1SFSA

1.07 a crystal structure of an uncharacterized b. stearothermophilus protein
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
213
structure length
213
Chain Sequence
GIWGVDSAQVVTDQLFQCVRTELGYPKFWGRYLSEVPNVSEGLTRDEIVRIRNYGVKVLPIYNAFREAVGYANGQVAARNAVFHARRLGIPKNKLLFANIEDFFAVDAAWIAAWVETLYPTGYRPGLYADPTKGDFAAAYCEAVSRNNQVAVQAVIWSAAPRPGTTKEQKAPRYQPAAPPCSANVWVWQYGRDAEVCPVDTNLADRRLLDFLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.07 A crystal structure of an uncharacterized B. stearothermophilus protein
rcsb
source organism Geobacillus stearothermophilus
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein
total genus 80
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2004-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08924 DUF1906 Domain of unknown function (DUF1906)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1sfsA00
1DWAM 4HA3A 3ALGA 2YLLA 3WY1A 1W9BM 4PMQA 4TVCA 3N18A 2PC8A 4TOQA 2WANA 3AROA 1GOWA 3WL1A 1EO7A 1ZBCA 5DT7A 1JZ3A 3AIQA 4NI3A 2PB1A 3N15A 5DEZA 2VJXA 2ZIDA 3O2LA 4GIAA 1TZ7A 4W8LA 3AS3A 3SCOA 5BYWA 3GH7A 4HPGA 1E6ZA 2WM0A 1OB0A 2AAAA 1E6SM 3WENA 2JEPA 4EK7A 3AYSA 1VFUA 2ZXDA 1D7FA 3ZJ8A 2DDXA 2DH3A 4QCFA 2VT0A 3AXHA 2A3CA 1NWUA 3ARYA 3L4YA 1JGIA 3NSNA 3WH9A 4PUEA 2BS9A 4LYRA 3WFZA 2BY0A 1Q4NX 4JHZA 2WWDA 3PTQA 3ARXA 1OBAA 4JFUA 3VD5A 1QHPA 1CXKA 3NDYA 1CGVA 3CUIA 3F5LA 1C90A 1MQQA 2ZX9A 1E4IA 1Z32X 4AYSA 5CSYA 3B9AA 2ZWZA 3IANA 1UH2A 4UFKA 4LQ1A 1UA7A 3VU2A 1XSKA 3UCQA 4OBSA 2VTFA 2DSVA 4MJ2A 4XUYA 1TA3B 1CNVA 1OINA 1OT2A 2J62A 1UKQA 2ZUWA 3AHZA 4M81A 2X0YA 2XM2A 4J3XA 3S6TA 3EDKA 3NSMA 2B31A 2XVGA 5A6AA 1HKKA 3F5KA 3GDBA 3I3EA 1KQYA 3VGGA 1FP8A 1GVIA 3SUWA 3IJ7A 3ARTA 3WD1A 3D3AA 2AMGA 4AD1A 3KEHA 1J0HA 1B3ZA 1SMAA 2YA2A 3VIHA 3L4XA 1J10A 1XV8A 1GZJA 2UY4A 4UOQA 4AD4A 4X0NA 5GNZA 2NT1A 1UKTA 4JZ5A 3A4AA 3L4WA 1DWGM 5E0CA 2G3IA 5CPTA 3VIIA 2WAGA 3WIJA 4W86A 3HU7A 2CITA 4CU7A 1ZBKA 4W7UA 4KGLA 5A2AA 1JD9A 4JHOA 5ABEA 2E9LA 1V0LA 5TD4A 1WKYA 5BWFA 3RM8A 3OZPA 3PTMA 5HOSA 1EOMA 1E1EA 1U2YA 4CCEA 2XVLA 2FHFA 4AW7A 2YDSA 3EMCA 2J78A 1E0VA 4JKLA 4W8AA 3PTKA 1JD7A 3UR7A 2DGAA 1FHDA 1UR8A 3VKKA 1WP6A 2DSZA 3GH5A 1CXHA 1ZB5A 3EDFA 1HNYA 3WUGA 4CU8A 3VGFA 1QHOA 3JUGA 5CSUA 4KMQA 2CKSA 3MV11 1NWTA 4CCCA 4W93A 1W3HA 4M24A 2JIWA 1JF5A 4BS0A 1CXEA 3T0BA 3AICA 2XUCA 2GK1B 3CHEA 2EQDA 4GI9A 3WDHA 3WNKA 3ARVA 4BZYA 1ODUA 4CUCA 1D3CA 1UWIA 2Q8XA 5HBFA 2RGMA 4ZXLA 3VO0A 3PZGA 3ZJKA 1V6UA 2W61A 3CZJA 5F7UA 4U5IA 1E6RA 1KCLA 1H0IA 2OSXA 4F9DA 3ZJ6A 2VUYA 5CXPA 7TAAA 2EPKX 2J8GA 5HXMA 1HKMA 5M17A 1AQHA 5BXPA 5CZKA 5BXRA 3KL5A 3VIGA 4H41A 3WNOA 1OIMA 2FH6A 1K9EA 3BSHA 1XD1A 3K1DA 4L4OA 1KGUA 2BV9A 3W6MA 1PZ2A 1FOBA 4W89A 3TP4A 3UEQA 4AZIA 1JAEA 3BCFA 3QR3A 1YQ2A 4KH2A 2UY3A 3WF4A 1KWGA 1EGZA 1FH9A 3L4UA 3W27A 1QI4A 4Y7EA 2VQUA 1MWOA 4PMRA 4OOZA 3WDIA 2W91A 1KXQA 1UD3A 3N11A 3E1F1 3VD7A 2VQTA 4CU6A 3MMWA 3DC0A 3TTSA 4J3UA 1D2KA 4UR9A 4C7DA 2PF0A 1ZJAA 5A3HA 2WZIA 9CGTA 3PZ9A 4U5KA 1WDSA 2XIIA 1JFXA 3UR8A 2V3FA 3NUKA 2DIEA 2YOCA 3RCNA 3O6AA 1B90A 4Z2LA 4OZOA 3EDDA 1OGSA 2BY1A 3B9EA 5HPOA 5E9AA 2V38A 2WCAA 2XGIA 1NP0A 2WB5A 3WFLA 2VRJA 2DH2A 2C8NA 3ZQ9A 3SEPA 4JIEA 2OSYA 5EBAA 1WDQA 1VIWA 1HIZA 5GNYA 4HMEA 5I5RA 4W5ZA 1JIBA 4QP0A 1XCWA 1GOKA 3AIVA 3CTTA 1B3YA 1KXVA 2WLZA 4HA4A 4MB1A 1LL7A 1HXJA 1K9FA 3VIFA 1E70M 3VGEA 2WVVA 1ECEA 2BXZA 1U33A 4S3KA 3QHNA 3B8SA 3S2CA 1IV8A 4AZ7A 1P6WA 3W24A 2YBUA 3AIRA 3WNNA 5JIPA 2TAAA 3AMCA 4W84A 4CN4A 1I1WA 1MQPA 1G94A 3W53A 2WMIB 3CUFA 2Z1KA 1XCXA 1JF6A 1CXLA 2DSKA 2W92A 4CVWA 3WDJA 2QPSA 5E70A 1VEPA 1E55A 2X2YA 1XH2A 4ATWA 1E3ZA 5I6SA 1PIFA 2D23A 1JNDA 2GJXB 1V02E 4AEFA 1UWSA 2J7EA 4CKQA 4PCTA 1HJVA 1XH1A 4W8BA 2J77A 1V02A 3CIVA 4AISA 5CPQA 2OSWA 4HOXA 1KR1A 3PZVA 2WW5A 3VMPA 2VZUA 1V03A 4FF5A 1L8NA 2GDUA 5HPCA 1J11A 3CZKA 1R7AA 4A4AA 3U5UA 2EPLX 2JALA 1JZ6A 1MW3A 2XGBA 2WSKA 1XD0A 4PTMA 2D1ZA 1E9LA 3EBVA 4E4PA 1WB0A 3ZSSA 3UETA 3LMYA 4PTXA 2JF7A 4P8WA 4TXEA 3KL3A 5I78A 3RM4A 2XHYA 1FP9A 2O9RA 1CGXA 2EXOA 1H41A 1WPCA 1HJUA 1V0NA 4BQ4A 3AMKA 2D0HA 3W6LA 3WKZA 2CCRA 4PSPA 2DT1A 1JXJA 1LL6A 2QHAA 1B3VA 3FHAA 2EPMX 1WZMA 3ARWA 4X9YA 2ZUTA 5D9OA 3L4VA 1UH3A 4TVDA 4BF7A 1H4PA 3T2QA 1C8XA 2BFGA 2W66A 1UHVA 2C0HA 1OD8A 2ZWYA 1NQ6A 1TFVA 2VX5A 1KR0A 4UFJA 2WVVB 4P7OA 1EDQA 3AXXA 2O92A 4KRUA 3AQUA 2OWXA 4M29A 3DECA 2E0PA 1W32A 3WDQA 3OGVA 4W7WA 2VO5A 1E71M 1W9PA 5GPRA 2GFTA 3AIEA 4D6JA 1NP2A 4MTVA 3G6LA 5LA0A 3N13A 1QW9A 4FLSA 1HVQA 4LXFA 4J28A 1OM0A 4PMVA 4UNIA 1UQZA 3PZIA 1V6WA 1X6NA 3AISA 4AZ5A 2CIPA 2ZUSA 1LF1A 4OBRA 3WF3A 4KWUA 1QNRA 4HZ7A 4M1RA 3PZTA 4IISA 1BSIA 3WUBA 1AMYA 3GXFA 4U3AA 2G4FA 1KFWA 1UWRA 1WDRA 4P7NA 2DSWA 1TG7A 4PMNA 1NM9A 1VEMA 1M04A 1BTCA 3WD2A 1UR9A 5CLTA 2J7DA 5A2CA 2V5CA 5BRPA 1Q6DA 1K6AA 1E3XA 1UZ4A 4PBGA 5LA2A 1B3XA 4MJ4A 5BXTA 3BAYA 1JI1A 1I1XA 1HKIA 3BLPX 4V27A 2JIEA 3ZR6A 5M03A 1J0JA 1VFMA 4WSKA 2DQXA 2XVNA 2IXVA 5AY7A 1VFFA 3MMDA 1H11A 3OLGA 5ABHA 3NYDA 3AOFA 2V3EA 4YHEA 2Y24A 3VM7A 4UQDA 1JYNA 2GJPA 5M5DA 3CGTA 4MNLA 2WCSA 1MQRA 2GVYA 2ZXBA 1GNXA 1CYGA 3THDA 4WKHA 3B9DA 1V0KA 2E9BA 1GHSA 4EKJA 3LPPA 1BYAA 2CBIA 3APGA 1QHZA 1W1VA 3BAKA 1BPLB 4LX4A 1Q6GA 4TUFA 2NSXA 3WBEA 2VX6A 4IPLA 2CBVA 2GJRA 4GI6A 3LPFA 4B9ZA 4CVUA 4URIA 1ISWA 8A3HA 5D8ZA 1HJQA 2VL4A 3KZSA 2PI6A 1HF6A 3GBEA 1MFVA 1EH9A 1HL9A 2Z1SA 5BXSA 4CN6A 2PWFA 1BAGA 1JDDA 4P8UA 3VMOA 1J0ZA 4RE4A 4DM1A 3TTYA 3WL0A 1DHKA 3DYMA 4D6CA 2PWGA 2D24A 4ZFMA 3WF2A 1TVNA 3W82A 2PBGA 4UZSA 2BHZA 2WHMA 1E6QM 3I3BA 2WCGA 4KRTA 5A6SA 1WAWA 2BVDA 3RJXA 4UQ9A 1VJZA 1TA3A 1KBKA 2J7HA 3CUHA 1EQPA 1LWHA 4ATDA 3MSDA 2WVUA 4HMCA 2VCBA 3OG2A 2WMJA 5AC4A 4BCEA 3W37A 3UERA 3N1AA 4JKKA 2YLAA 3WBAA 1MXDA 5HDRA 3RPMA 1U30A 4D72A 3U7BA 4ACYA 1UKOA 4J3SA 1F4HA 3OLDA 4W85A 3AS1A 3NJ3A 3TTQA 1QI2A 3ZR5A 3GYCA 3SUVA 4HU8A 4MB5A 4D6DA 3OB8A 4MB3A 2J8FA 1V3KA 3VX0A 1CLVA 2VZSA 4UFIA 4MNMA 2WLYA 2WSPA 2XFRA 3TONA 2CNCA 2OWCA 3RMEA 5BCAA 1V3IA 5I79A 1TCMA 2PWHA 4BQ5A 1JG9A 4DWSB 2E40A 2W5FA 4D6HA 1FA2A 1CTNA 3VNYA 3AXIA 1AVAA 1J18A 3T2OA 3VDHA 1RP9A 1QOXA 3AIUA 3NCOA 8CGTA 1G1YA 1FFQA 2BNJA 1QBAA 4V2XA 4B15A 5CGMA 2CERA 1BQCA 3W29A 4DUXA 3W28A 4MPKA 3ZOAA 2WBGA 3QHOA 2YBTA 3D5HA 5GQBA 2D3NA 3VM5A 5FIPA 1WZAA 2W62A 1W9XA 5FD0A 3M07A 4ZXOA 5A95A 4JFTA 1KCKA 3ZT6A 4HPHA 1XGZA 1HP5A 3MV01 1GPFA 3W26A 3AMGA 1CECA 2D2OA 2J47A 1LG2A 2XYLA 4UZUA 4MNKA 2YDRA 3CUGA 2EBNA 3ZO9A 3QOMA 2WC4A 5FL1A 1ZBWA 4AY1A 3HN3A 1B2YA 2DSUA 4XB3A 3FAXA 5C8BB 1VBUA 2XPKA 3SIMA 3T09A 1BGGA 4JFSA 3HMCA 1V08A 3HJEA 3SCTA 4Z2GA 3RIKA 4PSRA 3SCNA 2XFYA 3BLKA 1IZJA 4HA1A 1E5JA 2WMKA 2YJQA 2ZE0A 1W9DM 3MUIA 3SCQA 1B30A 5A69A 4W88A 1UWTA 4ACZB 4UQCA 2F2HA 2J75A 4AXNA 4LYPA 1EO5A 1E15A 4PMXA 4UCFA 4FLRA 1GOMA 1ZU8A 1W3JA 2G3NA 4P7RA 4YPJA 1WE5A 1BHGA 2PWEA 1GORA 2X0HA 1GJWA 2VI0A 3CZGA 2WK2A 3T0DA 2Y8VA 1R7OA 2VR4A 1XH0A 1XSJA 5CPSA 5EFDA 1OSEA 2UWFA 1JXKA 1CDGA 4AZHA 1BG4A 3DHUA 1SFSA 1S46A 2A3BA 5GNXA 1GUVA 1UH4A 4PMZA 1CLXA 3QGVA 3AZTA 5FCZA 3RJYA 4PMUA 2BVYA 2QF8A 4A3HA 1GJUA 1QI5A 4J27A 4DM2A 2IXUA 1QI3A 1VF8A 1JNEA 2Y8KA 4H04A 3PZMA 3WD4A 3GXMA 3DHPA 2UY2A 1W1YA 2E3ZA 1W9UA 3SUSA 1UKPA 3ZMRA 1H49A 3K8MA 1US2A 3O9NA 6TAAA 3AHVA 2CHNA 3T2PA 1VAHA 2AOSA 3SCVA 1PBGA 4CD8A 1OCQA 2JE8A 3WUFA 2E8YA 3RDKA 4PMYA 4U2YA 4A3YA 1JZ7A 5A94A 5A6JA 4CD6A 2XG9A 1C7SA 5I0DA 4OOUA 2RGLA 4PRWA 3K4AA 4XX6A 1KXHA 3M6DA 5I77A 1R87A 5AYBA 1WZLA 1CGWA 4AD3A 2O9TA 1QI0A 2NT0A 3VGHA 4AIEA 3FY1A 4AZ6A 2D22A 1CXIA 3VUPA 5DFAA 3W0KA 3VIKA 2X09A 1X1NA 5JUVA 4CD7A 1N82A 3VD3A 4GXPA 4HTYA 3ARUA 3VIPA 2BVTA 3WEOA 2YL9A 4YHGA 1BYDA 1E4LA 2EEXA 2XSBA 3BXWA 4EE9A 4JL2A 4AWEA 2YL5A 3EYPA 3KE0A 5DF0A 1CIUA 1E0XA 4C7FA 2D0GA 5A6LA 1FH7A 1SMDA 3GH4A 3WEZA 3VD4A 1VEOA 2W63A 3VDAA 4B16A 1DWIM 1M03A 4J3TA 3GTNA 1BVNP 1R85A 3K8KA 1E40A 5D9MA 1PX4A 4JFWA 3SCRA 5EB8A 2Y5EA 2WHKA 1H09A 2X05A 1TUXA 5I3DA 3WQ5A 1BYCA 1V6VA 2XM1A 4R27A 5A1AA 3VD9A 1ZS2A 4NRRA 1W2PA 1E4NA 4QLLA 1KB3A 2VC9A 3FXYA 4ATLA 1F4AA 4FMVA 3AIBA 1GQIA 5IHSA 1H1NA 4H8HA 5EMYA 2DT0A 3WH8A 5D9NA 4MDOA 2E8ZA 4PN2A 1EHNA 1V6XA 1V3LA 2WWCA 4ZE5A 1NARA 4UTFA 4NF7A 3CBWA 7A3HA 4NZCA 4Z2JA 2CBJA 3MSGA 1EDTA 2J79A 2HISA 4HP5A 3WNPA 3T0AA 2XIBA 1LJYA 4TX8A 3M46A 3WQ8A 3AZSA 2OYKA 2D3LA 1ITCA 4UQAA 1LWJA 1C8QA 4N42A 4PYSA 3TTOA 5DO8A 3IJ9A 2GK1A 3BSGA 3J7HA 2YA0A 2ESCA 4Z2HA 3RO8A 3UG4A 3AFBA 1UD4A 3VGBA 1MW1A 1C3FA 1AQMA 1JDAA 2WBKA 4H8VA 3BMVA 2WMFA 2DT3A 3RILA 4QFUA 2WVSA 3K8LA 3MKKA 1HL8A 1CZ1A 3CLWA 1V3MA 2O9OA 3ECQA 5A6BD 3BAXA 1EA9C 5I2UA 1MXGA 3L4ZA 1TE1A 3A6OA 4PTWA 1QW8A 4QLKA 4D6GA 1J0IA 1VRXA 4W5UA 2GSJA 2VMFA 1WCGA 2G3MA 1ZL1A 1E6PA 1J12A 1DEDA 1QNOA 1UD2A 1DWFM 3WDPP 2GJXA 4HZ8A 2W67A 4P8VA 3UG3A 3CZ8A 3WNLA 1US3A 5JBFA 1OD0A 1FH8A 4XZWA 3CUJA 3OLIA 5I23A 5DMYA 4DWSD 2VZVA 1QNPA 5FL0A 3N17A 1Q6FA 1UR0A 1CEOA 4AZBA 1GQJA 1W3LA 1TR1A 1J0YA 6A3HA 1PPIA 5D9PA 1XHGA 1MYRA 3GBDA 1EIBA 3CZEA 1B0IA 3PZOA 1CGTA 3CH9A 1BF2A 3ZSTA 2WMGA 1EHAA 2ZX5A 4JL1A 2FDMA 1TVPA 2JFEX 3ARSA 1HJXA 3MU7A 1UR1A 4GQRA 3BMWA 2BY3A 3WF0A 4MAZA 4CN1A 1KBBA 5IFTA 3MMUA 3NDZA 2YDQA 3WF1A 1VFOA 3OIHA 3FN9A 1JYXA 3VNZA 4GO8A 1H5VA 4U3CA 3VDBA 5A8PA 1H2JA 4GKLA 4DUWA 2WZHA 4WKAA 3WMBA 2YA1A 1E0WA 1M53A 1CENA 1UG6A 4FLQA 2C7FA 4H8UA 2Y2WA 2ZX8A 3AZRA 1UUQA 2QV4A 1A3HA 4ACZA 4AMCA 3SUUA 2E9MA 3AS2A 4JKMA 1IT0A 5A2BA 1GCYA 2VZOA 3ZT5A 3N9KA 1BYBA 3BCDA 2E4TA 1UA3A 2EJ1A 3SCUA 1GQLA 4H2CA 3LPGA 1E43A 4KGJA 2VCCA 1PJ9A 3ZM8A 3WH5A 2WNWA 2QLYA 2CYGA 3FNDA 4BA0A 2IUZA 5HNNA 5AYIA 3GNPA 5JIWA 4OKDA 4HOZA 1VJSA 2VNCA 1EOKA 1PIGA 2A3AA 4WLCA 2GUYA 1PAMA 3BAWA 1HN1A 4Z2KA 3OGRA 4H7VA 2FHBA 1M01A 1UD5A 1XRVA 3GXIA 4B3LA 1ISYA 2CPUA 1W3KA 2DT2A 5ABFB 2UY5A 5A8MA 1V6YA 3TOPA 3VDCA 5E09A 1C91A 3WH7A 1JZ4A 1ISZA 3F5JA 5ABFA 2QMKA 5BRQA 5KZ6A 1LLOA 2X1IA 4DUVA 3OZOA 4AD2A 2J25A 3ZT7A 2FHCA 3QHMA 1V3HA 4P7LA 1HP4A 5A8OA 3WQWA 1C7TA 3GM8A 3OBAA 3VMNA 3WQ6A 3VIJA 2DPEA 3W25A 3EMQA 1NWSA 2J74A 4UOZA 4YN5A 1H3GA 3VIMA 3SUTA 1IZKA 3CO4A 2YIHA 3AHYA 2ZUVA 4W87A 4D6EA 6CGTA 3UG5A 1HT6A 3MUY1 4E8CA 3VINA 2XSAA 4ML4A 2VVSA 3SCWA 1E73M 1MW2A 2ZUMA 1KXTA 4QDMA 3POCA 3OA5A 3ZIZA 2YKKA 1GOQA 1KQZA 1JI2A 5IDIA 2QPUA 1W91A 3WNMA 2O9PA 1BG9A 1WO2A 3WSUA 2XWDA 1CWYA 3L4TA 1E1FA 1SR0A 1WZKA 1MFUA 1LQ0A 4UQEA 2A3HA 4QCEA 2X8RA 4HZ6A 2XVPA 5LA1A 3TA9A 1HKJA 3EMZA 1GQKA 3VOCA 4DWSC 1V0MA 4CCDA 2WMHA 3WH6A 4E8DA 3PBGA 1O6IA 4M80A 4C7GA 1G01A 4P8XA 2HVMA 3GNOA 1WDPA 5LYRA 4EAMA 3RM9A 1QPKA 3T08A 4J7RA 3WELA 2CEQA 4MADA 4W7VA 3W4RA 3AHXA 1PZ3A 2A3EA 2J7FA 2F8QA 3AHTA 1CXFA 3BH4A 2OYLA 2WKLA 4GZEA 3POHA 3ARQA 4DWSA 1DTUA 5A6KA 1R86A 4RL3A 4Q22A 1CGYA 4UOJA 4D71A 2V3DA 1JYWA 3SCPA 4FK9A 3U57A 1G5AA 3IAQA 3IJ8A 3GXDA 1J9YA 1W1TA 3NSXA 2WKGA 3VILA 2F61A 2CBUA 1HX0A 1NWRA 5JBEA 1UR2A 1DP0A 5ABGA 4XZBA 3CHCA 1ITXA 2WHLA 3MUZ1 4M56A 3ALFA 1QVBA 4HU0A 4PMDA 3SURA 3WD0A 1PEZA 2VR5A 1NOWA 2WPGA 4PTVA 2V5DA 1OT1A 4NSBA 1E6NA 4F8XA 2MANA 1GHRA 3AYRA 4Q7NA 4MB4A 3BAIA 1PX3A 1GVYA 1LL4A 1OWQA 4F9JA 4AZCA 4B3KA 3L2MA 1UYQA 2VRKA 2PWDA 1Q6EA 4RE2A 4CD4A 3FAWA 2DEPA 5CQ1A 4N0RA 1L0PA 3N12A 4AIUA 5E0FA 4X0VA 5A8QA 3WMSA 5C70A 1E56A 1C8YA 1ZBVA 2NW0A 2VZTA 4V28A 2CKRA 4JCMA 4HOWA 1JZ5A 4WF7A 5E6ZA 4QAWA 1YHTA 1GOOA 2WXDM 4WIWA 2XTKA 2ZXQA 3FHQA 1ODZA 1W9VA 4IM4A 4PMOA 3THCA 4TX6A 1KWKA 4AC1X 3WEMA 2WC3A 3WD3A 1UD6A 1W2VA 3QOKA 3KL0A 5A8NA 4F66A 1R8LA 3A3HA 3G6MA 4IUGA 4ZEPA 2BY2A 2D20A 2ZICA 1JYVA 2J7CA 1E5NA 2JEQA 2G8ZA 1EXPA 3I3DA 4J3WA 2ZUUA 1NH6A 3GZAA 3ARZA 2CHOA 2Y4SA 2CETA 2XJ7A 4AIOA 1ESWA 1J0KA 4UQBA 1UR4A 4AZGA 4WK9A 3BAJA 1WNOA 5AC5A 1RD6A 1UZ1A 1GOIA 1A47A 5M3WA 2VX7A 4P7QA 4UFLA 4BQ2A 2CESA 3SCSA 4WKFA 3VIOA 3WQVA 3CMJA 4BQ3A 3K46A 1HVXA 1C93A 4D1JA 5IXEA 4JCLA 4RE3A 1BFNA 5KEZA 4MDPA 5IFPA 5ECUA 2GDVA 3ARPA 1VB9A 3PZQA 2PBOA 1RPKA 1K9DA 2ZX7A 4EANA 1V3JA 2JF6A 1XC6A 2FGZA 2ZUNA 4UFHA 4U2ZA 2ZX6A 2ZOXA 2G3JA 3VPLA 3II1A 4OUEA 2WC7A 2WVTA 5CG0A 7CGTA 5FKYA 1MVYA 4M82A 5C71A 2ZXAA 4LYQA 2J7BA 4L4PA 3CPUA 3CMGA 4M8UA 3AIWA 3VVGA 3ARRA 3OGSA 1QBBA 4XV0A 4IPNB 4TVUA 4JFVA 4FLOA 3AMLA 1GONA 4TTGA 5E6YA 1I75A 1CBGA 3DYOA 1HJSA 4D6FA 1B3WA 3MUAA 1UWUA 3GNRA 1B9ZA 1B1YA 1CGUA 1NOUA 4AD5A 4Z2IA 3A4XA 4J3VA 4CD5A 4LPCA 1DWHM 1DWJM 1UKSA 1QNSA 4HMDA 4ZE4A 2BXYA 3PZUA 3FW6A 3CZLA 1RP8A 1FHLA 2EPNA 1KGXA 2FH8A 2WZEA 3BC9A 1G0CA 1M7XA 4NRSA 1JZ2A 4GQQA 3CHFA 3PN8A 1NOFA 5BROA 4MAVA 1TMQA 3M7SA 2VURA 4LGXA 5CJ5A 3IK2A 4UFMA 1ZJBA 4B9YA 2BHYA 1SYTA 3W38A 5I24A 3AJ7A 4E2OA 1VBRA 4GZJA 2OLHA 4F79A 3OLEA 5DT5A 5JBDA 4U31A 5EFFA 4AZCB 1CPUA 1PX8A 3WDRA 3AI0A 3AS0A 1UOKA 1UD8A 4GINA 3VTRA 1K9TA 4R5EA 3WN6A 5D8WA 1UWQA 4JAWA 3N04A 3MO4A 1O7AA 1OGGA 5D4YA 3WUEA 3IAPA 2WMIA 4TTUA 4AEEA 1LG1A 3WMCA 2YL8A 4OIFA 3L2LA 1EDGA 2J7GA 3F4VA 4S3JA 2FGLA 3EDEA 2QMJA 3A4WA 3U7VA 3KWXA 1XYFA 4AD0A 1OGBA 1Y7VA 1XSIA 2OWWA 4OJYA 1UQYA 3A47A 3DYPA 4PEEA 2VVNA 1ISXA 1W1PA 1H0GA 1X6LA 1C92A 2WYSA 1JZ8A 2VRQA 4PCSA 1JDCA 1ISVA 2VOTA 3EDJA 1HJWA 1QNQA 3UESA 1GW1A 2G41A 4GPNA 2EPOA 3PZNA 1FFRA 2WHJA 1Q6CA 2EO7A 2XWEA 3VX1A 1E72M 4PUDA 1BVZA 1JL8A 1XYZA 5A6MA 4D6IA 2DIJA 1VENA 1E6XM 4GI8A 2BHUA 3ZJ7A 4CGTA 1E4MM 1BLIA 1B31A 3K4DA 3LPOA 3MANA 4D1IA 4MNJA 2XVKA 2J4GA 2YL6A 3W81A 4WJXA 2VX4A 1G9HA 4K68A 4WSJA 1BGAA 4GO9A 1MW0A 3WQ4A 4GZIA 5FOOA 1JAKA 2XFFA 3U5YA 1J01A 3VGDA 1KGWA 2OYMA 3MS8A 2CXGA 1EQCA 3PHAA 5A6BA 4ZENA 4QLJA 3BGAA 5CLWA 2VCAA 4U33A 3NIYA 1JFHA 5CGTA 2D0FA 3AMDA 3CHDA 1OIFA 5IHRA 1RH9A 1AQ0A 2V3GA 2W4XA
chains in the Genus database with same CATH superfamily
2YLLA 3ITGA 2WNZA 3MI6A 3N18A 3VNDA 3VOGA 3LZ5A 1BWVA 4TOQA 3RO6A 2WANA 1R38A 1EO7A 1VCFA 1ZBCA 4DXKA 3WYZA 4UTTA 3N9RA 3GHTA 5DN1A 3UXKA 3N15A 4Q7IA 1GVOA 1XUUA 3WQPA 1TZ7A 4I9MA 3W9ZA 1PDZA 2H9AB 2WM0A 4NJKA 2AAAA 3P0WA 3EA1A 1E6SM 3QBUA 3UPWA 2GGEA 4WDUA 1S39A 2ZXDA 3KRZA 4QCFA 1G7VA 2VC7A 4GIEA 3URBA 2VT0A 3AXHA 3RRAA 3ZVIA 4OWGA 3OZMA 3TFXA 1BTMA 1LP6A 5BNKA 2WNNA 4QSHA 1ADSA 2ALRA 2BS9A 5MKGA 1ZFJA 3QZEA 3VD5A 1KW1A 1QHPA 4CNPA 3PUOA 3G2GA 3EWWA 1W1IE 2HPMA 4LVGA 2Y63A 3LM3A 1LZOA 1A0CA 1EC7A 5DCEA 4JN6A 1A50A 3B9AA 2WKJA 2Y61A 4LY4A 2VFIA 1UH2A 3W2NA 1UA7A 2C6QA 3LV6A 2F6XA 3B05A 3T81A 1R5YA 5HJLA 3VU2A 1BRLA 2INFA 1H63A 3UCQA 4BR1A 2DSVA 4XUYA 4K8GA 1OINA 3MA8A 4M0XA 2DZUA 2VDGA 3HA1A 3LG3A 4M81A 4DI8A 4J3XA 1DPMA 2GQ3A 1Z89A 3NSMA 2XVGA 3UWWA 3DIPA 3GDBA 2X1UA 3VGGA 1FP8A 3Q58A 1TQXA 3LCXA 2AMGA 4AD1A 3TC3A 3HPXA 3KEHA 3UXLA 1J10A 3ZLHA 4F40A 3SSZA 4AD4A 4GQ0A 1LTDA 1M6JA 4HPNA 4ZTYA 5L6UA 2G3IA 2QDEA 2WAGA 3WIJA 1EJRC 2H8XA 3CIXA 1XLIA 1R30A 4H9YA 4W7UA 4S3EA 4KGLA 1JD9A 4EWND 4JNMA 1XXXA 2CW6A 3W2KA 4QJ3B 2Z7KA 5TD4A 1OC7A 4HBKA 1YPXA 1UBSA 1U2YA 3NXFA 2A5HA 5HNUA 3KBNA 1IYXA 3F7JA 2IQ0A 2J78A 3SQLA 1TPH1 1H1ZA 5C2XA 1LUCA 5K2ZA 1Z3NA 3C2VA 4QEHA 3GH5A 2YFNA 1YBQA 4OE7A 4I7VA 3UXDA 3OO2A 3EOUA 1ZB5A 4HB7A 1VHCA 2FGBA 5CSUA 4KMQA 5M2FX 4Z1YA 5AFDA 2BVWA 3MHUA 2Q3RA 3GSMA 4RDWA 4PB3A 1W3HA 1TYGA 1FXQA 4GI9A 4ADSA 2ACUA 4QE4A 1K8YA 4H7CA 2Q8XA 3NO3A 4RW5A 4ZXLA 4NJIA 4DAIA 1LORA 1R3VA 1KCLA 2OSXA 2IW0A 4LRSA 2PDQA 2EPKX 4ZQPA 5HXMA 1NFGA 5G2HA 3N4EA 4M6PA 5HJXA 4XBJA 3KVLA 4OBTA 3KL5A 3GY1A 1HL2A 4H41A 4Y9AA 2I5IA 3CQJA 4AIBA 1OIMA 4JYDA 3GD6A 2B4GA 3BW3A 2BV9A 1PZ2A 2ON3A 2INEA 3A23A 1JAEA 3BCFA 3T05A 3NYZA 2UY3A 3T42A 4C6JA 4H6RA 1QRQA 2VDHA 3SY5A 1QI4A 2VQUA 1MWOA 4PMRA 4RR4A 5HINA 2W91A 1UD3A 1EC9A 3N11A 3TJ4A 1TJ2A 2VHLA 3B0PA 1MRQA 4Q8OA 1E9YB 4Y8EA 4Q6XA 4FI4A 4GNVA 1TSIA 4UR9A 4C7DA 4DF1A 3CM4A 1I6NA 9CGTA 4L61A 4O10A 4GHRA 1HTIA 3PTDA 4R7WA 4GGHA 5AYXA 1QXLA 2YOCA 4IIBA 1Q5MA 3NURA 2VC5A 3CYJA 2C16A 1OGSA 1TB3A 3NM3A 2WCAA 4DJDC 2FZBA 3RPTA 2VRJA 4YVPA 3ZQ9A 4JIEA 2OSYA 1KRAC 2E09A 1SFJA 2X1RA 2MNRA 1VIWA 2A2IA 1PWLA 4BKNA 3STCA 1XCWA 3GNNA 1TO3A 3CTTA 4DUOA 3W1AA 1B3YA 2WLZA 1Z8AA 4HA4A 4MB1A 3Q94A 1K9FA 3VIFA 3BL3A 4S3KA 3W24A 3AIRA 3IARA 1MNSA 3AMCA 2PCQA 1I1WA 1MQPA 1JCTA 6REQB 3L66A 4IGHA 1XCXA 3APYA 2DSKA 3H23A 4L56A 4CVWA 3WDJA 2QPSA 5E70A 1VEPA 1ONEA 1P6CA 1RK5A 3M0JA 4O54A 4ATWA 3DI1A 3UWUA 5IBXA 3EXTA 1GTEA 4QJ1A 2QJJA 3UD6A 1UWSA 1EA0A 4YWSA 1RUSA 3FA4A 4HHHA 3K2GA 1TV8A 4MOZA 4FAMA 5CPQA 4HOXA 1TZZA 3TEVA 5BRBA 7ODCA 1V03A 4FF5A 1R7AA 3WK1A 1BSLA 2P3EA 3M9YA 3GR7A 4LNYA 2W6RA 1XD0A 4PTMA 3LRMA 3EBVA 3OODA 4GH1A 5JXQA 1WB0A 3PFRA 3ZSSA 3UETA 2ZDSA 2JF7A 4HNVA 1CI1A 1O94A 1R2RA 1FWDC 3KL3A 1G6CA 2BGNE 3LGEA 2A21A 2O9RA 4UTTC 1CLKA 4LCSA 4BQ4A 1ZLPA 5FSEC 4LFYA 3W6LA 4EPEC 1SZEA 1SO6A 5HJYA 4UR8A 2GYIA 3RMJA 2EPMX 3ARWA 4ZSTA 2FVMA 1UH3A 4TVDA 1H4PA 5EYWA 3T2QA 4O53A 2W66A 4FXSA 2WOQA 1UHVA 1ZAHA 2ZWYA 3CEUA 3W7IA 1KCXA 4GH3A 3BW4A 3T8LA 2Y1HA 4UFJA 2WVVB 5EY5A 2QNEA 3AXXA 3VCNA 4KRUA 4M29A 5KZMA 3DECA 4FR1A 3IGXA 1W32A 4PC8A 2QV5A 1AL8A 3EX3A 2VO5A 1E71M 3TYBA 6ENLA 2CZ5A 3GLCA 1F2JA 3DOPA 3V3WA 4Y8FA 4OGZA 4Q4PA 3LCFA 4MWAA 1ZP3A 5L9FA 1OM0A 4UNIA 1DJYA 3VZXA 2P53A 3AISA 4DJFC 3VOJA 4OBRA 3FYPA 3LD5A 4HZ7A 2BASA 3RF9A 1BSIA 5K9DA 4JQAA 3AWOA 2P1FA 1AA1B 2BMBA 3V35A 2ISWA 3MCOA 3SFKA 4J5NA 1W5MA 1R0MA 5CLTA 5HQLA 2J7DA 3W88A 1Q66A 3UP8A 1Q6DA 4IX0A 3EXSA 1E3XA 1GKRA 1UZ4A 3RITA 3TYEA 4Y6GA 5BXTA 3BAYA 1JI1A 2DUAA 4X63A 3ZZ1A 3QY6A 1QUMA 5KETA 1XYAA 4IIFA 1FWCC 3LENA 1HGWA 2DQXA 4FX8A 5CZTA 5XIMA 4EVZA 5AY7A 3QMTA 2H8ZA 3O7UA 5U4NA 2YZRA 5ABHA 4F4RA 4UTJA 5CC5A 2Y24A 4ALDA 1JYNA 3PF3A 1J93A 2GJPA 1PXGA 3FGCB 4MNLA 2E77A 2FPVA 4KWVA 2ZXBA 3ZR4A 3B9DA 1Q6QA 2E9BA 4ROPA 2CBIA 3APGA 2AMXA 1F9CA 3NQFA 2ISFA 3PPGA 5K4ZA 1BPLB 4S39A 4B92A 4LX4A 3TU9A 1QO2A 4DYKA 3C86A 2XH7A 3LPFA 4QG9A 1T5AA 5F2MA 4JTSA 3T9PA 4JTQA 8A3HA 5D8ZA 3RLUA 2QQ6A 4RDZA 1P7TA 2QCGA 2VP8A 3MP4A 1EH9A 3DEQA 4XKYB 5G4EA 1OK6A 2QEZA 4C1NA 1FRBA 2DZAA 3TAKA 4P8UA 4DM1A 2OZ0A 2QW5A 1RXOB 1XIFA 3W82A 2BHZA 2WHMA 4IT1A 3Q65A 4Q4SA 4LUJA 3PSVA 3AYVA 4LH8A 1IIHA 5D38A 4KRTA 1XR2A 4PH6A 1KBKA 3FYYA 1EQPA 1O5RA 1MRAA 3ITXA 3MUXA 2PLJA 4UWMA 1DHPA 3RPMA 3JR2A 3IIOA 4XK2A 4D72A 3U7BA 1VCGA 1UKOA 1FWEC 4WOZA 5FI8A 3GAYA 3LV5A 4RCXA 3BG9A 1IXNA 3AS1A 3NJ3A 1MSSA 3ZR5A 1IWBA 1AH3A 1CLVA 2GOUA 1FWWA 1LDCA 5A8GA 3THUA 2WSPA 2OWCA 1YPFA 1ECQA 2C91A 5E5CA 5DELA 3EAUA 3VNLA 5BCAA 4UCGA 1V8EA 4F0RA 5TIMA 4BQ5A 2E40A 2W5FA 3TYAA 4D6HA 3W83A 4ZO7A 4LW7A 3QV7A 3VNYA 1AVAA 4BHYA 4O1AA 3VDHA 1QOXA 2AGTA 4L1GA 4S38A 1GK8A 3EX6A 4B15A 3EWXA 3DFPA 4GISA 2HEJA 3QY7A 2GWGA 4WRHA 3W02A 3ITOA 2RDXA 2PZ0A 5IM51 4Q4KA 5GJNA 3D5HA 3VNKA 4AY8A 2W62A 1W9XA 3GU1A 5I3IA 1DJXA 2PLCA 4JGDA 3ZT6A 4WDXA 3I7QA 1G4TA 1WKFA 1CECA 2HVOA 1P0BA 3LI0A 4UZUA 4MNKA 1ZAJA 3CH0A 2EBNA 1P5BA 2WC4A 2NVCA 3PBMA 3UZ5A 4UR7A 1LOSA 3WG6A 2Y7DA 3FAXA 1S2WA 2QCMA 3SIMA 3A4JA 2X41A 3TLLA 1BGGA 4RK8A 3SCTA 1V08A 3CWOX 3RIKA 4PSRA 3PPCA 2YJQA 1U1HA 4B90A 4CNSA 4ZOEA 2F2HA 2J75A 2X30A 4BJHA 4G5DA 2YSWA 4DZ5A 1E15A 2NQ5A 1FKWA 4UCFA 4FLRA 1ZU8A 2G3NA 1WE5A 1ZENA 2FJKA 2X0HA 3TYZA 4C6IA 1XLJA 1TPVA 3T0DA 1QFEA 2Y8VA 4K1WA 3V1HA 1T6MA 3I4KA 1LBLA 5CPSA 2QCDA 1OSEA 2UWFA 1JXKA 1CDGA 3DHUA 4O28A 2EF9A 2QCNA 2NQZA 2QF8A 5FJOA 4PTDA 1GJUA 4F48A 3WBYA 1QI3A 4H9UA 3DHDA 4H04A 5E1QA 3WD4A 3BARA 3H2MA 3DHPA 3KM8A 2E3ZA 1UKPA 1TPWA 3ZMRA 1XG3A 4O8RA 1OC5A 2X2GA 4HYVA 3AHVA 3T4WA 2J9YA 3H6OA 4CD8A 1LT7A 3S8HA 2JE8A 4EPDC 4GNJA 1LROA 4JDBA 4MSSA 4B4FA 2VDIA 4K8HA 3U2CA 4DHGA 2XG9A 4XZ9A 4PRWA 4GYKA 3S5YA 1XIJA 3K4AA 1W37A 3M6DA 5AYBA 2NT0A 4AIEA 4K6AA 3NEHA 3I7RA 3LBCA 2QUUA 3V7PA 3QVQA 2CU0A 3VIKA 5BU6A 5JUVA 4CD7A 2ASHA 3F4NA 3LTPA 2E6YA 4IQDA 2PZNA 4JXCA 3FJ4A 2WJFA 5FF7A 3QGAC 2XSBA 4JL2A 3EYPA 5DF0A 1TMLA 4B5SA 4GUFA 3EA2A 1YADA 2GLKA 3GH4A 4F0MA 2W63A 2XDFA 3NL3A 1SQ7A 4J3TA 2VFHA 3I6TA 1A5OC 1E40A 3NQ7A 3OHMB 4JQ4A 4IJRA 2NVDA 1DQXA 4QHRA 2WHKA 2X05A 1TUXA 2VFFA 3VD9A 4UTHA 2ICSA 1AMKA 3FXYA 4FMVA 3AIBA 4B3ZA 1OVDA 4MPQA 1E9ZB 4TMCA 1H51A 2DT0A 3URAA 5HK4A 5D9NA 3LLFA 4LAUA 3G0UA 1TPEA 2OXNA 2FZMA 2PGEA 4MDOA 2E8ZA 4PN2A 1EHNA 4LVFA 2P0IA 4GIRA 4NF7A 1M5WA 4M51A 1XLBA 1IZCA 3IGUA 1EDTA 3AALA 3TC6A 4HP5A 1VQTA 4YU1A 3WNPA 4X61A 3W7DA 3ZS4A 4TX8A 1U1UA 3M46A 3D0CA 3AZSA 1S5MA 4W9TA 1UP2A 4O14A 3DG3A 1LWJA 1ZAIA 5IBXC 3AUOA 1I0DA 1Y5WA 2ESCA 4Z2HA 1EP3A 1PIIA 1O1HA 2POTA 4D2JA 1QWKA 2HE8A 3Q2DA 1AQMA 2WBKA 3B0UX 5F4XA 1FCUA 1Q4WA 4GUJA 2WMFA 3KWSA 1PKMA 1VH7A 1VR6A 2O9OA 3ECQA 5A6BD 5I2UA 4GQBA 1GW9A 3A6OA 4JTUA 3L68A 3LCWA 1TRIA 1IEXA 3S1XA 2IPGA 4QLKA 3KHJA 3WCZA 3SN0A 3GYEA 1E6PA 3FJNA 2Z24A 5KMYA 3MQTA 3DFNA 5LNSA 1BF6A 2W67A 1GVQA 3UG3A 3C3UA 3CZ8A 1XGEA 1U5HA 1US3A 5JBFA 3IPWA 3OLIA 1TWWA 3M0LA 3DN5A 1TPC1 1Q6FA 1UR0A 4LV9A 1K4GA 2GWNA 4AZBA 1GQJA 1V5XA 6PTDA 6A3HA 1PPIA 4B5TA 2R9RA 2A7RA 1MYRA 3CZEA 3JS3A 1B0IA 1BF2A 2WMGA 1L2QA 2ZX5A 2WV8A 3DG7A 3BK0A 3USBA 2JFEX 2FQIA 1HJXA 3EOOA 3OBKA 3BMWA 4CN1A 4AWTA 2DFAA 1PB0A 3N25A 3UYCA 4PBEA 1ZSXA 3T6CA 3W1MA 1XBZA 4PFHA 1B5TA 1JYXA 3W23A 5G4HC 1AQFA 1I4NA 3VDBA 5A8PA 1ONXA 2QPXA 2CFFA 2WZHA 4YCOA 5FSDC 4WKAA 3WMBA 3B0XA 1CENA 4AUBA 4S23A 4H00A 3QY8A 2QV4A 4AMCA 4JTJA 2E9MA 3I6RA 3D47A 1IT0A 2PLKA 2VZOA 3ZT5A 3N9KA 2EJ1A 1JPDX 4Q8VA 2BOEX 2NQJA 2G97A 3S3GA 5HR7A 2JGYA 2VGBA 3V5OA 4ZQCA 3NQEA 3NL6A 1PJ9A 3WH5A 1TJPA 5JIWA 4BA0A 5AYIA 3GNPA 4OKDA 4HOZA 1A3XA 1EOKA 1PIGA 5AVHA 2GUYA 3NO1A 5FF2A 1R2TA 2PAJA 3QTPA 3DFSA 4B3LA 1XIGA 2QIIA 4IF2A 2Y70A 1W3KA 1P0EA 1R3SA 3LBOA 3UJSA 5ABFB 3VDCA 3FSUA 3N2MA 1A53A 1OFAA 3F5JA 5ABFA 4C90A 3S4TA 3EPMA 2X1IA 4DUVA 2YCKX 3OZOA 1RR2A 4AD2A 2J25A 1TIWA 3CWNA 2FHCA 3QHMA 1EUAA 3GM8A 3VMNA 3VIJA 2HNEA 1Z9AA 5T91A 1Z6KA 4WHBA 2XSAA 2VVSA 3PWIA 2FTPA 4XBSA 2ZUMA 3POCA 3O16A 3OA5A 3ZXWA 1W91A 3WNMA 1E1FA 1SR0A 4LYKA 4UQEA 2A3HA 4QCEA 4MGGA 5LA1A 3D6NA 2WMHA 4M80A 3VCCA 3PVFA 2HVMA 1FY6A 2NXIA 4EAMA 3RM9A 3ISIX 5CBJA 4IQJA 2CEQA 2YGYA 1PZ3A 2F8QA 3BH4A 1DV7A 4GZEA 1M68A 3GR8A 4KCVA 4E8GA 5A6KA 1ML1A 4CNUA 1JYWA 2A6LA 3OBEA 4JTTA 2OT1A 3UNTA 3IJ8A 2TODA 3GXDA 1UWAA 5JQ9A 1GOXA 1EYWA 3NSXA 5DRIA 1W54A 4RXGA 2CBUA 1NWRA 4ZR8A 2V68A 3UZXA 2YXOA 5LZLA 3CHCA 4LS1A 1OF8A 1ITXA 3M64A 4PMDA 3WD0A 1PEZA 2WPGA 1VPYA 3NPUA 4Z08A 4NHVA 1Y5VA 4DBUA 4Z17A 1OT1A 4NSBA 1TE6A 1FWSA 1KM4A 2BTMA 3OQ8A 3IRDA 4Q7NA 1QASA 4A3QA 4QE5A 4F9JA 1OWQA 1UCWA 4AZCA 4IJBA 3QMSA 1GYMA 3L2MA 1UYQA 2PWDA 3PWGA 1UMYA 3QQ1A 1EPXA 2DEPA 5CCZA 2NUWA 3LHWA 3MO7A 4FALA 3ZWTA 4AIUA 3UWZA 4S3CA 4X0VA 2Z1BA 1GZ1A 3B0YA 1KFCA 1F61A 4N2YA 4JTRA 4HOWA 3UVAA 4WF7A 3SO7A 4A2SA 1W3TA 2XTKA 2ZXQA 3S9YA 4X60A 1W9VA 4PMOA 3ATYA 4TX6A 3UZZA 4FSAA 4CQCA 3ES8A 4QEEA 4L1WA 5DXXA 3QOKA 5K3VA 5H2ZA 1KFBA 2PRHA 3KL0A 5G4WA 4RDVA 2VGGA 1R8LA 1IR2A 1XM3A 2BY2A 1AW2A 4KRZA 4PUJA 3UYIA 2JK2A 2V6AA 4J3WA 3EB4A 2QCCA 1OK4A 1BVWA 3M0IA 2I7GA 2Y4SA 4AF0A 2BBFA 3IJLA 2E28A 2E5CA 4AZGA 4WK9A 1OZMA 1RQBA 5AC5A 1RD6A 1GKPA 5CZSA 4BK9A 4UFLA 3SCSA 4WKFA 3UXIA 4IPPA 3P0XA 2FVKA 4CQ9A 4YNGA 4JCLA 3M0KA 5IFPA 5ECUA 2NLIA 3DCPA 4WEVX 5FJTA 3PZQA 2J24A 5CH9A 3CO8A 2ZUNA 2FGZA 3WK0A 4A22A 1EXBA 2R1NA 4QE1A 1DE6A 1EUNA 4HMNA 1XISA 2J7BA 4RZBA 1K03A 1FQ0A 1MZRA 3CEPA 4IHCA 4YCPA 3M7WA 3CMGA 2J9XA 3V36A 3W1RA 3HBLA 1W5QA 4IPNB 3WQEA 4FLOA 3N19B 3AMLA 2IKJA 1CBGA 3T07A 4D6FA 1B3WA 2NQHA 3GNRA 2Y7GA 2OR2A 4JIPA 1CGUA 4Q8PA 4Z2IA 1LQ2A 2J66A 3OPSA 3CQ0A 4PCFA 1QNSA 1UASA 3E0LA 5AVNA 1RP8A 2ZC1A 4AY7A 1FHLA 3IGHX 1RHCA 3NQCA 1DIDA 2WZEA 1XFCA 1G0CA 2J8TA 4NRSA 3CHFA 4ZOAA 3BLFA 4H83A 1EGVA 1Z48A 4HD5A 4MAVA 1TMQA 4PBFA 2VURA 4E3VA 2P8CA 1LWIA 2QZRA 3IK2A 4GFSA 1ZJBA 3ZLGA 1SYTA 5C9UA 1VBRA 4C6BA 3KDNA 4HHLA 2C1HA 3IVUA 2WSRA 3W3OA 2XINA 2GQ9A 5JBDA 5EFFA 1P0DA 4IMAA 4MIMA 4AZCB 1OX5A 1CPUA 2HBVA 3AI0A 3AS0A 2V5LA 1PHWA 3RXZA 2PU0A 1UWQA 1W1B1 3TW7A 4H9ZA 3WUEA 3IAPA 3LHTA 2OT0A 3T4CA 3C0JA 3GRIA 4O13A 2DVXA 4RZ6A 3LHZA 3VDGA 4CCZA 3IK4A 1LLZA 4Y9MA 3LXCA 5DQPA 1RVGA 2QMJA 2OZ8A 1EF2A 3KWXA 4AD0A 1JUBA 1Q7ZA 1T99A 1XSIA 2OWWA 3GUWA 1Y0EA 3URNA 1JRBA 5I03A 1ISXA 2ZFAA 1G69A 2XN1A 1JZ8A 1ISVA 3EDJA 1JQXA 1QNQA 1GW1A 1CB7B 1IXPA 2V9DA 3MP5A 1K02A 1SO3A 4S3BA 4HU4A 2RHGA 4O17A 1Q6CA 3L12A 4IXHA 1GYNA 4DO5A 1XYZA 1SW7A 3P8IA 3QW3A 3VYLA 1E6XM 1DJHA 1S2CA 2Z2BA 1E4MM 1ICQA 3SJNA 1SO5A 3K4DA 1RBAA 3LPOA 1SJBA 5FEPA 4OV4A 3W81A 4XZNX 4CNTA 1YDNA 5DMNA 5AHEA 4ZOCA 4N4QA 4FNQA 1ZHAA 3H2AA 5FOOA 4GACA 2OGYA 4OQVA 1AZ2A 1VHNA 5CSSA 3VGDA 3MS8A 2CXGA 4ZENA 4QLJA 2EG7A 4AHQA 1ZQ5A 6XIMA 3CAKA 1JFHA 5CGTA 5H1WA 2D0FA 3UY7A 3OIXA 4Z42C 3GK0A 2W4XA 1DWAM 3ALGA 2GVJA 4IWWA 4PMQA 1ZCOA 2GJLA 4DZIA 3MSRA 3NPWA 1JCNA 1GOWA 4JQ3A 1JZ3A 1S5WA 3AIQA 4NASA 2VEKA 4E4FA 2ZA2A 4JIRA 3PBVA 3O2LA 4KEMA 3KXQA 1T96A 3SCOA 4NXSA 3NG3A 1FVPA 1E6ZA 3G5EA 2FB3A 3WENA 2JEPA 2V5BA 4EK7A 5D2TA 3OJGA 4YMZA 3ZJ8A 3URQA 2AQWA 1F6PA 1SJAA 2YR1A 3P5YA 4DO6A 4RXFA 2WM1A 3NSNA 1D7KA 1GEHA 3CT2A 3LTSA 2BY0A 1Q4NX 2WWDA 3PTQA 3B0VC 1YBQB 3CUIA 1KBIA 1C90A 2W3ZA 3CAQA 3HV9A 3WJWA 1Z32X 2NQ9A 1FDYA 3MVIA 4AYSA 5CSYA 4X9SA 1UP0A 3IANA 2TMDA 1BKSA 4JX6A 3UPMA 4TIMA 3IV3A 1RALA 4NT0A 1XSKA 3JVAA 1AFSA 4AF0B 2VTFA 2DZXA 2E67A 4MJ2A 5TBOA 3OVRA 1WYIA 2ZUWA 3HO8A 1K1DA 1EEXA 2X0YA 5FF3A 1TTIA 1SZNA 1KM5A 1XLDA 4ENLA 5HWNA 5A6AA 3F5KA 4JTKA 2Z2AA 3IJ7A 4C6NA 3TSBA 5FESA 3H12A 1J0HA 1UPMB 5TF0A 2YYUA 3TN6A 1QJWA 1XKJA 4NZFA 2YA2A 4YTRA 1Z7AA 1XV8A 2A7PA 4KF1A 4LY8A 5HANA 1GZJA 4HKPA 3QGKC 4JX5A 4UOQA 3KP0A 4X0NA 3G3DA 5GNZA 2NT1A 3O0KA 3DG6A 1UKTA 4IFOA 1PUDA 3L5MA 3VIIA 5D2YA 3HU7A 2DVUA 2H3DA 5AHIA 3W7EA 1ZBKA 5A2AA 1N8FA 1SJDA 3R7MA 4NNBA 1ADDA 3BVJA 5LGXA 2E9LA 1EP2A 3KBMA 1BWLA 4GUHA 1WKYA 4O4VA 1Q63A 4S1FA 4QQUA 3OVQA 4OV9A 1XL9A 2DIKA 3EMCA 1MDRA 4KWSA 2ZRUA 2G4JA 4JKLA 1JD7A 1RCQA 4ZZ9A 4LBUA 3VKKA 1WP6A 2DSZA 3M44A 6ALDA 4GCAA 3WUGA 4CU8A 3JUGA 1TVLA 1UUOA 2QR6A 3MV11 1X38A 3PAOA 1NWTA 2ABAA 3V0TA 4W93A 3W1LA 4B5VA 2OEKA 4G56A 3NL5A 1OEPA 3CHEA 3WDHA 1DQWA 4QG6A 4BZYA 1AD4A 1VFHA 2RGMA 3VO0A 3ZJKA 3CZJA 5F7UA 4PL2A 4F9DA 1KRCC 5CXPA 7TAAA 3FKKA 3KOYA 4QNWA 3W74A 1HKMA 1ZALA 2G5WA 4N4PA 3N6QA 3QN3A 3ELFA 3UF9A 1S38A 4KQNA 1WOBA 3KBWA 3W86A 3K1GA 2RKXA 3DENA 1GT8A 5K4XA 4MWAB 1AUSL 3E5PA 1K9EA 3OHIA 1FWJC 3BSHA 4HZMA 3TYDA 3QR1A 4K2SA 3EB2A 1KGUA 3W6MA 3H55A 3BZJA 4RJEA 4W89A 2TYSA 3W1PA 4PFMA 1YQ2A 3K4WA 1KWGA 1O12A 3OW1A 3M16A 3H24A 2FB2A 3W2LA 2X7WA 1IWAA 2PP1A 3M41A 2ZZ3A 3M5XA 3NQDA 3VD7A 1DE5A 3HURA 4FB7A 1D2KA 4NJHA 3EX2A 3W7NA 5A3HA 3S2JA 2O0TA 4WDTA 1I0BA 3R5EA 3NUKA 1P4CA 2HDJA 4IPJA 3B8UA 1B90A 4Z2LA 4YVVA 1LRQA 3S1VA 3B9EA 3RK8A 3B04A 1RJPA 2R1PA 2V38A 5HATA 4LANA 3QXBA 5EA9A 3WFLA 2DH2A 3WQGA 4LSBA 5GNYA 3K5XA 2QUNA 4W5ZA 4MVAA 2Y7FA 2HJPA 4QS5A 3TXVA 3B9NA 2QCLA 5DRCA 1U5JA 3AIVA 2P50A 3SRHA 4F0KA 2DVTA 3DBPA 2PE4A 1LL7A 1HXJA 3VGEA 1E70M 1YXYA 1YTDA 3S2CA 1IV8A 3CL6A 3I65A 4UTLA 3WNNA 3B3DA 2O4QA 2TAAA 4W84A 1OG6A 1JF6A 1CXLA 4ZMGA 4NVTA 2W92A 4LT9A 1JCMP 1E55A 2X2YA 4HHMA 3TAOA 1XH2A 3QYSA 3BCJA 1FX6A 1JNDA 1V02E 3PUEA 3PUGA 1A5MC 4UIOA 3CIVA 5G1TA 2OSWA 3IIXA 1KR1A 4IIHA 1HG3A 5C5YA 3UJFA 2GDUA 2GVLA 1T0OA 3B8IA 3U5UA 3W7PA 2EPLX 3P62A 1JZ6A 3HGOA 1PWMA 4MG4A 4E4PA 9RUBA 3LMYA 2OQLA 2V69A 4TXEA 4B5UA 4XKYA 1W0MA 3RM4A 1FP9A 1CGXA 4DRSA 2R24A 1WPCA 4MLJA 1HJUA 3E2QA 3AMKA 4A05A 3ANVA 1JXJA 4YTUA 3VKJA 2QDGA 4RV3A 1B3VA 3FHAA 3DKJA 3KOXA 1Q7QA 1VS1A 2ZUTA 5D9OA 3L4VA 5CAKA 2ZRXA 3DX5A 3GE7A 1C8XA 1XLEA 2BFGA 1PZ0A 2PSNA 3QRHA 1OD8A 4PODA 4GLEA 3R89A 4RLIA 4YJ5A 2NV9A 1QK2A 2CZFA 3N2XA 4L1XA 4O11A 4M7TA 2E0PA 3CT7A 4O1CA 3WDQA 3ENLA 1HUVA 4MKNA 2EG6A 4E3TA 4FX7A 3T40A 4GX9A 1NP2A 2Z28A 2VOMA 3N13A 1O5QA 1XKYA 3P84A 4DWDA 4FLSA 1HVQA 3W7LA 2CLMA 4J28A 4PMVA 1EZWA 3REQB 1DIEA 3PZIA 2PS2A 5C9XA 1LF1A 3PPHA 1FWTA 5LXEA 1D9EA 1MEHA 4M1RA 3PZTA 4L9ZA 4N02A 2PFHA 3T55A 1AMYA 4U3AA 3LCIA 3R8GA 1KFWA 1WDRA 4P7NA 4WQ6A 1TG7A 1ZJIA 4HSOA 4QXIA 1M04A 1K70A 4KFOA 3WD2A 4AYGA 1UR9A 1RPXA 3MSYA 1XJBA 1XBVA 3GR4A 4A3RA 1P48A 4MJ4A 3H4WA 1HKIA 1TR9A 3SI9A 4AB4A 1GJPA 1T40A 2YCLA 2Z2UA 1NTHA 1R3TA 1VLWA 4A21A 2GUBA 5D2WA 2E6FA 4WSKA 5A5WA 2EPHA 1LUCB 1IXOA 2IXVA 4ZB2A 3LYEA 1H11A 3A5FA 2UZ9A 2CLIA 4YHEA 2PDNA 1FDZA 4UQDA 3HG3A 3QTGA 3CGTA 2WCSA 2PCEA 1MQRA 2GVYA 2V30A 1CYGA 3THDA 2E7FA 2ZE3A 4UC5A 1NU5A 4UTIA 1NAL1 4EKJA 1BYAA 4CNOA 3B9OA 1QHZA 1W1VA 2PTDA 3BAKA 4DXXA 1DJWA 4A8NA 3BSMA 4AVNA 5B80A 5K9CA 3U2ZA 2GJRA 4GI6A 1PYFA 4CVUA 4UTWA 3GZ3A 1ISWA 2RUSA 4TQTA 1HJQA 4WVXA 2HK1A 1HF6A 4DJDD 3KUMA 4ZVJA 1L8PA 3C2RA 3LU2A 1KLYA 2PWFA 1BAGA 4GABA 4HPJA 1JDDA 3PWAA 1J0ZA 3TTYA 4D6CA 1F7BA 3LK6A 5D33A 1TVNA 3AXKA 4UZSA 4F0SA 4LF2A 3LRLA 4H9VA 2XISA 4UUIA 3CQIA 1WAWA 2BVDA 1DL3A 5FEZA 3BMXA 4UQ9A 1EX1A 2QCHA 3R13A 3E3HA 3CMFA 8XIMA 4Y9PA 4DVOA 3F4DA 2WVUA 4HMCA 4R85A 2A85A 6XIAA 5C2CA 1FWNA 4DZAA 3G1SA 3GXNA 1HW6A 3UERA 3WBAA 3S5ZA 4ACYA 5CJNA 4J3SA 4ZTXA 4IP7A 2H6RA 1LLWA 1FWHC 4NIRA 3GYCA 3SUVA 4MB5A 1O5KA 3R4IA 3TA6A 3GG7A 5MKGB 3MI2A 4XO7A 2WLYA 2FTWA 2AL1A 3BGJA 2ACSA 1J2WA 4ML9A 1PS9A 3AXMA 2NWSA 1JDFA 3RMEA 3VCRA 2D2GA 1J6OA 3WBXA 2VWTA 2PWHA 4EIVA 4MWAD 1JG9A 2CZDA 3G3MA 3S5SA 5E0KA 3AXIA 1ALDA 1J18A 3KLKA 4AVFA 1RP9A 1FHUA 4GC4A 4OUIA 1FFQA 1FWBC 3PB2A 4WGXA 4C6EA 2VD9A 3H8AA 2CERA 3GHUA 5CC3A 4FNPA 3W28A 5GQBA 2D3NA 4HNOA 5FIPA 1TWDA 1ITQA 3RPDA 3M07A 5A95A 1D8CA 1KCKA 4F3HA 3RLVA 4EXQA 4PA8A 4LU0A 1AZ1A 1HP5A 3MV01 4NZ3A 3W26A 3R12A 3HPZA 2XYLA 3G1FA 3H2FA 3LZ3A 4GKTA 4B2DA 3SM0A 4WZHA 3ZO9A 4Q4RA 3H7UA 3E02A 3GVWA 1H50A 5HULA 3HN3A 1B2YA 1V51A 4KESA 4OU1A 4XB3A 5AHFA 4IIDA 1VBUA 1UC5A 2XPKA 3TLQA 3T09A 1JUKA 1AH0A 2I57A 1IIGA 5B7YA 2ZE0A 1W9DM 2QGYA 4KFNA 5D04C 1OX4A 4W88A 3VKAA 4C1KA 5CC6A 4Q7BA 4AXNA 4XAPA 4PMXA 4N9DA 3SGGA 9XIAA 3QZ6A 2WJDA 1R9YA 2VI0A 3U2EA 3E38A 5IRPA 1XC4A 3EKGA 2WK2A 3HM7A 1W56A 2W79A 3G1RA 1R7OA 1XH0A 3PSWA 1QAPA 4R53A 4AZHA 2HMCA 2X1SA 1MUMA 1VFLA 5GNXA 3U8GA 1UH4A 1CLXA 4PMZA 2Y85A 5FCZA 4HQVA 2OCZA 3MDUA 1D8WA 1NDVA 4DPPA 1RAKA 2IXUA 4DM2A 4HTBA 1VF8A 3E0WA 2Y8KA 4IMDA 2GUUA 2V2HA 1OJXA 2KX9A 4O15A 4Q8NA 2J9ZA 3NPXA 2UY2A 3CB8A 1W1YA 1OCJA 1W9UA 3ONCA 4GY1A 3CV7A 3K8MA 1DJIA 3O9NA 3ONBA 2CHNA 2CHRA 3BUVA 1POJA 2AOSA 3SCVA 4Q4QA 1PBGA 1XINA 3WUFA 2E8YA 3E0FA 4N6EA 4PMYA 2HCVA 4U2YA 4A3YA 1HZYA 1UJQA 3TV8A 3W85A 4NQ1A 3L9CA 4E2VA 1LOQA 1EBHA 3S2MA 1KXHA 2ZZ7A 3U4FA 4AD3A 1W5NA 4C1NB 1QI0A 3P5ZA 3W71A 3FY1A 3SECA 2D22A 3LQLA 4I7WA 2PDGA 3OZYA 5DFAA 1D3HA 4S3DA 2X09A 1DJQA 1H7OA 1X1NA 1N82A 4JX4A 4GXPA 5H8PA 4HTYA 3NQGA 3CPRA 4GMEA 3UVIA 2OQYA 3HF3A 1IGWA 4YHGA 1BYDA 3BXWA 2YL5A 3KE0A 1AL7A 1B57A 3C2FA 4O52A 4B5XA 1OC6A 3GDLA 3VDAA 1DWIM 1M03A 1C8VA 3NXLA 1BRLB 3GTNA 1KA9F 3ABZA 1PX4A 3SCRA 4B5WA 1XIMA 4ZQMA 4N9BA 4PUKA 2Y5EA 3NWRA 4ZB5A 3AJXA 3L5AA 5G1MA 2YYTA 1V6VA 2XM1A 4J2MA 1W2PA 1KB3A 2VC9A 4ERAA 1F4AA 1EJTC 5IHSA 4NX5A 4L65A 1H1NA 2EGZA 3N73A 4H8HA 3UQNA 3WH8A 3ME3A 3HG4A 4MLRA 3EPOA 3PNUA 1V6TA 1V6XA 2WWCA 4UTFA 3CBWA 4Z1BA 7A3HA 4C5YA 4NZCA 4Z2JA 2HK0A 1V77A 3T78A 1W3NA 4I5UA 2PD9A 4M6VA 4ZO6A 4GD0A 2OKOA 2XIBA 3RX4A 4PL1A 3U3HA 3B06A 3PBYA 1EL3A 2OYKA 3N34A 1NEYA 1XCFA 2GGGA 3BSGA 3C2OA 3J7HA 2VGIA 4MUPA 3UG4A 1V4YA 1H60A 1KD0A 1OZQA 1IEQA 3PJTA 2I56A 2Z27A 3B8VA 4ZO9A 1WDDA 3NM1A 2DT3A 3RILA 1XLLA 3NNTA 4QFUA 5GJMA 2WVSA 3MKKA 4RV8A 1VGAA 3CLWA 1EA9C 1GEQA 2HROA 4KBXA 3W2UA 1WBJA 5TQLA 1SU5A 4PTWA 4GA8A 4MM1A 4IJCA 3O3RA 5FAGA 1I2OA 1VRXA 2GSJA 3H53A 2ZKMX 3EOSA 2G3MA 4AXKA 4WCJA 1J12A 3CV1A 3M0VA 3MJYA 2GJXA 2G3FA 4HZ8A 3STFA 1IGSA 2R8WA 1M9HA 5D09A 4XZWA 3FCPA 5DCDA 5I23A 2FVLA 2ZDRA 5DMYA 3UG8A 2VZVA 1V79A 3FA3A 4I9JA 1W3LA 1J0YA 2V2DA 5BOOA 1QPQA 3DESA 1SJCA 2Z6IA 1J4EA 1KTCA 1S2TA 2FLIA 1EIBA 3PZOA 1EHAA 5I06A 4Q8MA 4GBDA 2FDMA 1BXNA 5T8GA 1TVPA 3QEZA 4MZ1A 3S1UA 3MU7A 3V75A 1UR1A 3CV2A 1P0NA 4GCXA 2HE5A 3LLXA 3W7RA 3WF1A 2DZBA 1J5SA 4K7VA 3OIHA 2HXUA 3VNZA 4JTAA 1PTGA 1H5VA 2I14A 4JTDA 4GKLA 4DUWA 3KOFA 3S42A 1YLVA 1E0WA 1T7LA 2ZRYA 4FLQA 1GZGA 1QPRA 2C7FA 2PDUA 4H8UA 2Y2WA 2ZX8A 3MHFA 3AZRA 4F2UA 1X7FA 3SUUA 1TUFA 3GWQA 3GTHA 5BMXA 3OEXA 5BOEA 2ZZ5A 3AS2A 5I07A 1BYBA 3BCDA 3SCUA 4XKMA 1SM9A 2A3LA 3H22A 3LNPA 4BF5A 4HYWA 5JH2A 3O6CA 5HNRA 3CLMA 4R3UA 5AHMA 3FNDA 2IUZA 2Q02A 2QCDB 4PULA 2C1GA 1ICPA 1VJSA 2VNCA 4PMJA 2A3AA 3RU6A 1PYMA 4XAFA 3C56A 3V0SA 4JD4A 3G1XA 4AVOA 3V16A 1HN1A 3E5BA 2H9AA 2XIMA 3OGRA 1M01A 2QVHA 1UD5A 1XRVA 3GXIA 2GGIA 1ISYA 2CPUA 5I3KA 2IS7A 4O1FA 4JOMA 3EGJA 3FDGA 2DT2A 4EWJA 5A8MA 3COTA 1V6YA 4M1BA 3R10A 4AU0A 5BRQA 2G50A 3TH6A 4CQ8A 3TK7A 1LLOA 2P76A 4QS6A 2AAMA 3BQ5A 2PA6A 3CQHA 1V3HA 1HP4A 5A8OA 4YYFA 1Q65A 5LNVA 3WQWA 3P74A 1M7JA 3GUGA 3W25A 3EMQA 3CXOA 1TREA 1XLMA 4UOZA 4YN5A 3VABA 1H3GA 3VIMA 1ADOA 3WMLA 3SUTA 3AHYA 2QS8A 3CO4A 1ZCCA 3UG5A 3KBJA 1XIIA 5D03A 1E73M 1MW2A 4QIUA 1KXTA 4QDMA 2EG8A 2PLMA 1OHLA 1KQZA 3C5QA 1WO2A 2XWDA 1CWYA 1LQ0A 2RJGA 2X8RA 1VYRA 2GSEA 1JCXA 1J5TA 3NQ8A 1IWPA 3VOCA 4CCDA 3C8NA 2E25A 1O6IA 2A4AA 3ICJA 1G01A 4P8XA 3LRKA 1WDPA 5LYRA 1OFBA 4W7VA 4RX0A 2O7SA 1F3XA 1W8SA 3AHXA 4AX7A 5C0QA 5D37A 4FEZA 4C6LA 3IIZA 2WKLA 3TJLA 1DTUA 1XLHA 3M1ZA 1R86A 4BWLA 2P88A 3CAWA 1CGYA 3GIQA 2VFDA 3S2NA 2IQDA 3SCPA 4MKVA 4KS0A 4EP8C 3IAQA 1W1TA 2F61A 1ZTVA 3WLJA 2OX1A 4XZIA 3RLHA 3BZGA 1GKQA 4XZBA 4JY8A 4JTGA 1QVBA 1NOWA 1UR3M 2V5DA 1S1RA 4F8XA 1E6NA 2ZVRA 2NUYA 1GHRA 3FXGA 3H4GA 2CXEA 3NVDA 2GVGA 4MB4A 4O16A 4QTGA 2GL5A 4V15A 1R2SA 3FX4A 5KITA 2ZTKA 2CLLA 3NGJA 2VRKA 4XAGA 1Q6EA 4RE2A 3UPBA 3AU2A 1TWSA 1GPWA 2C0AA 1TQJA 3KRSA 5CQ1A 4YYCA 1L0PA 7ENLA 3MW7A 1C8YA 3MI3A 2NW0A 3MBDA 1FBAA 4XG1A 2CKRA 3MC5A 2CLKA 2J6VA 3V5FA 2Z1WA 3LHUA 1AG1O 3U9IA 5EKYA 1YHTA 3A3XA 4DBSA 1TWZA 1P7TB 3THCA 3L0GA 1KFKA 1RY8A 3WD3A 4AHPA 1EC8A 3IWPA 3AUJA 2VFGA 5A8NA 3LXAA 4LAKA 4IP4A 4F66A 3N3TA 3A3HA 3G6MA 4O4WA 2CLEA 3MYOA 3N6HA 2D20A 3WLRA 1D3GA 1EXPA 4L6DA 1YYAA 1Q85A 3R0DA 4RZ4A 2V2CA 1XICA 3KRBA 2XJ7A 1FUYA 2VD8A 3FGCA 4RUBA 1J0KA 5J8LA 4U10A 1UR4A 2GZXA 2ZA3A 3H7VA 2PURA 3IRSA 4BQ2A 3WQVA 3CMJA 1RJQA 4BQ3A 1C93A 2DW7A 1REQB 5LKYA 3KW3A 2GDVA 3OQEA 5CKSA 1GVEA 2O55A 1XW8A 1XX1A 3PC0A 3INPA 3G22A 2RJHA 4EANA 4H8NA 1KBLA 1V3JA 2JF6A 3F2BA 4UFHA 2ZX6A 1WV2A 2ZOXA 1G7UA 1XLAA 4GQGA 3SFWA 2WC7A 2WVTA 5CG0A 3KVKA 4O19A 3MUCA 2VFEA 1EPVA 4PUWA 4QDPA 5C71A 2Q3OA 4HA0A 2AGKA 5HQMA 4TVUA 3GVVA 3MBFA 3GC5A 1DTNA 5E6YA 2VEFA 3LGGA 5C54A 1B9ZA 1NOUA 3FFSA 4AD5A 3WQFA 2Y62A 4UMBA 3GDKA 1YXDA 3HFTA 2OJPA 1DQUA 4HMDA 2BXYA 3PZUA 3CZLA 3CU2A 5LNRA 1OFOA 2FH8A 1IE7C 1M7XA 1JZ2A 1XIHA 1NOFA 3PN8A 3KLLA 3H4XA 3UJRA 2ZRZA 5HUPA 1H5YA 3M7SA 3UNDA 4LGXA 3KVJA 4LCQA 5CJ5A 5HNTA 3H2NA 4MY9A 4E2DA 4B9YA 2OO6A 2BHYA 3W38A 4QG8A 4E2OA 2X16A 5CEWA 3VK5A 3GXPA 4WSHA 1SSDA 4BI6A 1AJ0A 1X96A 4YLWA 2ZRWA 2XN2A 4GINA 3BLIA 1K9TA 4R5EA 3ZYZA 5D8WA 3N04A 1XLCA 3PANA 2WMIA 4TTUA 5D32A 4ZFCA 1XYMA 4RPPA 2YL8A 1NY1A 3QLLA 3H70A 2FFIA 2FGLA 3TCSA 3U7VA 1XYFA 4B2DD 2WNQA 3DYPA 4AQLA 2VVNA 1X6LA 3TMLA 5FJIA 1RLCL 1JDCA 4NG3A 3TQPA 1T41A 2EPOA 3RN6A 4C6KA 3PZNA 3LXBA 2XN0A 3W00A 1E72M 5TNVA 3M0MA 1JGMA 4HNNA 4PGLA 1PZ1A 3WLQA 4CGTA 3GU2A 3IJ6A 3GW0A 4D1IA 5DBTA 2J4GA 2YL6A 2PWUA 1F6KA 2VX4A 2AL2A 3CIWA 3GS6A 4I8YA 5JMUA 1V7YA 1MW0A 1P1XA 3NQAA 1B9BA 4IMCA 1KFEA 1JAKA 2XFFA 4DBEA 2Q8ZA 2SFPA 3UWEA 4H6EA 1KGWA 2OYMA 1XYCA 1P0KA 3TR9A 1BQGA 1LCOA 4A29A 4NL1A 3QV6A 1CCWB 1KV8A 2PDHA 1OIFA 2YCIX 1AJZA 5CPLA 1XQKA 1AQ0A 1XDMA 5DMMA 1S2AA 3GX9A 3B97A 2NLYA 2AQOA 4YWIA 2FKPA 3TN3A 1W9BM 1X8CA 4AWSA 4RPQA 2PC8A 3L65A 2JBMA 2Z29A 3MHGA 2DZPA 2QIWA 3ITLA 4KEZA 1P6BA 1JDEA 3WL1A 1JPIA 5DT7A 3DHFA 1GQNA 2FYMA 2PB1A 4J3ZA 5DEZA 2VJXA 2ZIDA 3PNZA 4GIAA 3C2EA 1SW0A 2QT3A 4W8LA 4JNZA 5BYWA 3LDVA 4HPGA 1OB0A 4G1NA 3RX2A 4CNNA 3AYSA 1VFUA 2DDXA 1ME7A 1TPDA 3G18A 1IQ8A 2A3CA 1NWUA 3QFWA 3L4YA 3R0KA 1JGIA 1X1ZA 3KBVA 4PUEA 1B3OA 4JHZA 2YDAA 2ZBTA 1NF0A 1EJUC 4NZ1A 4TV6A 3ABXA 3F5LA 4MUZA 1MQQA 1OFRA 4ROQA 2O4MA 4HK6A 4HJFA 2BGSA 4HK7A 1JCJA 2ZWZA 4UFKA 3TN5A 3EEGA 3S0CA 2V63A 1C29A 3PG9A 4EPKA 4OBSA 2VC6A 3ABOA 1Q8AA 2PGWA 4YIWA 1CNVA 4XD6A 4DF0A 2NX9A 2Y89A 1OT2A 1UKQA 1X97A 2JGQA 2ODOA 3LNMA 1PVNA 3EDKA 5HUOA 1HKKA 4LC6A 1TZ9A 4KKXA 1GVRA 1KQYA 3I3EA 3SUWA 2XIJA 3OTRA 3EEZA 3ARTA 3LMZA 3D3AA 3OVGA 4H9MA 3MDWA 4H01A 4PR4A 3DZ1A 4HVXA 2QJGA 1VBHA 2NX1A 2ACQA 4ADUA 2AQVA 4LTSA 1RA0A 3L4WA 2NVAA 3RYSA 4DJEA 3UZWA 2FZDA 2GPTA 1UOZA 4W86A 3QJAA 4NZ4A 2CITA 5JU6A 3BJSA 4CU7A 3VKCA 3GTFA 3W76A 1E51A 5B7ZA 4XIAA 4A8RA 2B7QA 3IJIA 4FP1A 4JHOA 4YXGA 4US5A 1S1PA 2I5GA 3PTMA 1LBMA 1Q13A 4IPIA 1E1EA 2EHHA 4F2TA 4CCEA 1LQAA 1SZRA 4I3GA 4AW7A 2YDSA 3LN3A 4C6DA 4W8AA 3UR7A 9XIMA 4GBUA 1FWGC 2OQHA 1CXHA 1TPFA 4RNIA 3GFXA 3EDFA 4ONVA 1HNYA 2EKGA 3VGFA 5DBUA 1QHOA 4QJ5B 2CKSA 4DF2A 4O50A 3STEA 3ZVHB 4GFIA 3A22A 1M7PA 1RV8A 1JF5A 4F2BA 3T0BA 4IIGA 3AICA 1Q6RA 2FPYA 5G2WA 4FR6A 1MDLA 2EQDA 3VE7A 4LVDA 3WNKA 3FJLA 5JH1A 1D3CA 1UWIA 4DJDA 1AD1A 3THAA 2G96A 3PZGA 4ZBCA 1V6UA 1XQLA 4U5IA 3AO0A 3U2OA 4HT3A 2HPIA 5BOFA 2VUYA 3EX1A 1I2NA 2J8GA 4ZA0A 5M17A 1AQHA 2HRWA 3EA3A 5BXPA 5CZKA 5BXRA 4GJJA 4FXRA 1NSJA 1KM6A 1DOSA 5G5IA 2FH6A 4DLMA 5RUBA 1XD1A 1XYLA 2V82A 1Q45A 1MI3A 3UEQA 4AZIA 4LF1A 3QM3A 3QR3A 4M5PA 1G4SA 4H9XA 3S6OA 3WF4A 4PE8A 2PDFA 1EGZA 3STGA 2CZEA 4KEVA 4GVIA 4Y7EA 1MZHA 4OOZA 1DJZA 4IL0A 3AU6A 3PFMA 2VQTA 4FIRA 3VC5A 4FIQA 4MJMA 2ZZ1A 4NJGA 2PF0A 1ZJAA 3W6YA 3QPYA 2WZIA 4U5KA 1RQEA 4LUSA 3W2JA 1B4KA 3UR8A 3LLDA 1E1CB 2VENA 2ZCGA 3DFOA 3EDDA 4OZOA 3H26A 1RQHA 4L80A 5I7GA 5HPOA 4Z0JA 1S5VA 3APTA 1NP0A 4GUGA 1XRSA 2WB5A 8TIMA 2C8NA 3SEPA 3S9IA 5EBAA 4ZSUA 1WDQA 2OLAA 5DX7A 3I68A 4EX4A 5LIKX 1TX0A 4HMEA 3FK4A 3HPFA 5LIYX 3P82A 1JIBA 4QP0A 5FAJA 4I5XA 1M41A 1GOKA 3EPNA 4NI8A 3KFTA 1TJ1A 4XIMA 2F2KA 2WVVA 1ZPTA 3QHNA 4RDYA 5LNWA 3B8SA 4LBRA 3R79A 3S9ZA 2YBUA 2Z1XA 5JIPA 2DUXA 3GQYA 4CN4A 1G94A 1OADA 3R11A 4QRNA 2D73A 1SZGA 2UV8G 3BLEA 5PTDA 1YEYA 3GKFA 3RHGA 2QYGA 2PDJA 5LNUA 2JKPA 3QSRA 5EL1A 1ITUA 5AB3A 3TZFA 4GXMA 4AEFA 5HMFA 4C6MA 1HJVA 1XH1A 1LYXA 2J77A 1V02A 2Q01A 3SRDA 2WW5A 2V5JA 4I8DA 1L8NA 5HPCA 3CZKA 1MW3A 3N9SA 2XGBA 1EZ2A 4GVGA 1E9LA 2C18A 2ISSA 4PTXA 3VKDA 4P8WA 2ANUA 4JEQA 2XHYA 3DFQA 4PUUA 3VFCA 1IEVA 2EXOA 4L9YA 1H41A 1GG0A 5CBIA 4K3ZA 2D0HA 3NTYA 2CCRA 2GOKA 2QHAA 3EX4A 1WZMA 4X9YA 3GFYA 3QH2A 4M3PA 3W7QA 6REQA 1WXYA 4PZVA 4H19A 5AC8A 2Y5JA 1N8WA 3SY1A 1NQ6A 1TFVA 3GB6A 4DLFA 4ZQNA 2VX5A 2UBPC 4XBKA 1KR0A 3FDKA 2EAWA 4P7OA 1KM2A 1KKOA 3ZFHA 2O92A 1M65A 3NZPA 4L5ZA 3OGVA 1O66A 3E2RA 3BWWA 1S2UA 4UB9A 3BQ6A 5H8MA 1KM3A 2Z7GA 3IEBA 1SPQA 4DO4A 2BGQA 4NAFB 4DYJA 2FJUB 4D6JA 2E6DA 5LA0A 3SJ3A 3TCEA 3H54A 3LI1A 1UQZA 6TIMA 1X6NA 1RBOB 4LB4A 4AZ5A 5F2GA 2CIPA 1EF3A 2ZUSA 3DGRA 1TV3A 3WF3A 4KWUA 1N55A 1QNRA 2XZ7A 5GVJA 3WUBA 1C9DA 5C9WA 3GXFA 4DBWA 4PB4A 2DSWA 4IUOA 1QMLA 4PMNA 1NM9A 2OZ3A 3HFYA 1VEMA 4H1ZA 4H7ZA 3O1NA 5A2CA 2V5CA 3QMRA 1YNPA 5LA2A 1B3XA 4PRRA 3GKAA 3T8QA 1UROA 5HWJA 2JIEA 3ZR6A 1JEZA 2ATMA 1J0JA 3GG1A 2XGZA 3UWYA 3E2VA 3VA8A 4XISA 4FPSA 2BP1A 4LRTA 5I00A 2XVNA 3VOFA 3W72A 3MMDA 1JQVA 3AOFA 2I9UA 1PCKA 3EWZA 2C79A 3LCHA 4IXXA 4UTWC 4WKHA 2ZA1A 1GHSA 5F1VA 3LPPA 3NVTA 4RZ5A 4I9AA 3DUGA 2E1WA 1KM1A 4TUFA 3H21A 2NSXA 5AKQA 2VX6A 3LS9A 4HU3A 2CBVA 3SRFA 2QCFA 5AZ0A 4URIA 2XH0A 3G24A 1PE1A 3W1UA 1HL9A 4X2PA 4XD3A 2Z1SA 5BXSA 1UW9A 1XLFA 4X22A 1DBTA 3NZ1A 3QPZA 3MWAA 3P14A 3DYMA 3MY9A 2VKZG 2PWGA 2E5BA 2D24A 3NQ2A 3M5ZA 4JPGA 1DXIA 1E6QM 2WCGA 2OB3A 4GY7A 2CWNA 2WZMA 3FSTA 3RJXA 1TA3A 3MTWA 1TTJA 3CUHA 1KBJA 1LWHA 1WXZA 3BICA 3MSDA 4DYEA 4EOUA 2VCBA 5AC4A 4P5UA 1I2PA 3GC2A 3A64A 4BCEA 3W37A 2BG5A 1XBYA 3WJZA 1VIZA 3N1AA 3JRKA 4OHQA 5HDRA 1U30A 3QF0A 1F4HA 2F6KA 1K7FA 1Q2SA 3C52A 2PRLA 3EWBX 3OLDA 1VBGA 3V0UA 1A4MA 3TTQA 1QI2A 4HU8A 1S2VA 4D6DA 3HMJG 3BJTA 3N29A 2J8FA 3OB8A 2R14A 1V3KA 3VX0A 2RDTA 4UFIA 1TRDA 2P3ZA 4D8AA 2WZTA 4MNMA 2XFRA 4H9TA 3WLTA 2RAGA 1L2UA 3V18A 5T9CE 2O7QA 1V3IA 4JIQA 2V5KA 5DY2A 5I79A 1TCMA 1OCNA 4GRSA 4DWSB 2CLOA 1FA2A 2I1OA 4ERIA 3THQA 3KOWA 3AIUA 3MCNA 3LB0A 3NCOA 5HWMA 4LOCA 8CGTA 1G1YA 4IFKB 4WY0B 2BNJA 1QBAA 5CGMA 2PMQA 3NQ6A 1FDJA 1J6PA 1QOQA 3W1NA 4DUXA 4ICMA 4MPKA 5AOUA 2WBGA 3QHOA 2HZGA 1KTBA 3F2CA 4YS1A 4ZXOA 4BEUA 4JFTA 3VFLA 1EJ7L 4XD5A 4IG2B 8XIAA 3P80A 4ORIA 3RG6A 2D2OA 3EOEA 3WQOA 2WSYA 4BEQA 1LG2A 2ZRVA 5EU9A 4NUWA 3HQNA 3LBMA 1HKVA 5HMDA 3M5YA 4HNTA 4DY1A 3QOMA 3W87A 2DW6A 4AEOA 1ZBWA 4AY1A 3OG3A 4DN1A 3WLLA 3W1QA 1EYEA 3ID7A 2FZNA 1A5BA 3HMCA 4Z2GA 2XFYA 3S5OA 5CZ0A 4HA1A 1UPPA 1E5JA 1MEIA 2WMKA 7XIMA 3MKVA 3MUIA 3BLDA 1VP5A 3SCQA 1RY0A 4ACZB 1Q3NA 1QK0A 1ZUAX 4QAIA 3WJXA 4LYPA 4GGBA 1EO5A 3XISA 4O18A 3RX3A 1W3JA 4P7RA 5H91A 3QPEA 4YPJA 2HBXA 4C91A 2PWEA 1GORA 3USZA 1GJWA 2IKHA 3G1YA 4Q8TA 4DJEC 3UW6A 3FEQA 4BI7A 1PL9A 5G2IA 4DELA 1FXPA 1TPUA 2VR4A 1DORA 5BZAA 4XAYA 1TJRA 4C6OA 4MFEA 2I5QA 1WX0A 4PCPA 1BG4A 1S46A 2A3BA 3TQVA 3TQ0A 4J27A 1R47A 1BKHA 1FCBA 1WUFA 3IIVA 4KPLA 3V5CA 1X6UA 3PZMA 4JN8A 2Y8UA 3GXMA 5C9ZA 3ANYA 3HQPA 1H49A 3H2OA 1US2A 1JVNA 3T2PA 3UCCA 1K7EA 3CWHA 5M1TA 3GTIA 4A8LA 3VE9A 3LSBA 5DANA 2D2HA 3RDKA 1C9WA 3L0NA 1NIUA 3WLNA 3HIJA 1JZ7A 5A94A 3BG5A 2QAPA 1C7SA 4L64A 4OOUA 3H2EA 4XX6A 2R94A 1WZLA 1CGWA 4MKSA 4Q8WA 4ZCWA 4DJFA 1R6WA 4NNAA 3EKZA 4AZ6A 3TOYA 3KX6A 2YX0A 2HSAA 5I09A 5F4WA 3FVMA 3ARUA 1K8ZA 7REQA 2BVTA 1KCZA 4REQA 3WEOA 5KINA 1AJ2A 3VNJA 2EEXA 3UGVA 3U48A 2OG9A 4AWEA 1CIUA 5FJRA 4C7FA 5A6LA 4Z1DA 3TC7A 1J2BA 1FH7A 4DXVA 3PS7A 2QJHA 2YW4A 3O6YX 3GW3A 4B16A 3N2OA 4MMWA 5HA7A 3K8KA 1VFTA 1JPMA 1O4UA 5EB8A 3TNBA 4H6KA 2PF8A 1J96A 3IVTA 4LAZA 5AN7A 1H1YA 4C6QA 5I3DA 3L23A 3WQ5A