1SG5A

Solution structure of yaeo, a rho-specific inhibitor of transcription termination
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
86
structure length
86
Chain Sequence
MSMNDTYQPINCDDYDNLELACQHHLMLTLELKDGEKLQAKASDLVSRKNVEYLVVEAAGETRELRLDKITSFSHPEIGTVVVSES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of YaeO, a Rho-specific Inhibitor of Transcription Termination
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural genomics, transcription, protein binding
molecule keywords orf, hypothetical protein
total genus 6
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2004-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07073 ROF Modulator of Rho-dependent transcription termination (ROF)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.400 Mainly Beta Roll SH3 type barrels. Rof-like 1sg5A01
1SG5A
chains in the Genus database with same CATH superfamily
3OYEA 4PJMA 1UEBA 2E6NA 1G8XA 2OTJA 3QDRB 5LJ5e 3L2ZA 1W2BS 2EW3A 4E2FB 1H3ZA 3OSVA 4PJNA 2OJ2A 1AT1B 1VQ5Q 3JCMh 2QQBA 4JZ4A 2WSFE 2KBTA 2X4JA 4C5EA 1FMWA 1YJ9Q 3UDCA 1VQLQ 4PJJA 4XU1A 3QG1A 1UGSB 2VYTA 2KVQG 2YXYA 2CUDA 3X20B 4QQ6A 5GANd 3O8VA 1E6GA 4J9DA 2KI7A 5LL6S 5KE3A 2I0NA 1Q82C 1NM7A 1GCPA 1RAHB 2RK1A 1B3QA 1UB4A 4R0KA 1VQ6T 2JM9A 3T9NA 3M4GA 4J6WA 5GANe 4ORZA 4XTZA 5GAMf 4J6YA 3SEMA 5J3BA 1H8KA 1WA7A 2KE9A 4E6RA 5GMKh 4M75E 1IGUA 1T3LA 4J8OA 5IHIA 4B9WA 2EBPA 4Y91A 3V8KA 1C0MA 4BE0A 4ZNXA 4C8QF 2FZGB 4ELYC 2EVRA 2K57A 5GAOr 3OYHA 1PKTA 1VQ7Q 1M8VA 1X2QA 2HNIA 1M3CA 1LVKA 3H8ZA 4OVAA 1WHJA 4RCCA 1K73R 1BBZA 3RERA 1RUWA 2D0QB 5GAN4 1Q7YC 3RBBB 2MAMA 2QTVA 1RADB 3VYGA 2MI6A 2GFAA 1VOMA 2DM1A 5KCOA 2QXFA 1XTDA 1YJWT 4WCIA 3P8HA 2RQWA 1KHIA 1NZ9A 2ZPEB 2MWOA 4C92F 2P4RA 3MHXA 4OP0A 3CCET 1G3TA 3CXCA 3PFSA 4JUVA 4JRQA 2P0KA 3SDZA 2EKOA 2AKKA 4JJCA 2LCLA 1NPRA 3FLGA 3CD6Q 1WHKA 2O9VA 2CZ1B 2R58A 3PGGA 1OPKA 4QT7A 1D0YA 1PHTA 3I55T 3OW2A 1K76A 4C0GA 4A4EA 2LJ1A 3KUFA 2RHYA 4ZTJA 4MDXA 1OX9A 3I55Q 3M0PA 1E6HA 2XU8A 2V8KA 3NTKA 3VUZA 4BDYA 4HT8A 3UT1A 1ZSGA 2K5IA 1U1SA 1K9MU 1MV0B 1W2BP 5D6WA 2QG9B 2IPOB 2DJQA 1MNDA 4NL2A 2ABLA 2DNUA 4PLIA 1YCYA 2HSEB 1TUDA 1BK2A 3P8BB 4RKUE 2DK3A 4JPBW 3CPFA 1MMGA 2O4XA 2QQAA 2FEIA 3ME9A 4M77G 2DZ9A 1VQLA 3MPUB 2LTOA 3JCMP 4VUBA 3OA6A 3EH1A 4F17A 4IIOA 3G6EQ 1Q86R 1U3OA 4WF2A 3VU3C 4C8QG 1J3TA 1Y7XA 1X27A 2IVWA 4CC2A 1VUBA 4C8QB 1S72T 4M7AF 3OMCA 3DB4A 2JS0A 2EGEA 4PK4A 2H3JA 5GAN3 3VV0A 2KGTA 4LE9A 2KK4A 2X51A 4JJDA 2DTOA 4TVRA 5DY9A 3WVEB 1YP5A 3GNFB 2RQRA 4KGZB 5GMKl 5HY6A 4M7AG 2R5AA 1YN8A 1M1GA 4D8DA 4FSSA 4BD3A 1FMVA 4CC3A 4OF1A 2EPDA 2K3XA 1FX7A 4PFOA 3JCMX 3GNGA 1YIJA 2CP7A 4ELZC 3OYJA 3O5ZA 7AT1B 1ABOA 3CMEA 4PJOC 2CH4A 3CBOA 1YJWQ 1NYGA 5CKEA 1I5OB 3WVDB 2BE7D 3I56T 4ZGEB 5GMKi 4FT4A 1SEMA 5KYXA 1A0NB 2AT1B 4J9GA 8ATCB 2RI2A 2ZZDA 3QPHA 4M77E 4RG8A 5FWBA 3KFVA 3SFMA 1SRMA 3PTAA 3I56Q 1I81A 3G7ZA 1SPKA 1YBYA 2PVOB 1YHQT 4J9IA 2DXUA 1YWPA 3PIOA 4LUEA 5CVIA 1VQ5T 1KJWA 4HVWA 3EGXB 5LJ5d 1M90C 2JJ9A 2WSEE 4IURA 3HKSA 1VQNT 2RHXA 3BW1A 4AT1B 5IH2A 2O01E 5I21A 5FRMA 1ZSZC 1WNLA 2RHIA 3UA6A 1YJWA 5GAOn 2FPDA 2X3XD 1Q7YU 1PD1A 4X9CA 2JXBA 5LJ5j 3CCQA 3FIFA 4IUPA 4C8QA 1K73C 2A37A 4LD6A 3BFMA 4EMKC 2XKOC 1GFCA 2LCSA 3I5RA 2JUFA 3OMGA 1I0CA 5M9OA 4OMLA 1QW1A 3JCMV 2ZAEA 2YT6A 5GAOq 2FL7A 4F7UB 1VQPA 3CCEQ 1Y0MA 2GQIA 1D0ZA 2MYSA 3HTRA 2OTLQ 2PVGB 4RTVA 4C92A 1M1KC 4OMNA 1OOTA 2VVKA 3H0HA 1IHVA 1VIEA 1RAAB 3V7RA 2E10A 3X26B 1JB0E 2DO3A 3JCMJ 1TH7A 2YSQA 1IHWA 1WFWA 2JMCA 3N5BB 3G71A 1M2VB 1UG1A 4PJOF 2CGHA 3I5SA 2D8HA 2VXFA 3A8GB 2G3RA 4PFZA 5A0GA 2RI3A 4CI0C 3CMEQ 3I9QA 2O4XB 1QVFA 1E7OA 5GAN7 5GANf 2M0OA 2DA9A 3VS1A 2BKDN 1AWJA 1UJ0A 2KYMA 3QUIA 4NS5A 1ABQA 2LMJA 2E3IA 5FU7C 3REAB 2ZPIB 3TSWA 2EKHA 1HK9A 1V29B 4A4GA 4FT2A 4FSXA 2RK2A 4Z88A 1G3YA 1M3BA 1N6AA 3PNWC 4HCCA 3R6NA 3CCRT 3JCMg 1X6OA 6AT1B 1W1FA 1Y96A 3CD6T 3JCMe 1MMDA 4M7AC 3M0UA 1VQOT 1YNZA 4M7DD 1WZOA 2CP2A 5GAN5 2KMTA 4RMOA 2SRCA 1WJSA 1G3SA 4DBRA 1ZUYA 2HDAA 4DBHA 2HL5C 3CC4Q 1QVPA 1ZSZA 3OSSC 1BIBA 2W10A 4J7IA 4ZN3A 1N8RC 2X4XA 3MEWA 1PSFA 4F7UA 4M7DC 2PNIA 3R6OA 1TXQA 2JOYA 4V2SA 1WDXA 3NPFA 1G83A 1G5VA 3M55A 3EGDB 1K4US 1PRMC 1D1AA 1WHMA 5IN1A 3EG2A 3NGPA 1M9SA 3EHRA 1JXMA 1V1CA 3UA7A 1VQNQ 3G4SA 4M7DB 2OTJQ 5CKFA 4RTZA 2COZA 4RTUA 5GAN6 1B34B 2HQEA 1WHGA 5I2MA 2XIDA 3M0QA 5LJ3j 4QQDA 5GAMj 1OV3A 1R8OB 2ROLA 1KD1C 1GCQA 4JS4A 3NTHA 3L1AA 2RMOA 2C06A 2R57A 2E4HA 1RL2A 3CCJT 4JRIA 1KK7A 3HP9A 2QYZA 1YJ9A 4HKEA 2LZ6B 1KIKA 2FZKB 1JEGA 2CZ7B 4Z02A 1M2OA 2W0ZA 2PUOB 2MPXC 3QWXX 1Q86C 2DIGA 1OEBA 1VQNA 3L2RA 3E1SA 1B07A 4DEXA 3G4SQ 2BE9B 2E70A 5CIUA 3QXEB 2VASA 4C92C 1OU8A 3VUBA 2YUQA 3TCJA 2CREA 3HRTA 2GQVA 3CCRQ 3CMAA 2BZ8A 2LC4A 3GIBA 1YJ9T 1AZEA 2L8DA 1WQ7A 1PKSA 3RDVA 2P4TA 4QVDA 4KUDK 3PE0A 4FCYA 1BB9A 4JRKA 3CC2Q 4M7AA 1GCQC 4C92B 3HHTB 4F14A 2Y90A 4GY5A 3OS0A 2DXBA 3RUXA 5FROA 2COYA 3OW2P 5I11A 3RKYA 3PVLA 2PTKA 5D6YA 4OMFB 5CK9A 1M2VA 2L89A 1NEBA 3MEUA 3CCVA 5CKHA 3QIIA 2CSIA 4AFZC 3JB9F 3QKJA 1SSFA 2PQWA 1JJ2P 4PJLA 2EQIA 1WHLA 2A36A 4OGCA 1JJ2S 2HBPA 4JLGA 5KYNA 3SD4A 2QEXT 2C0OA 3OYCA 3JCMW 2VKNA 4JRPA 2GFUA 3THKA 3NMZC 2M1HA 1UTIA 3OYBA 2E65A 3GF5A 1KFZA 1UJYA 3CCVT 2WSCE 4FW2A 4XTWA 2RJDA 2GTOA 1QQJA 1YI2A 2EWNA 3PT9A 1H3HA 3SWNB 3CCSQ 1YITA 1YIJQ 1ARKA 2FZCB 1RI0A 2AHJB 2M9UA 4D8KA 3E2UA 2CSQA 1X01A 3CCMA 5EC7A 2HBWA 1PM3A 2JT4A 1TSFA 3QZ9B 2RJEA 5KCHA 2K7AA 2COWA 3M9QA 1JJ2A 1D0XA 1KC8C 2ATCB 2F2XA 1VIFA 4RCBA 1BI0A 2LQNA 3CXCP 1S1NA 4PJOB 1VQ7T 2A08A 1K0XA 4OMPA 1HSQA 2RO0A 3OYNA 1IZ6A 2ZCFB 1GBRA 3VS0A 3MP6A 5LJ3f 1JBMA 2C0IA 5KE2A 1YITT 3J81E 1YJNQ 1RAFB 1U1TA 4RTTA 1TG0A 3H0FA 1H641 1PD0A 4N0AC 2CP5A 5GAOl 5GAMg 1QP3A 1M1KU 3LLRA 1Y07A 5LJ5f 3G4ST 2HQHA 1PWTA 2JTFA 2WACA 5LJ3e 2JMAA 4M78B 1VQ7A 2CH4W 1VQ6Q 1N9SA 3CBPA 3LGFA 2LNHB 4C8QE 3EG9B 1GRIA 4M78G 2HMAA 5A2QE 5CQXA 2F2VA 4DBQA 1Y57A 3PIPA 3GPLA 1HD3A 4LUDA 4QKUA 1O9SA 3H41A 2RF0A 4FL6A 4LDVA 3M56A 3OYFA 3I55A 1OU9A 1W2BA 2JTMA 5HK3A 3QJ6A 3L2WA 4QVZA 4BE1A 4D6WA 1ZUUA 2YUNA 3QWYA 5C0MA 4KH1B 1FXXA 2KR3A 4M77C 3M0SA 4Q5WA 3CCEA 3LH5A 1S72Q 4M7DA 4M75C 1SHGA 1U8RA 1X69A 1RAIB 1UHCA 4WTOB 3TQ7P 4BI3A 2JS2A 2DE0X 4M77A 5GAOm 3C95A 2RNAA 1VQPT 2BZXA 2CZ6B 1VQ4A 2CUBA 1XJWB 2KT1A 2LX7A 4OMQA 3DLLA 3CCMQ 5KH6A 1UGRB 4IIMA 4J9CA 3CEYA 1UFFA 2RHUA 3OYLA 2V8IA 4P5NA 1QVFS 3CC2T 3MO8A 3GP8A 3VKIA 4QQGA 3UATA 3EG1A 2EGAA 3L2UA 1VA7A 1RLPC 4CC4B 3PVQA 2CP3A 2KROA 2CT4A 2QDLA 5GAMe 2IIMA 5DLQE 1VQ4T 1S72A 2K9GA 3META 2E12A 3BE3A 4O5VA 2HAXA 3OS2A 1B34A 2B86A 4N0AA 1WQWA 1EIFA 4PFPA 3QDFA 4KULA 1KSWA 4AG2C 3JB9H 3RKWA 1CKBA 4RTXA 1WGSA 2QI2A 3TSZA 5KYUA 3HFOA 4C0DB 2FPEA 1ZHIA 4M75A 3CCVQ 4C5IA 2RPNA 1TUCA 3ZL7C 1KHCA 3OY9A 2GGRA 2BIVA 2RJFA 1M27C 2V1RA 3V8LA 5J39A 3OYAA 1VQ9A 1ZSZB 1NYFA 5HKCA 3UF4A 3TU4K 2EIFA 3EFSA 2YHTA 9ATCB 3CCMT 2M16A 2G6FX 3M57A 2EFIA 2DBKA 4GLMA 2LJ0A 3OW2S 1EZZB 3LH0A 2KRNA 4EMKB 4A54A 2QQSA 1VQ9T 1YIJT 2NUTB 2EAYA 2CKKA 4OB3B 1VQMQ 3M0TA 4J9EA 3QYHB 4B9XA 5CCAA 4HVUA 3QYGB 1M5Q1 3EHQA 1OULA 4L6V5 4PJOE 1HJDA 2CYZB 4XTXA 3M4YA 1Q82R 3CC7T 3EFOA 1AWOA 3OYYA 1I1JA 4L5GA 1HXDA 2YUOA 1K0SA 1Y71A 2XK0A 4E7LA 4A4KA 1VYVA 3CPWP 3V7SA 2QEXQ 1YFNA 5FU6C 1G3WA 4XU0A 2YLCA 5L8RE 2L3RA 3CPWS 4XQ3A 2YUPA 2E64A 1C6VX 5AT1B 1KQSA 4F7UF 3G1JA 2EJGA 2J6FA 4M78E 2LX9A 3AT1B 2QA4A 2DL8A 3VRYA 3A8OB 4AG1C 1VQ4Q 2D9TA 1OYXA 4JJBA 2EYQA 1RABB 4AFUC 1QCOA 2KRSA 2BUDA 3X25B 2LRQA 2X4YA 2E1HA 4XTUA 2K79A 2YRDA 4A63B 3LWHA 3RESA 1NE8A 2DL5A 3A98A 3JCMQ 3ZFJA 3CPWA 2DL3A 3EG0A 2C0TA 3NHNA 4DOWA 3E19A 1G2BA 2B8AA 2JVVA 2RHZA 1KQSP 2E5QA 2AZVA 1GL5A 2EQKA 1VQKA 3CC2A 4RG2A 2XDPA 3RMQA 4AFSC 1BI2A 4ZGDB 1TOVA 5C6SA 5CQYA 2D8JA 3A8LB 5FU6B 5FWCA 1EFNA 4CC7A 4FIBA 1I4K1 3M59A 3MKDA 1LCKA 1Z9QA 3CCLQ 5I22A 2KQWA 4M75B 5LJ3g 4C0FA 1BYMA 1T0HA 2DEQA 1VQKT 3CXCS 1UGQB 3WXMB 2GBQA 3VS7A 5D7UA 4E7SA 4C5GA 4M7AE 1K8AU 3DB3A 5KYYA 1M8MA 4ZTFA 5GAMd 1OZ3A 2HQXA 1T3SA 3S6WA 1UUEA 1QCFA 4JJNK 1BI3A 1X6GA 1K9AA 4Z89A 2HKNA 1BCOA 4MZTA 2ZPHB 4M7DG 3X24B 3JAME 5LJ5h 1QVGA 2RN8A 3RNJA 4KT0E 2OTLT 2X9HA 3TVTA 3VJPA 3NFCA 2M0YA 3REBB 3UPUA 3G6EA 1Z9ZA 4RUGA 4LD9K 3P8DA 3RKXA 1UE9A 2ESWA 4HXJA 2HZYA 4M77F 2EQUA 1ZBJA 2LQWA 4C0ZA 1IB8A 2EYZA 3OYGA 1AZGB 4RTWA 1N5ZA 3OYKA 3I35A 4JZ3A 1QMCA 2DBMA 2OTLA 1UGPB 1FMKA 3JB9J 4HCZA 3G6ET 2ECZA 2M51A 2RD1A 1QVGS 3ULRB 2K3YA 1D09B 3MP1A 1RACB 1M90U 3NTIA 4BY6B 1KC8R 1NG2A 2DLPA 4X1VA 3VS4A 3BDLA 1IREB 2DYIA 1R0CB 1OX8A 1MMNA 2M02A 3OS5A 4N4GA 3QZ5B 3HL8A 2VXEA 3S3NA 2QDYB 4BY6C 1IXDA 2X4WA 2NUTA 2OTJT 2QA4T 1W4SA 4EDUA 2DYBA 2RJCA 3M53A 4K11A 1KQSS 3JRZA 4R56A 1K9MR 3CCLT 2DD5A 8AT1B 1WXTA 2F5KA 3MP8A 2DETA 1RAGB 3A1PA 2EGCA 2XMFA 3CBMA 4C92G 2KAFA 2V8JA 2LQ8A 1NLOC 3CC4T 2J7IA 3CD6A 1WJRA 3SWNA 5L23A 2K2VA 1I5LA 3PMTA 2CS7A 2AIRB 1VQOA 2LVMA 1X75C 1YCSB 1BIAA 1D3BB 3FC3A 3MEAA 2VB6A 3CCLA 4M77D 4X9DA 1K8AC 4KGVB 4DOVA 4PLLA 3HSBA 3H6ZA 2FHDA 3LX7A 4DA4A 2XDBA 3I56A 3UWNA 1AWWA 2YWWA 2A0FB 4FU6A 4CRIA 3H9NA 2NUPB 2DKGA 1VQ8Q 2QK0A 3ER0A 1YHQQ 2QEXA 4C92E 4R55A 2HEQA 3OYIA 2JN0A 1BU1A 3LWIA 4EIKA 1O75A 1ZLMA 3VRZA 3URGA 2R5MA 3DKMA 3C4SA 1VQ5A 2ZPGB 2HD0A 2P84A 2DXCA 2OX7A 4BACA 4GBQA 4EPCA 2EYYA 3EGDA 3MCAB 3J80E 4Y92A 2FRYA 5GANj 1TTHB 4L59A 5D6XA 2X3WD 1LJOA 4EMGA 4PNOA 2DERA 1OI1A 3L42A 1XNIA 3CCSA 1YITQ 5GAMh 1QCNA 2NUPA 3SB2A 4E7KA 3EH2A 4MMLA 2LP5A 3TREA 1Q81C 1VYUA 2DZCA 2VC8A 4M78F 1ZBXA 1GBQA 1WXUA 4HCKA 2VUBA 1Q81U 3L2QA 1VQ8A 4A53A 2OAWA 2XI9A 1AEYA 5GAN8 2DL7A 4GLKA 3S3MA 3FJPA 4UC4A 4MDWA 5IHKA 4E7IA 2KY9A 1UGVA 4E7HA 5FW9A 3GOXA 1SKUB 4J6XA 2L3PA 3CMAT 4C5HA 3FDRA 1OPLA 2YRVA 3HRUA 1WHHA 4Z8AA 4M78C 2CZ0B 1EX4A 1WIEA 2JW4A 4BDZA 3KBGA 1N27A 1N8RR 1W6XA 2F1LA 1WYXA 2I2LA 3CCQT 2DRMA 1YI2Q 1NJIU 3OQ5A 2YLBA 2PZ1A 1DJ7B 3G71T 5LJ3h 2XD0A 2XG8D 2MMPA 1N8RU 1YJNT 1D1BA 4JDSA 3FRNA 1M3AA 2YDLA 3OBWA 4BI8B 4QW2A 1ZA2B 4LDWA 2NUZA 2JM8A 4M7DE 1SHFA 2VGMA 1Q82U 2OAUA 2MF2A 5LJ3d 2A3LA 4FW1A 4KUIA 3E9FA 2NLUA 5CR2A 3PMIA 2VV5A 2E3HA 3U23A 2L2PA 2KXDA 1Q81R 1Q7YR 3D7SB 2KT8A 1TWBA 4LN2A 1LOJA 3LYIA 5ECAA 1D1CA 4FYVB 1VQMA 4M7DF 1JO8A 4M78A 2E6ZA 4F04B 5CO7A 1AWXA 5IHNA 3JB9G 3CCQQ 1YI2T 4B6MA 5FLXE 1VQ6A 4JLIA 2MCNA 3QO3A 1X6BA 2RQUA 1ACMB 5CKDA 1NJIR 1R77A 4O6JA 1K1ZA 1PCXA 1M1KR 4M78D 1QKWA 4A4HA 2J06A 2RB6A 3M0RA 2QAZA 4C92D 3J7AF 2VGNA 2MOXA 4KBMB 2DILA 2CT3A 3EG9A 2DAQA 1YHQA 2F69A 1MGQA 2HL3A 1VQMT 3EG3A 5FRNA 4E47A 1QLYA 1QP2A 1OZ2A 4J5YA 2O88A 1WI7A 5IT9E 1JXOA 2MK5A 2DFUA 2K5FA 2O9SA 3RIRA 4N4IA 3V7CA 5KYWA 3IQLA 1QKXA 2O2OA 1MHNA 4PJOD 1M1FA 1JRIA 1K73U 2ED1A 3HFNA 3C0CA 3EGXA 2JNGA 3E9GA 4C0DC 1X2KA 1X43A 2K3BA 1U5SA 1IO6A 3KXTA 2DX1A 4X34A 1T0JA 1C1AA 2GTJA 3BDUA 4KRTA 3L2VA 2KYBA 2XICA 1AD5A 4JS5A 1KC8U 3JB9D 3LGLA 3S3OA 4BE2A 3GLXA 1TS9A 3CCST 3OYMA 4FM4B 4E7JA 2EJ9A 5GMKe 2DJZA 4HVVA 4DQ2A 1JU5C 4EMHA 1KQ2A 2HCKA 1QVGP 1KQ1A 1XQHA 4ANJA 2XDDA 3FB9A 2DL4A 3JCMc 1VQLT 1MV3A 5CKBA 5EG2A 4ZN1A 1AOJA 2F2WA 2Y4XA 4PKCC 2CP6A 2RQVA 1WPYA 4XU3A 3M5AA 2ZPFB 3INZA 4QVCA 1ZA1B 1KD1R 3FJ5A 4LNPA 4EMKA 2L0AA 2PVDB 4FYXB 4OGEA 2BZYA 2DVJA 4DEYA 4FYYB 1TU0B 3CCRA 4M77B 2H3EB 2JZ2A 3JCMb 1YJNA 2D0NA 1LPLA 3JB9I 2J6OA 1NPPA 4M7AB 3VS5A 1RI9A 2FG0A 4PL6A 5HK0A 3G71Q 5AYFA 3JCMd 2KRMA 1NEGA 1PNJA 1SG5A 2RA2A 1PRLC 3CC7Q 1F1BB 1R0BG 1UHFA 3OS1A 3CCUA 1Q95G 5HCKA 4M75G 4IKFA 2LQKA 4XTYA 2EYWA 1JQQA 3CQTA 2IG0A 4AFQC 4J9FA 2J6KA 2ROTA 2RM4A 4OMMA 2RI5A 4LDUA 5IAYA 2DRKA 2VWFA 5GJVB 4KH0B 2DXTA 1KD1U 3CCUT 2YRCA 3C94A 4N4HA 3A8HB 3QJYA 2H8HA 2QGFB 4J7FA 2QQ9A 4DBFA 4OB0B 2O31A 3CCJA 4LXCA 1Q86U 2K4YA 2L5QA 4J9BA 5IXFA 1FWZA 2P0QA 5GMKj 2LJ3A 1LNXA 3X28B 4RTYA 1TUGB 1K9MC 1NJIC 2Z0WA 5CAIA 2AK5A 2HKQB 3A8MB 2D1XA 3SWNC 5KYXB 2QTXA 1PSEA 2NWMA 3EFRA 2KEAA 4OMOA 4IUUA 1I07A 4NOYA 2FO0A 1GFDA 3A5ZB 4OB2B 3ASKA 1MMAA 1VYTA 2L3SA 3OB9A 2V1QA 4HCBA 3CMAQ 4C8QD 2JTEA 4IUQA 1M30A 2AZSA 3FEOA 5J26A 1VQ8T 5A0LA 2DVEA 1U06A 1WLPB 1WX6A 3M58A 1K8AR 3CCJQ 1VQOQ 3DLMA 1VQKQ 1PG5B 1MUZA 3AHUA 3QSUA 2CP0A 2P0PA 4M4ZA 3EFOB 3Q1JA 2FYKA 1XOVA 1NBEB 4BB7A 1D3BA 2K6DA 1UECA 3VS2A 2K2MA 4XAXB 3RR6A 1WJQA 4F7UG 4IUTA 2KNBB 5A0DA 2K5LA 3EGUA 1ZX6A 1YWOA 4BUGA 4ESRA 1CSKA 4KGXB 4AMCA 1QWFA 1H92A 5GANh 4J83A 4M75D 1VQPQ 5LJ5g 3ZBDA 4MZPA 2DTIA 1NLPC 1I8FA 1WXBA 5DLOA 2OI3A 3QBYA 2DD4A 5KYYB 5DM7R 2ZPBB 2FVUA 3ZEHA 3EAEA 3F70A 2PU9B 4PJOA 3RMSA 1GXIE 1RLQC 1SSHA 2DIQA 1M90R 4OB1B 4HT9A 4HA8A 3JCMf 2KSSA 2QASA 2ZGWA 1RAEB 2LDMA 5GJWB 4ATOA 4C8QC 4FYWB 2AKLA 1M4ZA 1ZUKA 2E5KA 3MJXA 1V76A 1AVZC 2SEMA 4LDYA 3VS6A 3C12A 3GBQA 1QVFP 1CKAA 5GANg 4XU2A 1AHJB 2A28A 1B7TA 2CDTA 2KDSA 4NL3A 1HYOA 3LW5E 3CMET 2Y4YA 2ENMA 2RH2A 4ME7A 5GMKm 2EJFA 2HSPA 2QGGA 3OYDA 2LT1A 2LNVA 3VYHB 3TEEA 3HPWA 3MEVA 2QA4Q 3CC4A 1SRLA 2J05A 1W70A 4II1A 3HRSA 2DMOA 3V8JA 2EQJA 3VS3A 2LT4A 5GAN2 2DPPB 4A4FA 1KG1A 1UDLA 5KYWB 2GF7A 2X35A 4M75F 3CCUQ 4BI4A 5IXBA 1PC0A 3M54A 3QHSA 5KYUB 3JSCA 1BKBA 1QWEA 1SF9A 2F5TX 4ZGJB 1BI1A 2XHCA 2V26A 2ED0A 1FYNA 4MMKA 1IGQA 3SHWA 4XK8E 4IUVA 4F7UE 3JV3A 2QQRA 2FRWA 2GNCA 1BCMA 2GCXA 1MNEA 2BTTA 2DF6A 4Y28E 4PJOG 3OBYA 4XTVA 1Y96B 4F16A 1P92A 1N9RA 4J9HA 4YTLA 1OQKA 2FB7A 4LDXA 2EQMA 4MZMA 2DTHA 2L3QA 2EYXA 1ZQ1A 2LCCA 3BY7A 2PUKB 2MIOA 3CC7A 2MWPA 4M7AD 5GAOp 2RQTA 5I2SA 1IRXA 2FPFA 5FU7B 2NYSA 2A7YA 2E41A 4E7ZA 1VQ9Q 2D6FA 2DEUA 2KXCA 3H0IA
chains in the Genus database with same CATH topology
1SG5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SG5 A; 
#chains in the Genus database with same CATH topology
 3OYE A;  4PJM A;  1UEB A;  2E6N A;  1G8X A;  2OTJ A;  3QDR B;  5LJ5 e;  3L2Z A;  1W2B S;  2EW3 A;  4E2F B;  1H3Z A;  3OSV A;  4PJN A;  2OJ2 A;  1AT1 B;  1VQ5 Q;  3JCM h;  2QQB A;  4JZ4 A;  2WSF E;  2KBT A;  2X4J A;  4C5E A;  1FMW A;  1YJ9 Q;  3UDC A;  1VQL Q;  4PJJ A;  4XU1 A;  3QG1 A;  1UGS B;  2VYT A;  2KVQ G;  2YXY A;  2CUD A;  3X20 B;  4QQ6 A;  5GAN d;  3O8V A;  1E6G A;  4J9D A;  2KI7 A;  5LL6 S;  5KE3 A;  2I0N A;  1Q82 C;  1NM7 A;  1GCP A;  1RAH B;  2RK1 A;  1B3Q A;  1UB4 A;  4R0K A;  1VQ6 T;  2JM9 A;  3T9N A;  3M4G A;  4J6W A;  5GAN e;  4ORZ A;  4XTZ A;  5GAM f;  4J6Y A;  3SEM A;  5J3B A;  1H8K A;  1WA7 A;  2KE9 A;  4E6R A;  5GMK h;  4M75 E;  1IGU A;  1T3L A;  4J8O A;  5IHI A;  4B9W A;  2EBP A;  4Y91 A;  3V8K A;  1C0M A;  4BE0 A;  4ZNX A;  4C8Q F;  2FZG B;  4ELY C;  2EVR A;  2K57 A;  5GAO r;  3OYH A;  1PKT A;  1VQ7 Q;  1M8V A;  1X2Q A;  2HNI A;  1M3C A;  1LVK A;  3H8Z A;  4OVA A;  1WHJ A;  4RCC A;  1K73 R;  1BBZ A;  3RER A;  1RUW A;  2D0Q B;  5GAN 4;  1Q7Y C;  3RBB B;  2MAM A;  2QTV A;  1RAD B;  3VYG A;  2MI6 A;  2GFA A;  1VOM A;  2DM1 A;  5KCO A;  2QXF A;  1XTD A;  1YJW T;  4WCI A;  3P8H A;  2RQW A;  1KHI A;  1NZ9 A;  2ZPE B;  2MWO A;  4C92 F;  2P4R A;  3MHX A;  4OP0 A;  3CCE T;  1G3T A;  3CXC A;  3PFS A;  4JUV A;  4JRQ A;  2P0K A;  3SDZ A;  2EKO A;  2AKK A;  4JJC A;  2LCL A;  1NPR A;  3FLG A;  3CD6 Q;  1WHK A;  2O9V A;  2CZ1 B;  2R58 A;  3PGG A;  1OPK A;  4QT7 A;  1D0Y A;  1PHT A;  3I55 T;  3OW2 A;  1K76 A;  4C0G A;  4A4E A;  2LJ1 A;  3KUF A;  2RHY A;  4ZTJ A;  4MDX A;  1OX9 A;  3I55 Q;  3M0P A;  1E6H A;  2XU8 A;  2V8K A;  3NTK A;  3VUZ A;  4BDY A;  4HT8 A;  3UT1 A;  1ZSG A;  2K5I A;  1U1S A;  1K9M U;  1MV0 B;  1W2B P;  5D6W A;  2QG9 B;  2IPO B;  2DJQ A;  1MND A;  4NL2 A;  2ABL A;  2DNU A;  4PLI A;  1YCY A;  2HSE B;  1TUD A;  1BK2 A;  3P8B B;  4RKU E;  2DK3 A;  4JPB W;  3CPF A;  1MMG A;  2O4X A;  2QQA A;  2FEI A;  3ME9 A;  4M77 G;  2DZ9 A;  1VQL A;  3MPU B;  2LTO A;  3JCM P;  4VUB A;  3OA6 A;  3EH1 A;  4F17 A;  4IIO A;  3G6E Q;  1Q86 R;  1U3O A;  4WF2 A;  3VU3 C;  4C8Q G;  1J3T A;  1Y7X A;  1X27 A;  2IVW A;  4CC2 A;  1VUB A;  4C8Q B;  1S72 T;  4M7A F;  3OMC A;  3DB4 A;  2JS0 A;  2EGE A;  4PK4 A;  2H3J A;  5GAN 3;  3VV0 A;  2KGT A;  4LE9 A;  2KK4 A;  2X51 A;  4JJD A;  2DTO A;  4TVR A;  5DY9 A;  3WVE B;  1YP5 A;  3GNF B;  2RQR A;  4KGZ B;  5GMK l;  5HY6 A;  4M7A G;  2R5A A;  1YN8 A;  1M1G A;  4D8D A;  4FSS A;  4BD3 A;  1FMV A;  4CC3 A;  4OF1 A;  2EPD A;  2K3X A;  1FX7 A;  4PFO A;  3JCM X;  3GNG A;  1YIJ A;  2CP7 A;  4ELZ C;  3OYJ A;  3O5Z A;  7AT1 B;  1ABO A;  3CME A;  4PJO C;  2CH4 A;  3CBO A;  1YJW Q;  1NYG A;  5CKE A;  1I5O B;  3WVD B;  2BE7 D;  3I56 T;  4ZGE B;  5GMK i;  4FT4 A;  1SEM A;  5KYX A;  1A0N B;  2AT1 B;  4J9G A;  8ATC B;  2RI2 A;  2ZZD A;  3QPH A;  4M77 E;  4RG8 A;  5FWB A;  3KFV A;  3SFM A;  1SRM A;  3PTA A;  3I56 Q;  1I81 A;  3G7Z A;  1SPK A;  1YBY A;  2PVO B;  1YHQ T;  4J9I A;  2DXU A;  1YWP A;  3PIO A;  4LUE A;  5CVI A;  1VQ5 T;  1KJW A;  4HVW A;  3EGX B;  5LJ5 d;  1M90 C;  2JJ9 A;  2WSE E;  4IUR A;  3HKS A;  1VQN T;  2RHX A;  3BW1 A;  4AT1 B;  5IH2 A;  2O01 E;  5I21 A;  5FRM A;  1ZSZ C;  1WNL A;  2RHI A;  3UA6 A;  1YJW A;  5GAO n;  2FPD A;  2X3X D;  1Q7Y U;  1PD1 A;  4X9C A;  2JXB A;  5LJ5 j;  3CCQ A;  3FIF A;  4IUP A;  4C8Q A;  1K73 C;  2A37 A;  4LD6 A;  3BFM A;  4EMK C;  2XKO C;  1GFC A;  2LCS A;  3I5R A;  2JUF A;  3OMG A;  1I0C A;  5M9O A;  4OML A;  1QW1 A;  3JCM V;  2ZAE A;  2YT6 A;  5GAO q;  2FL7 A;  4F7U B;  1VQP A;  3CCE Q;  1Y0M A;  2GQI A;  1D0Z A;  2MYS A;  3HTR A;  2OTL Q;  2PVG B;  4RTV A;  4C92 A;  1M1K C;  4OMN A;  1OOT A;  2VVK A;  3H0H A;  1IHV A;  1VIE A;  1RAA B;  3V7R A;  2E10 A;  3X26 B;  1JB0 E;  2DO3 A;  3JCM J;  1TH7 A;  2YSQ A;  1IHW A;  1WFW A;  2JMC A;  3N5B B;  3G71 A;  1M2V B;  1UG1 A;  4PJO F;  2CGH A;  3I5S A;  2D8H A;  2VXF A;  3A8G B;  2G3R A;  4PFZ A;  5A0G A;  2RI3 A;  4CI0 C;  3CME Q;  3I9Q A;  2O4X B;  1QVF A;  1E7O A;  5GAN 7;  5GAN f;  2M0O A;  2DA9 A;  3VS1 A;  2BKD N;  1AWJ A;  1UJ0 A;  2KYM A;  3QUI A;  4NS5 A;  1ABQ A;  2LMJ A;  2E3I A;  5FU7 C;  3REA B;  2ZPI B;  3TSW A;  2EKH A;  1HK9 A;  1V29 B;  4A4G A;  4FT2 A;  4FSX A;  2RK2 A;  4Z88 A;  1G3Y A;  1M3B A;  1N6A A;  3PNW C;  4HCC A;  3R6N A;  3CCR T;  3JCM g;  1X6O A;  6AT1 B;  1W1F A;  1Y96 A;  3CD6 T;  3JCM e;  1MMD A;  4M7A C;  3M0U A;  1VQO T;  1YNZ A;  4M7D D;  1WZO A;  2CP2 A;  5GAN 5;  2KMT A;  4RMO A;  2SRC A;  1WJS A;  1G3S A;  4DBR A;  1ZUY A;  2HDA A;  4DBH A;  2HL5 C;  3CC4 Q;  1QVP A;  1ZSZ A;  3OSS C;  1BIB A;  2W10 A;  4J7I A;  4ZN3 A;  1N8R C;  2X4X A;  3MEW A;  1PSF A;  4F7U A;  4M7D C;  2PNI A;  3R6O A;  1TXQ A;  2JOY A;  4V2S A;  1WDX A;  3NPF A;  1G83 A;  1G5V A;  3M55 A;  3EGD B;  1K4U S;  1PRM C;  1D1A A;  1WHM A;  5IN1 A;  3EG2 A;  3NGP A;  1M9S A;  3EHR A;  1JXM A;  1V1C A;  3UA7 A;  1VQN Q;  3G4S A;  4M7D B;  2OTJ Q;  5CKF A;  4RTZ A;  2COZ A;  4RTU A;  5GAN 6;  1B34 B;  2HQE A;  1WHG A;  5I2M A;  2XID A;  3M0Q A;  5LJ3 j;  4QQD A;  5GAM j;  1OV3 A;  1R8O B;  2ROL A;  1KD1 C;  1GCQ A;  4JS4 A;  3NTH A;  3L1A A;  2RMO A;  2C06 A;  2R57 A;  2E4H A;  1RL2 A;  3CCJ T;  4JRI A;  1KK7 A;  3HP9 A;  2QYZ A;  1YJ9 A;  4HKE A;  2LZ6 B;  1KIK A;  2FZK B;  1JEG A;  2CZ7 B;  4Z02 A;  1M2O A;  2W0Z A;  2PUO B;  2MPX C;  3QWX X;  1Q86 C;  2DIG A;  1OEB A;  1VQN A;  3L2R A;  3E1S A;  1B07 A;  4DEX A;  3G4S Q;  2BE9 B;  2E70 A;  5CIU A;  3QXE B;  2VAS A;  4C92 C;  1OU8 A;  3VUB A;  2YUQ A;  3TCJ A;  2CRE A;  3HRT A;  2GQV A;  3CCR Q;  3CMA A;  2BZ8 A;  2LC4 A;  3GIB A;  1YJ9 T;  1AZE A;  2L8D A;  1WQ7 A;  1PKS A;  3RDV A;  2P4T A;  4QVD A;  4KUD K;  3PE0 A;  4FCY A;  1BB9 A;  4JRK A;  3CC2 Q;  4M7A A;  1GCQ C;  4C92 B;  3HHT B;  4F14 A;  2Y90 A;  4GY5 A;  3OS0 A;  2DXB A;  3RUX A;  5FRO A;  2COY A;  3OW2 P;  5I11 A;  3RKY A;  3PVL A;  2PTK A;  5D6Y A;  4OMF B;  5CK9 A;  1M2V A;  2L89 A;  1NEB A;  3MEU A;  3CCV A;  5CKH A;  3QII A;  2CSI A;  4AFZ C;  3JB9 F;  3QKJ A;  1SSF A;  2PQW A;  1JJ2 P;  4PJL A;  2EQI A;  1WHL A;  2A36 A;  4OGC A;  1JJ2 S;  2HBP A;  4JLG A;  5KYN A;  3SD4 A;  2QEX T;  2C0O A;  3OYC A;  3JCM W;  2VKN A;  4JRP A;  2GFU A;  3THK A;  3NMZ C;  2M1H A;  1UTI A;  3OYB A;  2E65 A;  3GF5 A;  1KFZ A;  1UJY A;  3CCV T;  2WSC E;  4FW2 A;  4XTW A;  2RJD A;  2GTO A;  1QQJ A;  1YI2 A;  2EWN A;  3PT9 A;  1H3H A;  3SWN B;  3CCS Q;  1YIT A;  1YIJ Q;  1ARK A;  2FZC B;  1RI0 A;  2AHJ B;  2M9U A;  4D8K A;  3E2U A;  2CSQ A;  1X01 A;  3CCM A;  5EC7 A;  2HBW A;  1PM3 A;  2JT4 A;  1TSF A;  3QZ9 B;  2RJE A;  5KCH A;  2K7A A;  2COW A;  3M9Q A;  1JJ2 A;  1D0X A;  1KC8 C;  2ATC B;  2F2X A;  1VIF A;  4RCB A;  1BI0 A;  2LQN A;  3CXC P;  1S1N A;  4PJO B;  1VQ7 T;  2A08 A;  1K0X A;  4OMP A;  1HSQ A;  2RO0 A;  3OYN A;  1IZ6 A;  2ZCF B;  1GBR A;  3VS0 A;  3MP6 A;  5LJ3 f;  1JBM A;  2C0I A;  5KE2 A;  1YIT T;  3J81 E;  1YJN Q;  1RAF B;  1U1T A;  4RTT A;  1TG0 A;  3H0F A;  1H64 1;  1PD0 A;  4N0A C;  2CP5 A;  5GAO l;  5GAM g;  1QP3 A;  1M1K U;  3LLR A;  1Y07 A;  5LJ5 f;  3G4S T;  2HQH A;  1PWT A;  2JTF A;  2WAC A;  5LJ3 e;  2JMA A;  4M78 B;  1VQ7 A;  2CH4 W;  1VQ6 Q;  1N9S A;  3CBP A;  3LGF A;  2LNH B;  4C8Q E;  3EG9 B;  1GRI A;  4M78 G;  2HMA A;  5A2Q E;  5CQX A;  2F2V A;  4DBQ A;  1Y57 A;  3PIP A;  3GPL A;  1HD3 A;  4LUD A;  4QKU A;  1O9S A;  3H41 A;  2RF0 A;  4FL6 A;  4LDV A;  3M56 A;  3OYF A;  3I55 A;  1OU9 A;  1W2B A;  2JTM A;  5HK3 A;  3QJ6 A;  3L2W A;  4QVZ A;  4BE1 A;  4D6W A;  1ZUU A;  2YUN A;  3QWY A;  5C0M A;  4KH1 B;  1FXX A;  2KR3 A;  4M77 C;  3M0S A;  4Q5W A;  3CCE A;  3LH5 A;  1S72 Q;  4M7D A;  4M75 C;  1SHG A;  1U8R A;  1X69 A;  1RAI B;  1UHC A;  4WTO B;  3TQ7 P;  4BI3 A;  2JS2 A;  2DE0 X;  4M77 A;  5GAO m;  3C95 A;  2RNA A;  1VQP T;  2BZX A;  2CZ6 B;  1VQ4 A;  2CUB A;  1XJW B;  2KT1 A;  2LX7 A;  4OMQ A;  3DLL A;  3CCM Q;  5KH6 A;  1UGR B;  4IIM A;  4J9C A;  3CEY A;  1UFF A;  2RHU A;  3OYL A;  2V8I A;  4P5N A;  1QVF S;  3CC2 T;  3MO8 A;  3GP8 A;  3VKI A;  4QQG A;  3UAT A;  3EG1 A;  2EGA A;  3L2U A;  1VA7 A;  1RLP C;  4CC4 B;  3PVQ A;  2CP3 A;  2KRO A;  2CT4 A;  2QDL A;  5GAM e;  2IIM A;  5DLQ E;  1VQ4 T;  1S72 A;  2K9G A;  3MET A;  2E12 A;  3BE3 A;  4O5V A;  2HAX A;  3OS2 A;  1B34 A;  2B86 A;  4N0A A;  1WQW A;  1EIF A;  4PFP A;  3QDF A;  4KUL A;  1KSW A;  4AG2 C;  3JB9 H;  3RKW A;  1CKB A;  4RTX A;  1WGS A;  2QI2 A;  3TSZ A;  5KYU A;  3HFO A;  4C0D B;  2FPE A;  1ZHI A;  4M75 A;  3CCV Q;  4C5I A;  2RPN A;  1TUC A;  3ZL7 C;  1KHC A;  3OY9 A;  2GGR A;  2BIV A;  2RJF A;  1M27 C;  2V1R A;  3V8L A;  5J39 A;  3OYA A;  1VQ9 A;  1ZSZ B;  1NYF A;  5HKC A;  3UF4 A;  3TU4 K;  2EIF A;  3EFS A;  2YHT A;  9ATC B;  3CCM T;  2M16 A;  2G6F X;  3M57 A;  2EFI A;  2DBK A;  4GLM A;  2LJ0 A;  3OW2 S;  1EZZ B;  3LH0 A;  2KRN A;  4EMK B;  4A54 A;  2QQS A;  1VQ9 T;  1YIJ T;  2NUT B;  2EAY A;  2CKK A;  4OB3 B;  1VQM Q;  3M0T A;  4J9E A;  3QYH B;  4B9X A;  5CCA A;  4HVU A;  3QYG B;  1M5Q 1;  3EHQ A;  1OUL A;  4L6V 5;  4PJO E;  1HJD A;  2CYZ B;  4XTX A;  3M4Y A;  1Q82 R;  3CC7 T;  3EFO A;  1AWO A;  3OYY A;  1I1J A;  4L5G A;  1HXD A;  2YUO A;  1K0S A;  1Y71 A;  2XK0 A;  4E7L A;  4A4K A;  1VYV A;  3CPW P;  3V7S A;  2QEX Q;  1YFN A;  5FU6 C;  1G3W A;  4XU0 A;  2YLC A;  5L8R E;  2L3R A;  3CPW S;  4XQ3 A;  2YUP A;  2E64 A;  1C6V X;  5AT1 B;  1KQS A;  4F7U F;  3G1J A;  2EJG A;  2J6F A;  4M78 E;  2LX9 A;  3AT1 B;  2QA4 A;  2DL8 A;  3VRY A;  3A8O B;  4AG1 C;  1VQ4 Q;  2D9T A;  1OYX A;  4JJB A;  2EYQ A;  1RAB B;  4AFU C;  1QCO A;  2KRS A;  2BUD A;  3X25 B;  2LRQ A;  2X4Y A;  2E1H A;  4XTU A;  2K79 A;  2YRD A;  4A63 B;  3LWH A;  3RES A;  1NE8 A;  2DL5 A;  3A98 A;  3JCM Q;  3ZFJ A;  3CPW A;  2DL3 A;  3EG0 A;  2C0T A;  3NHN A;  4DOW A;  3E19 A;  1G2B A;  2B8A A;  2JVV A;  2RHZ A;  1KQS P;  2E5Q A;  2AZV A;  1GL5 A;  2EQK A;  1VQK A;  3CC2 A;  4RG2 A;  2XDP A;  3RMQ A;  4AFS C;  1BI2 A;  4ZGD B;  1TOV A;  5C6S A;  5CQY A;  2D8J A;  3A8L B;  5FU6 B;  5FWC A;  1EFN A;  4CC7 A;  4FIB A;  1I4K 1;  3M59 A;  3MKD A;  1LCK A;  1Z9Q A;  3CCL Q;  5I22 A;  2KQW A;  4M75 B;  5LJ3 g;  4C0F A;  1BYM A;  1T0H A;  2DEQ A;  1VQK T;  3CXC S;  1UGQ B;  3WXM B;  2GBQ A;  3VS7 A;  5D7U A;  4E7S A;  4C5G A;  4M7A E;  1K8A U;  3DB3 A;  5KYY A;  1M8M A;  4ZTF A;  5GAM d;  1OZ3 A;  2HQX A;  1T3S A;  3S6W A;  1UUE A;  1QCF A;  4JJN K;  1BI3 A;  1X6G A;  1K9A A;  4Z89 A;  2HKN A;  1BCO A;  4MZT A;  2ZPH B;  4M7D G;  3X24 B;  3JAM E;  5LJ5 h;  1QVG A;  2RN8 A;  3RNJ A;  4KT0 E;  2OTL T;  2X9H A;  3TVT A;  3VJP A;  3NFC A;  2M0Y A;  3REB B;  3UPU A;  3G6E A;  1Z9Z A;  4RUG A;  4LD9 K;  3P8D A;  3RKX A;  1UE9 A;  2ESW A;  4HXJ A;  2HZY A;  4M77 F;  2EQU A;  1ZBJ A;  2LQW A;  4C0Z A;  1IB8 A;  2EYZ A;  3OYG A;  1AZG B;  4RTW A;  1N5Z A;  3OYK A;  3I35 A;  4JZ3 A;  1QMC A;  2DBM A;  2OTL A;  1UGP B;  1FMK A;  3JB9 J;  4HCZ A;  3G6E T;  2ECZ A;  2M51 A;  2RD1 A;  1QVG S;  3ULR B;  2K3Y A;  1D09 B;  3MP1 A;  1RAC B;  1M90 U;  3NTI A;  4BY6 B;  1KC8 R;  1NG2 A;  2DLP A;  4X1V A;  3VS4 A;  3BDL A;  1IRE B;  2DYI A;  1R0C B;  1OX8 A;  1MMN A;  2M02 A;  3OS5 A;  4N4G A;  3QZ5 B;  3HL8 A;  2VXE A;  3S3N A;  2QDY B;  4BY6 C;  1IXD A;  2X4W A;  2NUT A;  2OTJ T;  2QA4 T;  1W4S A;  4EDU A;  2DYB A;  2RJC A;  3M53 A;  4K11 A;  1KQS S;  3JRZ A;  4R56 A;  1K9M R;  3CCL T;  2DD5 A;  8AT1 B;  1WXT A;  2F5K A;  3MP8 A;  2DET A;  1RAG B;  3A1P A;  2EGC A;  2XMF A;  3CBM A;  4C92 G;  2KAF A;  2V8J A;  2LQ8 A;  1NLO C;  3CC4 T;  2J7I A;  3CD6 A;  1WJR A;  3SWN A;  5L23 A;  2K2V A;  1I5L A;  3PMT A;  2CS7 A;  2AIR B;  1VQO A;  2LVM A;  1X75 C;  1YCS B;  1BIA A;  1D3B B;  3FC3 A;  3MEA A;  2VB6 A;  3CCL A;  4M77 D;  4X9D A;  1K8A C;  4KGV B;  4DOV A;  4PLL A;  3HSB A;  3H6Z A;  2FHD A;  3LX7 A;  4DA4 A;  2XDB A;  3I56 A;  3UWN A;  1AWW A;  2YWW A;  2A0F B;  4FU6 A;  4CRI A;  3H9N A;  2NUP B;  2DKG A;  1VQ8 Q;  2QK0 A;  3ER0 A;  1YHQ Q;  2QEX A;  4C92 E;  4R55 A;  2HEQ A;  3OYI A;  2JN0 A;  1BU1 A;  3LWI A;  4EIK A;  1O75 A;  1ZLM A;  3VRZ A;  3URG A;  2R5M A;  3DKM A;  3C4S A;  1VQ5 A;  2ZPG B;  2HD0 A;  2P84 A;  2DXC A;  2OX7 A;  4BAC A;  4GBQ A;  4EPC A;  2EYY A;  3EGD A;  3MCA B;  3J80 E;  4Y92 A;  2FRY A;  5GAN j;  1TTH B;  4L59 A;  5D6X A;  2X3W D;  1LJO A;  4EMG A;  4PNO A;  2DER A;  1OI1 A;  3L42 A;  1XNI A;  3CCS A;  1YIT Q;  5GAM h;  1QCN A;  2NUP A;  3SB2 A;  4E7K A;  3EH2 A;  4MML A;  2LP5 A;  3TRE A;  1Q81 C;  1VYU A;  2DZC A;  2VC8 A;  4M78 F;  1ZBX A;  1GBQ A;  1WXU A;  4HCK A;  2VUB A;  1Q81 U;  3L2Q A;  1VQ8 A;  4A53 A;  2OAW A;  2XI9 A;  1AEY A;  5GAN 8;  2DL7 A;  4GLK A;  3S3M A;  3FJP A;  4UC4 A;  4MDW A;  5IHK A;  4E7I A;  2KY9 A;  1UGV A;  4E7H A;  5FW9 A;  3GOX A;  1SKU B;  4J6X A;  2L3P A;  3CMA T;  4C5H A;  3FDR A;  1OPL A;  2YRV A;  3HRU A;  1WHH A;  4Z8A A;  4M78 C;  2CZ0 B;  1EX4 A;  1WIE A;  2JW4 A;  4BDZ A;  3KBG A;  1N27 A;  1N8R R;  1W6X A;  2F1L A;  1WYX A;  2I2L A;  3CCQ T;  2DRM A;  1YI2 Q;  1NJI U;  3OQ5 A;  2YLB A;  2PZ1 A;  1DJ7 B;  3G71 T;  5LJ3 h;  2XD0 A;  2XG8 D;  2MMP A;  1N8R U;  1YJN T;  1D1B A;  4JDS A;  3FRN A;  1M3A A;  2YDL A;  3OBW A;  4BI8 B;  4QW2 A;  1ZA2 B;  4LDW A;  2NUZ A;  2JM8 A;  4M7D E;  1SHF A;  2VGM A;  1Q82 U;  2OAU A;  2MF2 A;  5LJ3 d;  2A3L A;  4FW1 A;  4KUI A;  3E9F A;  2NLU A;  5CR2 A;  3PMI A;  2VV5 A;  2E3H A;  3U23 A;  2L2P A;  2KXD A;  1Q81 R;  1Q7Y R;  3D7S B;  2KT8 A;  1TWB A;  4LN2 A;  1LOJ A;  3LYI A;  5ECA A;  1D1C A;  4FYV B;  1VQM A;  4M7D F;  1JO8 A;  4M78 A;  2E6Z A;  4F04 B;  5CO7 A;  1AWX A;  5IHN A;  3JB9 G;  3CCQ Q;  1YI2 T;  4B6M A;  5FLX E;  1VQ6 A;  4JLI A;  2MCN A;  3QO3 A;  1X6B A;  2RQU A;  1ACM B;  5CKD A;  1NJI R;  1R77 A;  4O6J A;  1K1Z A;  1PCX A;  1M1K R;  4M78 D;  1QKW A;  4A4H A;  2J06 A;  2RB6 A;  3M0R A;  2QAZ A;  4C92 D;  3J7A F;  2VGN A;  2MOX A;  4KBM B;  2DIL A;  2CT3 A;  3EG9 A;  2DAQ A;  1YHQ A;  2F69 A;  1MGQ A;  2HL3 A;  1VQM T;  3EG3 A;  5FRN A;  4E47 A;  1QLY A;  1QP2 A;  1OZ2 A;  4J5Y A;  2O88 A;  1WI7 A;  5IT9 E;  1JXO A;  2MK5 A;  2DFU A;  2K5F A;  2O9S A;  3RIR A;  4N4I A;  3V7C A;  5KYW A;  3IQL A;  1QKX A;  2O2O A;  1MHN A;  4PJO D;  1M1F A;  1JRI A;  1K73 U;  2ED1 A;  3HFN A;  3C0C A;  3EGX A;  2JNG A;  3E9G A;  4C0D C;  1X2K A;  1X43 A;  2K3B A;  1U5S A;  1IO6 A;  3KXT A;  2DX1 A;  4X34 A;  1T0J A;  1C1A A;  2GTJ A;  3BDU A;  4KRT A;  3L2V A;  2KYB A;  2XIC A;  1AD5 A;  4JS5 A;  1KC8 U;  3JB9 D;  3LGL A;  3S3O A;  4BE2 A;  3GLX A;  1TS9 A;  3CCS T;  3OYM A;  4FM4 B;  4E7J A;  2EJ9 A;  5GMK e;  2DJZ A;  4HVV A;  4DQ2 A;  1JU5 C;  4EMH A;  1KQ2 A;  2HCK A;  1QVG P;  1KQ1 A;  1XQH A;  4ANJ A;  2XDD A;  3FB9 A;  2DL4 A;  3JCM c;  1VQL T;  1MV3 A;  5CKB A;  5EG2 A;  4ZN1 A;  1AOJ A;  2F2W A;  2Y4X A;  4PKC C;  2CP6 A;  2RQV A;  1WPY A;  4XU3 A;  3M5A A;  2ZPF B;  3INZ A;  4QVC A;  1ZA1 B;  1KD1 R;  3FJ5 A;  4LNP A;  4EMK A;  2L0A A;  2PVD B;  4FYX B;  4OGE A;  2BZY A;  2DVJ A;  4DEY A;  4FYY B;  1TU0 B;  3CCR A;  4M77 B;  2H3E B;  2JZ2 A;  3JCM b;  1YJN A;  2D0N A;  1LPL A;  3JB9 I;  2J6O A;  1NPP A;  4M7A B;  3VS5 A;  1RI9 A;  2FG0 A;  4PL6 A;  5HK0 A;  3G71 Q;  5AYF A;  3JCM d;  2KRM A;  1NEG A;  1PNJ A;  1SG5 A;  2RA2 A;  1PRL C;  3CC7 Q;  1F1B B;  1R0B G;  1UHF A;  3OS1 A;  3CCU A;  1Q95 G;  5HCK A;  4M75 G;  4IKF A;  2LQK A;  4XTY A;  2EYW A;  1JQQ A;  3CQT A;  2IG0 A;  4AFQ C;  4J9F A;  2J6K A;  2ROT A;  2RM4 A;  4OMM A;  2RI5 A;  4LDU A;  5IAY A;  2DRK A;  2VWF A;  5GJV B;  4KH0 B;  2DXT A;  1KD1 U;  3CCU T;  2YRC A;  3C94 A;  4N4H A;  3A8H B;  3QJY A;  2H8H A;  2QGF B;  4J7F A;  2QQ9 A;  4DBF A;  4OB0 B;  2O31 A;  3CCJ A;  4LXC A;  1Q86 U;  2K4Y A;  2L5Q A;  4J9B A;  5IXF A;  1FWZ A;  2P0Q A;  5GMK j;  2LJ3 A;  1LNX A;  3X28 B;  4RTY A;  1TUG B;  1K9M C;  1NJI C;  2Z0W A;  5CAI A;  2AK5 A;  2HKQ B;  3A8M B;  2D1X A;  3SWN C;  5KYX B;  2QTX A;  1PSE A;  2NWM A;  3EFR A;  2KEA A;  4OMO A;  4IUU A;  1I07 A;  4NOY A;  2FO0 A;  1GFD A;  3A5Z B;  4OB2 B;  3ASK A;  1MMA A;  1VYT A;  2L3S A;  3OB9 A;  2V1Q A;  4HCB A;  3CMA Q;  4C8Q D;  2JTE A;  4IUQ A;  1M30 A;  2AZS A;  3FEO A;  5J26 A;  1VQ8 T;  5A0L A;  2DVE A;  1U06 A;  1WLP B;  1WX6 A;  3M58 A;  1K8A R;  3CCJ Q;  1VQO Q;  3DLM A;  1VQK Q;  1PG5 B;  1MUZ A;  3AHU A;  3QSU A;  2CP0 A;  2P0P A;  4M4Z A;  3EFO B;  3Q1J A;  2FYK A;  1XOV A;  1NBE B;  4BB7 A;  1D3B A;  2K6D A;  1UEC A;  3VS2 A;  2K2M A;  4XAX B;  3RR6 A;  1WJQ A;  4F7U G;  4IUT A;  2KNB B;  5A0D A;  2K5L A;  3EGU A;  1ZX6 A;  1YWO A;  4BUG A;  4ESR A;  1CSK A;  4KGX B;  4AMC A;  1QWF A;  1H92 A;  5GAN h;  4J83 A;  4M75 D;  1VQP Q;  5LJ5 g;  3ZBD A;  4MZP A;  2DTI A;  1NLP C;  1I8F A;  1WXB A;  5DLO A;  2OI3 A;  3QBY A;  2DD4 A;  5KYY B;  5DM7 R;  2ZPB B;  2FVU A;  3ZEH A;  3EAE A;  3F70 A;  2PU9 B;  4PJO A;  3RMS A;  1GXI E;  1RLQ C;  1SSH A;  2DIQ A;  1M90 R;  4OB1 B;  4HT9 A;  4HA8 A;  3JCM f;  2KSS A;  2QAS A;  2ZGW A;  1RAE B;  2LDM A;  5GJW B;  4ATO A;  4C8Q C;  4FYW B;  2AKL A;  1M4Z A;  1ZUK A;  2E5K A;  3MJX A;  1V76 A;  1AVZ C;  2SEM A;  4LDY A;  3VS6 A;  3C12 A;  3GBQ A;  1QVF P;  1CKA A;  5GAN g;  4XU2 A;  1AHJ B;  2A28 A;  1B7T A;  2CDT A;  2KDS A;  4NL3 A;  1HYO A;  3LW5 E;  3CME T;  2Y4Y A;  2ENM A;  2RH2 A;  4ME7 A;  5GMK m;  2EJF A;  2HSP A;  2QGG A;  3OYD A;  2LT1 A;  2LNV A;  3VYH B;  3TEE A;  3HPW A;  3MEV A;  2QA4 Q;  3CC4 A;  1SRL A;  2J05 A;  1W70 A;  4II1 A;  3HRS A;  2DMO A;  3V8J A;  2EQJ A;  3VS3 A;  2LT4 A;  5GAN 2;  2DPP B;  4A4F A;  1KG1 A;  1UDL A;  5KYW B;  2GF7 A;  2X35 A;  4M75 F;  3CCU Q;  4BI4 A;  5IXB A;  1PC0 A;  3M54 A;  3QHS A;  5KYU B;  3JSC A;  1BKB A;  1QWE A;  1SF9 A;  2F5T X;  4ZGJ B;  1BI1 A;  2XHC A;  2V26 A;  2ED0 A;  1FYN A;  4MMK A;  1IGQ A;  3SHW A;  4XK8 E;  4IUV A;  4F7U E;  3JV3 A;  2QQR A;  2FRW A;  2GNC A;  1BCM A;  2GCX A;  1MNE A;  2BTT A;  2DF6 A;  4Y28 E;  4PJO G;  3OBY A;  4XTV A;  1Y96 B;  4F16 A;  1P92 A;  1N9R A;  4J9H A;  4YTL A;  1OQK A;  2FB7 A;  4LDX A;  2EQM A;  4MZM A;  2DTH A;  2L3Q A;  2EYX A;  1ZQ1 A;  2LCC A;  3BY7 A;  2PUK B;  2MIO A;  3CC7 A;  2MWP A;  4M7A D;  5GAO p;  2RQT A;  5I2S A;  1IRX A;  2FPF A;  5FU7 B;  2NYS A;  2A7Y A;  2E41 A;  4E7Z A;  1VQ9 Q;  2D6F A;  2DEU A;  2KXC A;  3H0I A; 
#chains in the Genus database with same CATH homology
 1SG5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...