5BT 3N7EA 1BBRH 2OUAA 4K2YA 4B6EA 2JH6D 2Z3CA 1V2QT 1O30A 2BDIA 2XXLA 1XKBC 3SQHE 3UWJH 3SU5A 5LPRA 2L6OA 1GHZA 4IN2A 5L6NH 1ARBA 3SUFA 1TWXB 2RA3A 3DT0H 5LH8A 1CGHA 1LO6A 1KXAA 1O2LA 1GL1A 1TGCA 4I33A 3PO1C 1ELGA 1H8ED 2FYRA 3QZRA 5A0BA 1OP8A 2G8TA 4Q2KA 3E16B 3KYGA 2XWAA 5EG4A 2LNCA 1QURH 1DICA 4BAOB 1MKWK 4Q7ZA 1GVKB 1O3EA 3H7OA 5KECA 2W26A 3RC5A 1Y3XA 1E1QD 2WUBA 1AUTC 2PR3A 5DP5A 4JYTA 2PW8H 3KQCA 4Z0KA 2QC2A 3K9XB 1BIOA 1DDJA 3DUXH 3M5LA 1P57B 3M3TA 1NY22 1CHGA 3PTNA 4CH2B 4FUBA 4FUCA 4ISNA 3TJNA 4ABIA 3PRBA 1PQAA 3V3MA 2JJ1D 1QA7A 1TNLA 1AO5A 4A7IB 3ZZ6A 2GT8A 3DSGA 1O36A 3M7UA 2O8UA 1EFRD 1OS8A 4WF8A 4X1NU 3RXCA 1KSNA 5E0JA 3QWCH 3TNSA 3SU0A 3VB3A 3ZYEA 2A4RA 3KHVA 5E0GA 4B6FA 1V2OT 4XSKU 1TBRH 4YESB 1XM1A 1VGCC 2ODPA 2ZZUH 2BOKA 1Z6JH 3NRLA 1UVUH 3MU1A 1BMNH 3SV2H 3GCOA 2WPKS 3EA8A 5FCKA 3SU2A 4WH8A 1O2PA 1C5LH 1DY9A 1HDTH 5FCRA 2P59A 1DWCH 5FBIA 2EI8A 2ZGHA 1RJXB 4I86A 1F0SA 1Y3VA 3F0PA 1NFWA 2BM2A 1FY5A 4BAQB 4NWLA 3A7VA 3UQOA 3RXDA 1VCPA 1KXDA 5HXFA 2OC0A 1HRTH 3PLPA 1ZTKA 2B0FA 3PB1E 3SQEE 1ARCA 2ZWLH 4RI0A 4TY7A 2Z9JA 1TX6A 1QBOA 1P3CA 1BHXF 1SGIB 1TMTH 1UVSH 1E1RD 1W0YH 1BRBE 4IMZA 4XE4A 3QLPH 4TT3D 4UFFH 1ETRH 4Y11E 2FYQA 3MI4A 1C2LA 2BQ7B 5E2PA 2WPHS 1G3DA 2GDDA 4CR9A 1HBTH 3A7XA 1YPKH 5CDFE 4D7FA 1EAWA 1DVAH 4JK5A 1SHYA 1A3EH 1YPHC 2J5UA 4NIWA 5DP7A 2JJ2D 4E7RG 2IOTA 1IQNA 1TBQH 1D6RA 2HRVA 3FO8D 3P8NA 1A4WH 4AZ2B 5FPTA 2ANKH 1NESE 2FS8A 1NS3A 2FOGA 1GMHF 1ZZZA 1FPCH 2UWLA 3GY7A 4NIVA 1P02A 1ZPBA 1BTXA 3CP7A 1FX0B 2NU2E 4BTIB 3PLBA 1AVWA 3U8TH 6CHAC 2BX3A 1GMHG 1MTVA 4YOIA 8ESTE 2VVUA 1YGCH 1U6QA 1O3PB 1LHEH 1GGDB 5C0TA 3W94A 1HXFH 1ELFA 5AFZH 4IGDA 2A1DB 1LPGB 3OFND 1EAXA 1A61H 1QQ4A 1C5YB 5CHAB 4LZ1H 2EEKA 2TRMA 2FLRH 3TGJE 1ANEA 2WPIS 4I8JA 5EXNA 5JB9S 2HLDD 4MNYA 2ZDNA 3A89A 2BD9A 1RTKA 3SJKA 3MQKC 3LH3A 5EPYA 4E05H 4YM9A 1W8BH 3I77A 1HAVA 4SGAE 5GCHF 3MU4A 4MG3A 1C5VA 2LELA 1QY6A 2VH0A 1AHTH 1WOFA 1PYTC 4ESTE 2O8LA 3AASA 3RXBA 2Y81A 1GBBA 5FPSA 1AVXA 1HAVB 1HIAA 1O2MA 1TGBA 3F6UH 5GCHG 1KTSB 2ZCLP 1D6WA 1O3NA 4CH8B 1SOTA 1W0KD 3OEHD 4Y10E 1RS0A 2FODA 3BF6H 2ZPRA 2BDBA 1O2SA 5HM2A 5DSFA 1HIAB 5TCCA 1GL0E 3LGTA 1C1TA 1LDTT 3GDVA 2OBQA 1K28D 2GV6A 1WTHD 1G9IE 3ATIA 1M9UA 3BIUH 2GGVB 3K6ZA 1C5WB 5HIZA 5GXPA 2GTBA 3M3SA 2BMGB 3SW2B 3EDXB 2BDAA 2VBCA 3QTVH 1V2TT 4ASUD 3SHCH 2VVCA 3KIDU 1FQ3A 4I8HA 2XNIA 4UD9H 4AFSA 1O2WA 2R3UA 1FY8E 1IHTH 5DP8A 3ZZDA 4B75A 2STAE 3TGKE 1EAUA 1SPJA 4U30A 1NRPH 5EXLA 1A7SA 3A83A 1O3BA 3SU6A 2A32A 3MU8A 2QYIA 1BBRK 3UUZA 2P93A 1EPTC 1IAUA 1ABJH 1SHHB 3GYMA 4LK4A 3NZIA 2V3MA 3Q77A 4MNXA 4RT1A 3SNAA 1EOLA 3KQ5A 2FOHA 3GCHC 1O5CB 4WVPE 3V13A 3V7TA 2FLBH 6GCHF 1MTWA 1C5RA 2A2QH 2AMDA 1MKXK 5K7RA 1K1JA 2GZ9A 2CK3D 2OC8A 1P2MA 2ZIQH 1WAYB 3M5OA 2FOMB 1XXFA 4ABDA 2NU3E 6GCHG 4Y8XA 2L74A 1TQ7B 4GSOA 2Z3EA 2A2XH 3PMJA 3M7TA 5C94A 1O2TA 1GJAB 4ISLA 3DHKH 4F55A 5C2ZA 1GHXH 1HAYB 2NU4E 3E6PH 1SBWA 4K5ZA 1QRZA 1C1QA 1GVZA 1C2MA 2YNAA 4JCNA 1MCVA 2A7HA 1SL3A 4E06H 1G2LA 1K22H 4O3UA 1O2VA 3RXJA 1K1MA 1QFKH 4CBNA 2RDEA 3KCGH 4AB8A 1AB9C 1OPHB 5E8EH 1O5FH 2R0KA 5EJ1A 2H1UA 1YPGH 1H8DH 3U28C 1F2SE 5ESBA 2QA9E 1O2GH 4I8GA 3RU4T 4BANB 3GY2A 5GNDA 3RC4A 2BYAX 3ZZ4A 3U9AH 2A0QB 3UOUA 5BRRE 2RA0A 1JOUB 3QDZB 3CNRA 4NSYA 4XFQA 2TGTA 1UVPA 3WWFA 4LZ4B 2ZP0H 5T6DA 5LPEA 1O3GA 1TMBH 2TGAA 4X6OA 1HJAB 3GYLB 3T5FH 1JRTA 1GDUA 2PV9B 4A1VA 4X0WU 2BB4A 1ZSLA 1SB1H 2BQWB 1AQ7A 1T31A 1GI7B 1CO7E 1MKWH 3MO6A 1QCPA 1THSH 4KTCA 3EGKH 4JZIA 1MCTA 2F83A 1G30B 4HGCA 1V2ST 1IQJA 1OXGA 1DY8A 2ZFTA 1AD8H 1ZHRA 3EYDA 2G5VA 5ETXA 1T7CA 4NIXA 1XUHA 1IQFA 2P16A 1GVLA 3A7TA 1SSXA 5CMXH 4OS2A 5AFYH 3FANA 2V6NA 2YMSB 1XX9A 2Z94A 3VFEA 3K2UA 1AGJA 2XWBI 3O8BA 5GJ4B 1PQ5A 3LOXA 1UW7A 1WU1A 2G52A 2AGGX 2IN2A 3LJJA 3RXTA 1KDQA 2KR7A 1XVOA 3QK1A 1BRAA 1GBAA 2NWNA 2ZHFH 3MFJA 3EE0B 4FVBA 1FY4A 1GBKA 3RU4D 1AFQC 1C9TA 1FMGA 1YBWA 2R9PA 1P09A 3RXVA 5A0AE 1BT7A 2BD4A 2CGAA 1GI5A 1C2KA 1ORFA 4YZUA 4I8LA 1ZTJA 2IPQX 5EJLA 3BTWE 3MHWU 1VJ9U 2CHAC 1GJ5H 3UAIC 2R2WU 1C1RA 3A81A 5DO4H 1FY3A 1K9OE 3QTOH 3BTQE 1GJ6A 3RLWH 1JMOH 3QUMP 2Z6BD 4MPXA 1ID5H 1T8NA 3VB5A 2Z3DA 2H9HA 3FFGA 3M61U 2QN5T 1MAYA 3GY5A 1V2NT 2H5DA 1BOQA 2GX4A 3PMAB 1XVMA 1P05A 4A1TA 2C3SA 4ZH8A 4MPUA 1TMUH 3BTTE 2XC4A 1O5EH 1PPFE 5F8XA 1V2PT 2VU8E 4TY6A 1DOJA 1DSTA 2ZCKP 3TU7H 1GJDB 1J8AA 3E8LA 1FAKH 1O39A 2A31A 4I31A 1N1LA 1TPPA 3VGCB 1IQHA 1THRH 2H5CA 2W6JD 5IK2D 1ACBE 1RTLA 4RT0A 1A5GH 5EIYA 2J95A 1G3EA 1GCTB 1DLKB 3SGAE 1CU1A 3ESTA 2C93B 2QY0B 2O8TA 5DP9A 1EP6A 3T27A 4AOQA 1E0FD 2J9NA 5H4IB 1WBGB 3SJIA 2P95A 4B2AA 1EJMA 1J15A 1D9IA 1FUJA 1V2JT 2ZQ1A 3F9GA 2FM2A 4FVDA 1SFQB 4YT7H 4R8TB 2P3UB 3WW7A 3ENSB 1KYNA 1O3OA 3GCTF 4ZROA 2ZG0H 1GJ7B 3UWIA 1W13U 1W3CA 1T32A 5C1UA 5DN6D 1BITA 4UFEH 2OC7A 1O3MA 3CENA 1HAHH 3VPKA 5EQRA 4RKJB 4DOQA 2P8OC 1LQEA 3BTHE 5F6MA 1H1BA 1TIOA 2XRCA 1A1RA 4IS5A 1OP2A 3GCTG 2J34A 1ELBA 4NA7A 1S5SA 2OTVA 1MBQA 3RM2H 5ESTE 4D9RA 3DD2H 2VWMA 2ULLA 2Z9IA 3AW1A 2OLGA 2VGCC 4PROA 1G3BA 4Y71A 1C5PA 4MVNA 2QXIA 1YWUA 1ELEE 1VCWA 2SGAA 1QJ7B 1ZYOA 5JPMH 2OINA 3QGNB 3UOPA 2LPRA 1FI8A 4OGYA 3RMNH 1LVOA 1TPSA 3E1XB 1Q2WA 3RMMH 3SUGA 1E37B 3UR6A 3AAUA 1NBME 4NZLA 1F0UA 2VVVA 4JZDH 4TSFD 1Y5UT 3KGPA 1TPAE 3F1SB 4XBCA 2ZO3H 2SFAA 5C1YA 2WPDD 1C2IA 1GHWH 1GG6C 1MTNB 1GHVH 1YKTA 2PLXA 3NXPA 3M36A 3A7YA 3PLKA 1G32B 4HFPB 2ZGBH 4H6TA 1S6FA 2ZDMA 4ISIH 4JYVH 4AC9A 3EQ0H 1TRMA 3PWBA 1SGPE 2XYAA 2ZHWH 2C8XB 2SNWA 1OWJA 4FUHA 1TA2A 1A46H 5A2MH 2ANYA 3OY6U 1O3HA 2ZDLA 1YC0A 2OK5A 1UTJA 4CRDA 2FXRA 2BHGA 2FI5E 1L1NA 2CXVA 4CHAC 2AIQA 1MABB 1OWIA 1LVBA 2QXJA 4WWYA 3RXOA 1K1LA 2JETB 3BTDE 1BBRE 3OYPA 4UFDH 4BAKB 2V3OH 3N7DA 1HPGA 1UTQA 1GJCB 2Q6DA 1SQRA 2F91A 3BG8A 3FZZA 3MNSA 1PJPA 1OWKA 3E90B 1HNEE 1YLNA 4K3JA 2UWPA 3A85A 2Y7ZA 4AGJA 2D8WA 1MKXH 1AWFH 3BG4C 1UVOA 3V0XA 2ZU3A 3OSYA 1HAIH 2G5NA 1NZQH 1AZZA 1H9IE 3LC5A 2GKVE 3ZIAD 1NFYA 3A8DA 4UE7H 3RM0H 4BTUB 4Q7XA 2HNTC 1DS2E 2R2MB 1LHDH 1BTWA 1DT2A 1ETSH 1C1SA 4X8TH 2BY6X 4K1SA 4ZHMU 1MBMA 2ZTYA 3M37A 3TGIE 1FAXA 4BAMB 1BHXB 1FN6A 3MNXA 1GBFA 4Y7BA 4B76A 4GPGA 1RXPA 1K21H 4U2WA 1ZPCA 2W6ID 1SI5H 1T4UH 4WXIA 1GI8B 2VNTA 1WUNH 1SGEE 1FONA 4A1XA 4NFFA 2BQ6B 4CBOA 1SGRE 1PPEE 2ODYB 1G2MA 1C1OA 1C4U2 3RXGA 4K8YA 5E0HA 2HPQH 1GBHA 3MH7A 2PSXA 3U69H 1SGCA 1NFUA 1NRQH 2ZGJA 2TIOA 2BD3A 1QL9A 1GWAA 3I78A 3SZEA 6LPRA 1MZAA 1O5DH 1W0ZU 1P8VC 1V2WT 1BTZA 2B8OH 1OWEA 3MU0A 5A0CA 3NPSA 2BXTH 1N6XA 1J16A 3RXKA 3K6YA 4I8KA 2PHBA 4ABBA 4O03A 4CR5A 1D3PB 3PTBA 1ANDA 2ZTZA 2GJGA 3KN2A 1GMDF 3KYFA 1QRWA 3TNTA 1ESTA 5T6GA 3ZZ8A 2XBWA 2FZZA 2VWOA 2AGEX 1EZUC 4K8BA 2I6QA 3O8RA 1FV9A 1PPGE 1GMDG 1PYTD 2HGTH 1VCQA 2BXUH 1ELDE 1OP0A 4IC6A 1UTKA 1BMLA 2O8WA 4DJZB 1W11U 2EQNA 3LPRA 1ZHPA 2ZI2H 1K0HA 1E34B 2H2ZA 1FZZA 2R3YA 5JBTA 4X8UH 5FX6A 1SGDE 1GDNA 2J4IA 3OU0A 4YT6H 3TITA 3ZVDA 1FXYA 1MAXA 4CRCA 1Y3YA 1O2HA 1TNKA 4RN6A 1AUJA 1F5LA 4LOYH 1HAPH 3ZZ5A 4TPYA 1VITF 3MMGA 4D76A 2FTMA 1HB0B 2A4QA 2GVFA 8GCHF 4OS4A 5E2OA 5FXLA 2F9OA 1VITG 1GPZA 1KIGH 1RFNA 3GDUA 1H8IH 4KGAA 3TJUA 3S9CA 1INCA 1HYLA 1O3LA 2XBVA 8GCHG 2V7QD 3P8GA 1CVWH 1DWDH 1BB0B 2K0QA 1IQKA 4MQAA 1O3DA 2ZU1A 5C17A 1IQIA 4K1EA 2ALVA 2PKSB 2H9TH 1HFDA 1AU8A 1RIWC 1F92A 2WZQA 5T3HA 1XUKA 1P2NA 1QL8A 2A7JA 1TX8A 1KXFA 4FUIA 1Z1IA 1E38B 4MDSA 1NM6A 1O3JA 1P3EA 5FBEA 2BLQA 4BXSA 1DSUA 3BTEE 3NUMA 4YTAA 1CA8B 1FNIA 1DM4B 1SG8B 1Z8IB 3ELAH 1HXEH 1QQUA 1ZGIA 1SOZA 1AVGH 1O2XA 1O2OA 4Y0ZE 2BY8X 2A5AA 1G36A 2OQUA 2XBYA 4BXWA 5C3NA 3U98H 1KXBA 3L3TA 1FIWA 1F5KU 4AYYB 3R3GB 1CGIE 2KCYA 3OE7D 1CA0B 4ABJA 3Q3YA 4QT8C 3VB7A 1AZ8A 3L33A 2CF8H 8LPRA 4ACAA 1T4VH 4K69A 3IG6B 2ZU2A 3AK5A 1TE0A 3SOSA 1K1NA 1O34A 3BIVH 2DUCA 3KQBA 2W7SA 3PYHA 3SGBE 1IQMA 2Q1JA 2ZU4A 3VXFH 1D4PB 5GDSH 4B71A 1NC6A 1C2GA 4FUFA 1OX1A 1HUTH 1TGNA 2J97A 1FLEE 1ZMNA 1HGTH 1CGJE 1ZMJA 3L6PA 2WV9A 2BDHA 1O3CA 2GCTB 3RXFA 3GY8A 2P3FH 5DG6A 5F53A 4FU8A 5T6FA 2F9BH 3F9EA 1G37A 1HJ9A 4B74A 1TNJA 1GBLA 2W3KA 1CBWB 1Z6EA 2I6SA 1ZRKA 1Z8RA 3UFAA 3Q3KA 1P2IA 3UQVA 1C5MD 4B1TA 1GI1A 3RC6A 1QL7A 4UDWH 1N8OB 1V2MT 3RXMA 2O9QA 1YM0A 2AH4X 3URDA 4FUEA 3SUDA 1O2UA 1UMAH 1C1VH 3ATWA 1A0JA 1HCGA 1AKSA 1XUFA 4ZAEA 3ZYDA 5L30H 2GT7A 1JBUH 1P9UA 5GWZA 1JWTA 4DT4A 5EW1H 5C0UA 3FAOA 1B0FA 5JB8S 1TBZH 4HG6A 4H6SB 3SJ9A 3ZV8A 5JBCS 3EA7A 4CRAA 4IW4E 4AB9A 2HVYB 3SGQE 2G55A 1C5QA 2ALPA 2OXSA 1CE5A 1JIRA 2FOAA 3BV9B 4RSPA 2J92A 4XOJA 1SQTA 1BA8B 1NRNH 3E3TA 1NU9A 4NFEA 1WQSA 1FJSA 1O2IA 3GY6A 1F7ZA 4JZEH 4VGCB 4YLUA 3HGPA 3PM3A 1QA0A 1K1PA 2ZFRH 3QO6A 1S84A 1O3IA 3PMHB 1QNJA 1C2FA 3O8CA 2BDGA 2UUJB 3E0NB 1S0RA 2ZFPH 5EQSA 2VIPA 3MOCA 5A8XA 2GMTB 2ESTE 1QB6A 1OHHD 3RXQA 1WSSH 2G4TA 3MH6A 4JZ1A 4X6PA 2G00A 1A2CH 2ZFQH 1ESAA 2BZ6H 2XBXA 3A80A 4F48B 1SLXB 2BX4A 2FS9A 3PV2A 3ZZAA 3QN7A 1Y8TA 1BDAA 1NPMA 2B7DH 4ABEA 1EOJA 1IOEA 2ZTXA 1BRCE 1GBIA 3C1KA 3RXLA 1QHRB 1VKYA 5G4BA 2XW9A 1Q31A 3DSPA 3RXEA 1P01A 5C67A 1IHSH 4YXWD 2OCVB 5HIYA 1BTHH 1YPLH 4INLA 3DSOA 2KCPA 3LIWA 1HAOH 1TA6A 4K1TA 4B2CA 1O2JA 5DP6A 3WY8A 2ZA5A 4DY7B 2LP6A 1OYQA 1P12E 4MNVA 1W10U 5TJXA 2FX4A 1Y3WA 1YP9A 3VEQB 3QGJA 2ZFFH 3JZ2B 3LGIA 1CT4E 1SLUB 1KXCA 3T29A 3ODDA 1QJ6B 1S6HA 4AFUA 1YCPM 3RXUA 1MTSA 2PP6A 4M7GA 4TWWA 2FPZA 3A8CA 3PV4A 1ZGVA 3W1EA 1GGDC 3HKJB 4FUGA 4IBLH 3OY5U 1KDQB 1K1IA 1XMNB 2W5EA 1IQEA 1TABE 4ZCNA 1O33A 1ZPZA 2WINI 3Q00A 4Z6AH 3PO1B 2J2UA 1IQGA 4NZQA 4SGBE 7KMEH 4U32A 1J9CH 5CHAC 2XC0A 2BY7X 5SGAE 2GV7A 1LHCH 1C1WH 7GCHF 3PV5A 1C5ZB 4CREA 3ZV9A 1DLEA 3F68H 1L4ZA 1W14U 2M2AA 3RLYH 4ZXYH 5A8ZA 7GCHG 1GBTA 1GI0A 3ATKA 3KQDA 3BTGE 2QXHA 3FP8E 2VH6A 3SNEA 3M5MA 1YPMH 3I29A 2JIZD 3SYJA 1SLWB 5T1VA 1H4WA 3R0FA 5LGOA 1UTLM 1Z1JA 2ZHEH 2GDEH 4GHTA 1Y5AT 3H5CB 1UTPA 4Z1MD 3FZDA 3IITA 5LPFA 3PWCA 2OP9A 2Y5FA 3BEIB 1O37A 4JZFH 2D1JA 1BJUA 3ITIA 5JBBS 1EB1H 2BDYA 1WQVH 1V3XA 1QTFA 1VGCB 4GUXA 2QF3A 4D7GA 1WV7H 3P6ZB 4X6NA 4WMDA 2FEQH 2GCHF 4X2XA 2Z9KA 1YLCA 5I46H 5EXMA 2AEIH 1O2YA 1NU7B 1O0DH 5AHGH 1BCUH 4YO9A 3HKIB 4OGXA 3FN8A 1S6LA 1FY1A 1NT1A 3JZ1B 3MO3A 3SV6A 2SGFE 3P17H 4OM9A 2GCHG 4H42U 2EA3A 2FO9A 1ZJKA 2PSYA 3SN8A 4DVAU 3S69A 3K65B 5F8TA 2WYGA 2NU0E 2DE8A 4XBBA 3RDZA 1CT0E 1P2OA 5IYTA 1JIMA 1HLTH 2PUXB 2HNTF 2QAAA 4WXVA 3C27B 1C2DA 1DPOA 3RUOA 4CRFA 2R0LA 2QF0A 4BAHB 2PFEA 3S7KB 1EZXC 1DXWA 5HM9A 2CJIA 3WWBA 1J14A 2FESH 1E79D 4I32A 3EAJA 3MH5A 5J4QA 1L2EA 1ANBA 2ZNKH 2ZDAH 5C5NA 1V2VT 1QIXB 3SBKA 1FPHH 3P8FA 5L2ZH 3AVZA 2PKAA 2AERH 2FIRH 5TCAA 1P2QA 2Y6TA 3F0OA 1C4V2 2KX4A 2SNVA 2BLVA 1QRXA 2IJD1 4X1PU 1SR5C 4D9QA 3TJVA 1RRKA 2H9EH 2KCAA 2PKAB 1TOMH 2G51A 1ELVA 2YMSD 3D65E 4JK6A 3F9HA 5F8ZA 4E7NA 2V0BA 1PFXC 1OKXA 2BOHB 3DCLA 2OD3B 3Q76A 5C5OA 2EI6A 1BMMH 1XKAC 2A5KA 4JYUH 5I25A 1KY9A 3RXAA 1K1OA 2AIPA 2TBSA 1GBMA 1SFIA 3KEEA 2SGEE 3NCLA 4HTCH 3AW0A 1P11E 1P04A 6CHAB 3U1IB 2BLWA 2B5TB 2M5TA 4Y79A 1G3CA 1LMWB 4AGKA 3SO3A 2BVRH 3B8JA 2SGPE 1Y59T 1MD7A 1SQAA 4WMEA 1CHOF 2FOCA 4X1SU 3P70B 2HPPH 2HALA 3UPEA 3BTME 5EOKA 3FKSD 4INHA 1LKAA 4KELA 9LPRA 1GJ4H 1W7XH 3PROA 3MU5A 1S83A 4YLQH 3BSQA 3S9AA 2VIWA 1SC8U 1TNGA 2FI3E 1COWD 3LT3A 1CHOG 4ABHA 1ETTH 4UONA 1C1NA 2WYJA 1O2RA 2DE9A 3TK5A 1EUFA 1LVYA 4AG2A 1HJAC 1B5GH 4OS6A 1L1GA
chains in the Genus database with same CATH topology
3A82A 4O9VA 1FDPA 4Y76A 3MNCA 2BD8A 4HZHA 2KAIA 4Q80A 1TONA 2Q6GA 4AFZA 1NROH 1RTFB 4JMYA 2HVXA 2CF9H 4FUJA 2RCEA 1SGFA 1EJNA 1W12U 2HLCA 1VITH 1Z8GA 2KAIB 1PPZA 1B0EA 1ZLRA 1EP5A 2ZF0H 1O5GH 3KNXA 3LGVA 1OSSA 2PGQB 2BTCE 1Z71A 1AY6H 4NWKA 5C20A 1ZMLA 3ZVEA 4BTTB 2J38A 1LTOA 3MWIU 2XC5A 3STJA 2UUYA 2Q6FA 3FP6E 1QB9A 3LONA 2A4GA 1AN1E 2WUCA 4ISHH 1GDQA 2FI4E 4DIHH 1EPTA 3B9FH 4O97A 4BNRA 3NWUA 1UCYK 4OS5A 1A5HA 2OC1A 4ASHA 1S85A 3SNBA 1ELTA 2CV3A 3SUEA 1GBDA 1EPTB 3ODFA 4OS7A 3A86A 2PUQH 3CS0A 2BY9X 1C5NH 5K0HA 1BQYA 4FXGH 4INKA 3A7ZA 3GCHB 3T25A 5EU8A 1DXPA 1CQQA 4GAWA 2BZAA 3KF2A 1EJAA 3TPIZ 1SMFE 1LPKB 3LDXH 1T8OA 2WPMS 1ZR0A 1JRSA 4AORA 4WMFA 5L2YH 2BD2A 1O5BB 3TH2H 2TGDA 3AAVA 5EODA 4UFGH 3URCA 3NKKA 3LGWA 1ZOMA 5F03A 1DUEA 4ZMAH 1O35A 3TK9A 5GPIB 3HPTB 3SV8A 4GLYA 4A6LA 2ZGCA 2ZECA 5DK1A 1SGFG 4B73A 4FUDA 3VGCC 2A5IA 2ZC9H 4DW2U 1V2KT 3GICB 1AB9B 1P0SH 3O8DA 1C1PA 1WCZA 2F9VA 2P94A 4A5TS 5EPNA 3ATLA 3TJOA 2RDLA 1GCTC 4TWYA 2Y7XA 1RGQA 3KQEA 2AGIX 2C8ZB 3S9BA 1EXFA 5EQQA 1EATA 3MYWA 1L1JA 2ANMH 5A09A 8KME2 3SU3A 4ZKOU 4THNH 1ANCA 1FIZA 1O3AA 1WTGH 3T2NA 3GCNA 2QIQA 4ZKSU 1TGTA 1OOKB 1ZRBA 1LHGH 3FVFB 2IJOB 3A87A 2BD5A 2ODQA 3P8OA 1GHBF 1MTUA 2FX6A 1TOCB 5GIBA 3UY9A 3MH4A 1SGNE 1AWHB 2FWWA 1THPB 1GI6A 1DANH 1PQ8A 1TNHA 2JH0D 3TLOA 2FMJA 4CRGA 1GHBG 4X1QU 1GHAF 1HV7A 3KL6A 2GZ7A 1MUEB 2ZEBA 3RXPA 1PPCE 4IC5A 2G4UA 3A8BA 2FOFA 1ESBA 1GMCF 3H7TA 5C1XA 1SLVB 1GHAG 2A4OA 1ZTLA 5DKMA 2BY5X 1QGFA 4AX9H 5PTPA 1LKBA 1TLDA 2Z9GA 2HWLB 1GMCG 1ZJDA 1EAIA 3LU9B 1T8MA 2SGDE 3ZZBA 2F9PA 3OTJE 1OYTH 2H6MA 4J2YB 1AFQB 4MNWA 1L0ZA 3V12A 2ZPQA 1F0RA 1TALA 2SGQE 2W7UA 2XCFA 1MTNC 2ASUB 3M5NA 5A8YA 3LKWA 1TFXA 1S81A 1XUGA 3VB4A 3U1JB 4FU7A 1DUAA 3GISB 4X6MA 2CHAB 3E0PB 1O38A 4WH6A 1TRNA 4ABAA 2GP9B 1X7AC 4CRBA 1GI4A 1GJ8B 1YCPK 4NA8A 2VB0A 5DPAA 4YOJA 4NCYA 4R0IA 1A3BH 4KP0A 1TX7A 1H9HE 5DP4A 1QJ1B 1HJ8A 2ZDVH 3T26A 5FAHA 3F9FA 3ZVGA 2JETC 3RU4E 1O32A 2QV1A 1GBCA 1MU8B 1B7XB 1D3DB 3ZVCA 1HAZB 1LPZB 5JYIA 1BMAA 3M3VA 1C1MA 5J4SA 1W2KH 3RXHA 1EASA 1O2QA 2FOEA 2ZGXH 2AS9A 2RG3A 3RP2A 1F0TA 4A92A 5FPYA 2WV5A 4KTUA 3VB6A 1S0QA 3LH1A 1OWDA 4NSVA 5HGGA 2C8YB 1DX5M 3TK6A 1XUIA 3LGUA 4H4FA 1O2KA 4Y8ZA 1SGQE 1GI3A 3GY4A 3ZZ9A 1GBEA 3DFLA 3BTFE 4GVUA 2G81E 1O31A 1BZXE 1YPJH 4DGJA 1O3FA 2XCNA 3SJOA 1BJVA 1KLIH 1D3QB 3W95A 1GHYH 1QR3E 3RMOH 3LC3A 2F9UA 1ZSKA 1MU6B 1AKSB 1XUJA 2BDCA 3A8AA 4GCHF 1VZQH 1C2EA 1P03A 1V2UT 1A0LA 3HK3B 3T62A 1E35B 1EKBB 4AG1A 1V2LT 4WY3A 4X2WA 1UTMA 2VJ1A 2P8OB 4GCHG 4DG4A 2ANWA 4NIYA 3GDSA 4TPIZ 2FTLE 2GD4B 4NA9H 2PTNA 5HYOA 2EI7A 3GY3A 3UREA 2YNBA 3SU1A 3PMBB 1KLTA 2VGCB 1GCDA 2Y5GA 2PGBB 4ZHAA 2V3HH 1MZDA 1HAXB 1FN8A 1AE8H 2AFQB 1DITH 5BPEA 6ESTA 5IDKA 3ATMA 3SV9A 1CT2E 4ABGA 1PPBH 1C2JA 4Y8YA 1A5IA 1ABIH 1P10A 1XXDA 2Y82A 1BUIA 5DP3A 3UTUH 3SI3H 2AMPA 1NN6A 2VINA 3A84A 4DIIH 1UTOA 5HMAA 4FU9A 1Q3XA 2QCYA 1OWHA 2ZKSA 4Q7YA 2THFB 1GG6B 4Y0YE 1NFXA 1MD8A 4F4OC 4ZXXH 1SGYE 1BRUP 2W3IA 1VJAU 2QXGA 2TGPZ 5ABWA 1EQ9A 1ZHMA 3S7HB 3P95A 2FDAA 1ELAA 1O2NA 2ZCHP 3VXEH 1HAGE 3SV7A 2HNTE 3HATH 4ISOA 1C1UH 1KTTB 4B2BA 3Q3XA 1NO9H 4X2VA 4LXBH 2F3CE 2ZPSA 4CHAB 3UNSA 1K2I1 1UCYH 1Y3UA 1UCYE 2F9NA 2VIQA 2Z7FE 5DJ7A 4KTSA 2NU1E 3A7WA 3BEFB 3BN9A 1TGSZ 2A45B 2V35A 1GBJA 2JKHA 4DURA 1V2RT 1ZSJA 1MQ6A 3M35A 1RD3B 1DWEH 2PKSC 2Y80A 4ZHLU 1JXPA 1UTNA 3UNQA 4Y6DA 1QBNA 3CS7A 1NTPA 2WV4A 3BG4B 4HI3A 2AYWA 2VIVA 1BTPA 1H9LB 3ZZ7A 1WYKA 3RXSA 3P92A 1P06A 1C5OH 1DWBH 1YF4A 2JH5D 3GOVB 3HGNA 4AYVB 2UUFB 1A0HB 1UO6A 5JBAS 5FHTA 2CMYA 5JDUB 1DFPA 4DT7B 3EA9A 2VWLA 3M7QA 1MMJN 1TAWA 4X1RU 1YYY1 4I7YH 2VWNA 3UNRA 3U8OH 3E91A 1UK4A 4TYDA 1CA0C 2TPIZ 4YOGA 3ZVBA 7LPRA 1W7GH 5DGJA 2C90B 1PQ7A 4ZKNU 4AFQA 1SGTA 3ZVFA 1TNIA 7ESTE 2OQ5A 4K60A 2Y5HA 5EGMA 3TVJB 4NG9H 4X8SH 1GI9B 3SI4H 1SQOA 1L4DA 1UK3A 3TIUA 1C9PA 1EZSC 3OX7U 3D23A 2D26C 4WJG2 1IQLA 2BD7A 1TB6H 4Y7AA 1V6DA 2FOBA 1TRYA 1T8LA 2C4FH 2D2DA 2ZFSA 1AE5A 1YPHE 2IPHA 2P3TB 3LGYA 3UIRA 2GCTC 1AFEH 3A88A 1PPHE 2J94A 3RXIA 2VIDA 1CBWC 4IN1A 4MPVA 2Z9LA 4X2YA 3T28A 4J1YA 3STIA 2UWOA 1VR1H 3SZNA 4BOHA 1N8OC 4ZKRU 1F5RA 1C5XB 3S0NA 4GHQA 2QGRA 1P2JA 1EB2A 4NGAH 1NRSH 3ZZCA 3D49H 1UK2A 4OS1A 2BVXH 1UJ1A 4MPWA 9ESTA 2K1QA 1C5UA 2GZ8A 1P9SA 3N7OA 2WPJS 3RXRA 1KXEA 1LVMA 1CSOE 3SU4A 1AIXH 1Z8JB 1LCYA 2WPLS 3LJOA 1KLJH 2BLOA 1BTYA 1QBVH 1GJ9B 4ABFA 1GI2A 1C5SA 1Z7KA 4XBDA 1TYNA 2ZDKA 1N6YA 2FP7B 4KKDA 1C4Y2 1P2KA 1UVTH 5CE1A 3SORA 4VGCC 5FX5A 1YCPH 1UHBA 1YLDA 2ZHQH 3FP7E 1MQ5A 3B23B 3G01A 2VIOA 1O2ZA 2B9LA 3ZZ3A 2ZQ2A 1BTUA 1AMHA 2ZU5A 1GJBB 3TH4H 3RMLH 2HOBA 4O3TA 2A7CA 1SVPA 3D62A 5B6OA 1AI8H 1RIWB 3UR9A 1UHBB 2AMQA 2UUKB 2ZHDA 4ZUHA 1YPEH 4IMQA 1MH0A 2GMTC 2XTTB 3MNBA 2PTCE 2YOLA 4F49A 4X8VH 3ZVAA 2STBE 3HK6B 1TQ0B 4AN7A 3BTKE 2O8MA 4UEHH 1O5AB 2EC9H 1C5TA 5AF9H 4DCDA 3DFJA 4D8NA 3QX5H 3DA9B 4MTBA 3BEUA 4RKOB 1TPOA 3MO9A 3TH3H 1EZQA 1LHFH 3NK8A 1J17T 1LQDB 5AVDA 2PWXA 5EW2H 3QZQA 4MLFB 1NRRH 1DE7H 3SNCA 4XDEA 1QB1A 3IWMA 1D3TB 2BVSH 2OBOA 1ELCA 3SHAH 1EX3A 1C2HA 2ILNA 2CN0H 3SJ8A 3MTYA 4U01A 3U8RH 2C8WB 1S82A 3SNDA 1O3KA 1E36B 1Y5BT 1BBRH 2OUAA 4K2YA 2JH6D 2Z3CA 1V2QT 1O30A 2BDIA 2XXLA 1XKBC 3SQHE 3UWJH 3SU5A 5LPRA 5L6NH 1GHZA 4IN2A 1ARBA 3SUFA 1TWXB 2RA3A 3DT0H 5LH8A 1CGHA 1LO6A 1KXAA 1O2LA 1GL1A 1TGCA 4I33A 3PO1C 1ELGA 2FYRA 3QZRA 5A0BA 1OP8A 2G8TA 4Q2KA 3E16B 2XWAA 5EG4A 2LNCA 1QURH 1DICA 4BAOB 1MKWK 4Q7ZA 1GVKB 1O3EA 3H7OA 2W26A 3RC5A 1Y3XA 2WUBA 1AUTC 2PR3A 5DP5A 4JYTA 2PW8H 3KQCA 4Z0KA 2QC2A 3K9XB 1BIOA 1DDJA 3DUXH 3M5LA 1P57B 3M3TA 1NY22 1CHGA 3PTNA 4CH2B 4FUBA 4FUCA 4ISNA 3TJNA 4ABIA 1PQAA 3V3MA 1QA7A 1TNLA 1AO5A 4A7IB 3ZZ6A 2GT8A 1O36A 3M7UA 2O8UA 1OS8A 4WF8A 4X1NU 3RXCA 1KSNA 5E0JA 3QWCH 3TNSA 3SU0A 3VB3A 3ZYEA 2A4RA 3KHVA 5E0GA 1V2OT 4XSKU 1TBRH 4YESB 1XM1A 1VGCC 2ODPA 2ZZUH 2BOKA 1Z6JH 1UVUH 3MU1A 1BMNH 3SV2H 3GCOA 2WPKS 3EA8A 5FCKA 3SU2A 4WH8A 1O2PA 1C5LH 1DY9A 1HDTH 5FCRA 2P59A 1DWCH 5FBIA 2EI8A 2ZGHA 1RJXB 1F0SA 1Y3VA 1NFWA 2BM2A 1FY5A 4BAQB 4NWLA 3A7VA 3UQOA 3RXDA 1VCPA 1KXDA 5HXFA 2OC0A 1HRTH 3PLPA 1ZTKA 2B0FA 3PB1E 3SQEE 1ARCA 2ZWLH 4TY7A 2Z9JA 1TX6A 1QBOA 1P3CA 1BHXF 1SGIB 1TMTH 1UVSH 1W0YH 1BRBE 4IMZA 4XE4A 3QLPH 4UFFH 1ETRH 4Y11E 2FYQA 3MI4A 1C2LA 2BQ7B 5E2PA 2WPHS 1G3DA 2GDDA 4CR9A 1HBTH 3A7XA 1YPKH 4D7FA 1EAWA 1DVAH 4JK5A 1SHYA 1A3EH 1YPHC 4NIWA 5DP7A 4E7RG 2IOTA 1IQNA 1TBQH 1D6RA 2HRVA 3P8NA 1A4WH 4AZ2B 5FPTA 2ANKH 1NESE 2FS8A 1NS3A 2FOGA 1GMHF 1ZZZA 1FPCH 2UWLA 3GY7A 4NIVA 1P02A 1ZPBA 1BTXA 3CP7A 2NU2E 4BTIB 3PLBA 1AVWA 3U8TH 6CHAC 2BX3A 1GMHG 1MTVA 4YOIA 8ESTE 2VVUA 1YGCH 1U6QA 1O3PB 1LHEH 1GGDB 3W94A 1HXFH 1ELFA 5AFZH 4IGDA 2A1DB 1LPGB 1EAXA 1A61H 1QQ4A 1C5YB 5CHAB 4LZ1H 2EEKA 2TRMA 2FLRH 3TGJE 1ANEA 2WPIS 4I8JA 5EXNA 5JB9S 4MNYA 2ZDNA 3A89A 2BD9A 1RTKA 3SJKA 3LH3A 5EPYA 4E05H 4YM9A 1W8BH 3I77A 1HAVA 4SGAE 5GCHF 3MU4A 4MG3A 1C5VA 1QY6A 2VH0A 1AHTH 1WOFA 1PYTC 4ESTE 2O8LA 3AASA 3RXBA 2Y81A 1GBBA 5FPSA 1AVXA 1HAVB 1HIAA 1O2MA 1TGBA 3F6UH 5GCHG 1KTSB 2ZCLP 1D6WA 1O3NA 4CH8B 1SOTA 4Y10E 1RS0A 2FODA 3BF6H 2ZPRA 2BDBA 1O2SA 5HM2A 1HIAB 5TCCA 1GL0E 3LGTA 1C1TA 1LDTT 3GDVA 2OBQA 1K28D 2GV6A 1WTHD 1G9IE 3ATIA 1M9UA 3BIUH 2GGVB 3K6ZA 1C5WB 5GXPA 2GTBA 3M3SA 2BMGB 3SW2B 3EDXB 2BDAA 3QTVH 1V2TT 3SHCH 2VVCA 3KIDU 1FQ3A 4I8HA 2XNIA 4UD9H 4AFSA 1O2WA 2R3UA 1FY8E 1IHTH 5DP8A 3ZZDA 4B75A 2STAE 3TGKE 1EAUA 1SPJA 4U30A 1NRPH 5EXLA 1A7SA 3A83A 1O3BA 3SU6A 2A32A 3MU8A 2QYIA 1BBRK 3UUZA 2P93A 1EPTC 1IAUA 1ABJH 1SHHB 3GYMA 4LK4A 3NZIA 3Q77A 4MNXA 3SNAA 1EOLA 2FOHA 3GCHC 1O5CB 4WVPE 3V13A 3V7TA 2FLBH 6GCHF 1MTWA 1C5RA 2A2QH 2AMDA 1MKXK 5K7RA 1K1JA 2GZ9A 2OC8A 1P2MA 2ZIQH 1WAYB 3M5OA 2FOMB 1XXFA 4ABDA 2NU3E 6GCHG 4Y8XA 1TQ7B 4GSOA 2Z3EA 2A2XH 3PMJA 3M7TA 1O2TA 1GJAB 4ISLA 3DHKH 5C2ZA 1GHXH 1HAYB 2NU4E 3E6PH 1SBWA 4K5ZA 1QRZA 1C1QA 1GVZA 1C2MA 2YNAA 4JCNA 1MCVA 2A7HA 1SL3A 4E06H 1G2LA 1K22H 4O3UA 1O2VA 3RXJA 1K1MA 1QFKH 4CBNA 3KCGH 4AB8A 1AB9C 1OPHB