1SG9A

Crystal structure of thermotoga maritima protein hemk, an n5-glutamine methyltransferase
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
274
structure length
274
Chain Sequence
SGAERKIWSLIRDCSGKLEGVTETSVLEVLLIVSRVLGIRKEDLFLKDLGVSPTEEKRILELVEKRASGYPLHYILGEKEFMGLSFLVEEGVFVPRPETEELVELALELIRKYGIKTVADIGTGSGAIGVSVAKFSDAIVFATDVSSKAVEIARKNAERHGVSDRFFVRKGEFLEPFKEKFASIEMILSNPPYVKSSAHLPKDVLFEPPEALFGGEDGLDFYREFFGRYDTSGKIVLMEIGEDQVEELKKIVSDTVFLKDSAGKYRFLLLNRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel mode of dimerization via formation of a glutamate anhydride crosslink in a protein crystal structure.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Unknown function
molecule keywords hemK protein
total genus 90
structure length 274
sequence length 274
chains with identical sequence B, C
ec nomenclature ec 2.1.1.297: Peptide chain release factor N(5)-glutamine methyltransferase.
pdb deposition date 2004-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05175 MTS Methyltransferase small domain
A PF17827 PrmC_N PrmC N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1sg9A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1sg9A02
3OZTA 2GH1A 3M70A 3NWBA 3ELWA 3KPWA 3F92A 3R0QA 1SUSA 1WGLA 2IPXA 3GRUA 4V0RA 3LBYA 5K01A 5K0CA 4QVKA 2C7QA 4DMGA 3A7DA 4IV8A 3HNRA 5FA5A 3LECA 2NXEA 5DTMA 1VDLA 4UN2B 3A25A 2PX5A 1R6AA 4PIMA 3TQSA 4ER7A 3FUTA 5GINE 1QYRA 2AN4A 1G41A 3DXYA 5BP7A 1EQAA 4M37A 5HILA 3FTDA 4H0NA 1ZV1A 5LR6A 1WS6A 1EJ6A 3GWZA 4MIKA 3I64A 3BXOA 4OQEA 2E5WA 2IDKA 2G71A 3ORHA 5DSXA 1GO5A 4JXJA 3Q7EA 2K4MA 2P3OA 3DMFA 4R71A 3TR6A 3EVDA 1IFYA 3VC2A 4F85A 1YFLA 1SKMA 2I9KA 1ZMVA 4OX9Y 3G8AA 4FSXA 5EMLA 1P39A 2IP2A 1KYWA 2ZVJA 3MTEA 5F2OA 3E21A 2PX4A 1FBNA 4HTFB 3M6UA 4E30A 1KIAA 5K0BA 3TM5A 4E2XA 2P40A 3TPZA 4FGZA 1QZEA 1WR1B 3DULA 2DAIA 4R05A 1JG3A 2LBCA 2DAKA 3G8BA 3T0IA 2VDVE 3FUWA 2H5XA 3AXTA 3BWYA 2PKWA 3HVIA 2QNJA 5GOZA 1NBHA 3TKAA 3GIWA 3NVKI 1I4WA 3HCDA 3TRKA 2ZWAA 4QQNA 3G5LA 1WXWA 2QHOB 2G8NA 5FA8A 2ZFUA 5FHRA 3BGIA 4GOOD 5K05A 4P58A 4QPNA 5C0OE 4FSDA 4AZVA 2ZBPA 3NDJA 4F86A 3TFWA 2AOUA 4YV2A 3OE4A 5CVJA 3PFHA 1KHHA 3H4JA 1DUSA 3A7EA 3P9IA 5FQOA 3ID6C 9MHTA 4X41A 4OA8A 3OU6A 2A14A 2VDUE 5E8RA 2YXDA 5DRYA 4PYJA 5K0GA 1M6EX 2JHPA 3G2QA 4OBWA 5DXJA 5T67A 5HIKA 1G38A 3FYCA 3T7RA 3REOA 4LG1A 2JHCA 5EHIA 5LQUA 3KQOA 3MB5A 1TR8A 5FULA 4RTRA 2QY6A 3OFKA 2L4EA 2OXTA 4HRAA 5E1BA 2MGWA 4MTLA 3HCAA 4PYLA 3X0DA 1AF7A 1VEJA 2JG3A 4DCGA 1AV6A 3T7SA 4FR0A 4KIFA 5FWAA 2BZGA 3NWEA 4GEKA 5EEGA 2KNVA 1ORHA 3Q87B 1FP1D 5H02A 2GPYA 4GEWA 3QV2A 4G56A 4P7GA 1NV8A 1YB2A 1Y8GA 2FPOA 1BC5A 1O9GA 2LVAA 1BOOA 1VE3A 2ERCA 3NJRA 3PS9A 1XDUA 3G88A 3IHPA 2ZBQA 4XUCA 3RW9A 4E70A 4C4AA 4FT2A 1KPGA 1XCLA 2IFTA 3BGVA 3UA4A 1BHJA 2BM8A 2OB1A 5K03A 2UZ4A 5EZSA 1JR4A 1IXSA 1ZGAA 1HNNA 5EZQA 5U4XA 5FTWA 3EVAA 1VP3A 3TMAA 3M6WA 1FP2A 3EEYA 4CKBA 2C7OA 3CVOA 4IKPA 4CKCA 5C9ZA 1CUKA 1OR8A 1ZGJA 5ICFA 4FS8A 2PLWA 3BT7A 1TW3A 3G89A 3IV6A 4RSRA 2P8JA 4GOLD 3IYLW 3EGVA 5IKMA 4C08A 2XVMA 2G72A 3O4FA 4KIGA 3FRHA 3I53A 1RJGA 3CC8A 3EVEA 4P7KA 4E33A 5F2NA 5KYGA 2ZZNA 5JI2E 2H11A 1R00A 2FRXA 5EEHA 5K09A 4F1IA 2IBTA 3UJ7A 3LKDA 3UJAA 2O57A 1G6Q1 2PWYA 2YTZA 3PFGA 2B3TA 3KU1A 3FTEA 1G4AE 2VDWA 3BGDA 5FADA 2UYCA 5K0LA 1NW7A 1RJDA 3H2BA 4NECA 2LVPC 3OE5A 3B5IA 2AR0A 3PT9A 5DM2A 3TM4A 3BBZA 2OBFA 3CGGA 3QOWA 1VQ1A 2EKKA 2LVNC 1KPIA 1L9KA 1VL5A 3FRIA 2EJTA 2YUIA 1JQ3A 1XXHE 3HVJA 3NTVA 4HGZA 4KWCA 3G2OA 4RWZA 4C05A 2PT9A 1Q0SA 2EX4A 2DHYA 3O7WA 2EG5A 1KPHA 3GDHA 3P9KA 1RI3A 3RODA 1XVAA 4E2WA 4RTJA 2B78A 3UZUA 4GF5A 4WP2A 4KDCA 5DLYA 4QDJA 1ZQ9A 2OPBA 3B89A 1F4IA 1N7JA 3GRRA 1IM2A 3HCEA 3NDIA 4EKIA 3GNLA 4M7RA 3HCBA 3LCVB 4YUYA 4YUWA 2P3LA 1R74A 4ER0A 2G3QA 1P91A 1VG5A 5KVAA 1KYZA 4BP1A 3OU7A 2FCAA 2XYQA 1F3LA 1UFZA 2AOTB 2P7HA 2YVLA 3C6KA 3KQPA 3P71T 3C6MA 3UJBA 5E9WA 3E8SA 3KQTA 3O31A 3SMQA 2JNHA 3EVCA 1M0EA 1YF3A 1TPYA 2K0BX 3MERA 2I6GA 4RTSA 5LQKA 1SQFA 5HOQA 1Q0TA 3KPJA 1JTEA 3IEIA 3HCCA 5EGSA 2BR3A 5DXAA 1G8AA 2JJQA 3GXOA 2QYOA 3THSA 2DAGA 1QAQA 1WJ7A 3IHTA 2O25A 4LWOA 2DULA 5DX1A 2IDJA 5CD1A 1N7IA 3KQYA 1WIVA 2HV9A 1R8XA 2ZTHA 5EC8A 3LCCA 5EHGA 1WXXA 2V74B 4R6WA 4YV0A 4E32A 4PCAA 5GIOE 3GJYA 4RVGA 4X1OA 5EG5A 3P97A 4X63A 5DM1A 5FQNA 4GOMD 2P3QA 4XUDA 5EMKA 3KPUA 3V97A 5CCBA 3AJDA 3JWJA 3HA3A 4QVGA 5HZMA 3SVZA 4UOEA 4E2YA 1G3IA 2ZLBA 3BZBA 3C3PA 4R8RA 3FE3A 3ERCA 3KQQA 2CWWA 5CVEA 3DXXA 1UIRA 1ZHFA 4RTOA 1VLMA 5M5BA 2YR0A 1P3QQ 4RTLA 3E7PA 4BLUA 5E1OA 2AOVA 3F4KA 3C3YA 3NMUF 3FUUA 2NNWB 1ZMUA 1JSXA 2O0LA 4C07A 3ELUA 4U7PB 3PLAE 2NP7A 5D1NA 2XBMA 2Z6QA 2XVAA 2P35A 5K0EA 5CIYA 1DL5A 1WG8A 2BR4A 1KYIA 3VYWA 2IBSA 3DOUA 3EVFA 5LQCA 4Z2YA 2NYUA 4V0QA 2PY6A 8MHTA 4YMHA 1DCTA 1JG2A 1VBFA 3R3HA 5K0NA 1WZNA 3SXJA 1EFUB 4C06A 2OKCA 1MN3A 2CMGA 1R18A 4QTTB 3SSNA 2NXJA 3BKXA 3GRVA 1NV9A 5EPEA 3OU2A 5LQJA 2AS0A 3GCZA 5DRTA 4QDKA 2KNZA 3M33A 4P7JA 1FJXA 1L3BA 4EQZA 3SGLA 3G5TA 3JWIA 1U2ZA 4RTKA 2JZ1A 2F8LA 2UYHA 2Y1XA 2I62A 4ER5A 2BM9A 2OO9A 2AOXA 1KP9A 2DENA 3G7UA 3IECA 4GBED 4Y2HA 4ER3A 5EKUA 5CVUA 3P8ZA 2HWJA 5EVJA 5KQRA 3DP7A 5GWXA 4DKJA 1JSZA 3CJRA 4F2LA 1E94E 1VPTA 3FPHA 2VZ9A 3DMHA 2EFJA 2VP3A 3S68A 2WA1A 3PB3A 3T7TA 5E9QA 5CUQA 2IGTA 2PT6A 3KPYA 4OBXA 5ICGA 1JG1A 2PBFA 3KR0A 3EVBA 3ELDA 3UBTA 2BWBA 4PYQA 3DLIA 3HA5A 4EMSA 3OZSA 1DV0A 7MHTA 1G55A 4ISCA 1I1NA 4CKEA 3M6XA 1YFJA 1WY7A 2FYTA 4MHTA 4ATNA 3FTFA 1RJFA 4XCXA 3SR4A 4RTMA 2JP7A 2AN3A 5HFJA 4CTJA 2PX8A 4B17A 2DNAA 1D2GA 2MR9A 5DX8A 1QAMA 3B7PA 4PCLA 3BWBA 4A6EA 2YQZA 4Y30A 3VC1A 5P8WA 2PSSA 2ONYA 3C0KA 3CBGA 5EMJA 4ER6A 1Q02A 2ZW9A 4HH4A 1XDSA 5KQSA 3ELYA 2HMYB 4OQDA 1JG4A 1VEGA 1QANA 2UYOA 2GLUA 3R6TA 1KXZA 5LQNA 2HWKA 1M6YA 5E2AA 1X1BA 2QRVA 2JY7A 3EPPA 4X60A 2LVOC 4DQ0A 3SM3A 5JUWA 2B9EA 1JTFA 1NW6A 3B3GA 3KPVA 3EVZA 4GQBA 2CKDA 5E1MA 4IWNA 1X19A 1VIDA 4RVHA 4PYIA 3UJCA 2MJ5B 3P2KA 2CWBA 3K9OA 5BW4A 3KQWA 4BLVA 5CCXA 3AWIA 1EG2A 2CMHA 2PJDA 5ICCA 4HC4A 2NP6A 2O06A 5BXYA 1RI4A 5EQJB 1RI1A 4BY9E 2HTEA 4HGYA 3MCTA 1NKVA 2PVCA 3D2LA 1ZMWA 3P2EA 3G2PA 3UA3A 2AVNA 4M38A 4DBGB 1R8YA 2R6ZA 4KDRA 1HT1E 4PWYA 4WVLA 2R0IA 5LSAA 1JR3E 1T43A 5D1HA 3THRA 4EKGA 4Q7JA 1D2CA 2DKLA 1G8SA 4FP9A 5DTRA 3K0BA 1ZKDA 2QSFX 3GLIE 2LD4A 3MAGA 1IM8A 3LGAA 4AZWA 10MHA 2DAEA 1G60A 3K6RA 4RV9A 5DM4A 3LHDA 3HTXA 2IIPA 1BKYA 3AY0A 4YMGA 2BH2A 1X1AA 1X1DA 3SSOA 2GB4A 4RYLA 3CCFA 5EIFA 3DLCA 3M6VA 4RVDA 2YXLA 2FK8A 2DAMA 1SUIA 3ANXA 4DM3A 3GLFE 2ZIFA 3BKWA 2CP8A 1RI5A 5T6BA 2OYRA 3VSEA 2G1PA 4RX1A 3GLGE 5EIWA 3CKKA 3JWHA 5DSTA 4CWAA 1VP9A 3FPFA 3M4XA 2C7RA 3HM2A 3OZRA 4AX8A 2HR1A 1UWVA 2PV0A 5F2KA 4PINA 4POOA 2ZBRA 4PYOA 1AQJA 4GOND 3KR2A 4PYNA 3UJ9A 4PNEA 2RRUA 3LL7A 5DT2A 5HIIA 4A6DA 3T6PA 1L1EA 2HAKA 2N47A 2QRVB 3I5UA 3I58A 1NBIA 3U81A 1Z3CA 2DZLA 1SQGA 3EGIA 3E23A 3LDFA 2ZSUA 4LECA 3TKYA 3GRZA 1P1BA 3KR9A 2G70A 5ICEA 3GLHE 3LDUA 3R24A 4KVZA 5GP1A 4YV1A 3NVMB 4YUZA 3ME5A 1XTPA 4PONA 3HVKA 4RVFA 4DZRA 3V8VA 4R8SA 1I9GA 1PGYA 2ZTCA 5FCDA 3UWPA 4C03A 2P41A 5KS2A 1XJ5A 2L4FA 2EJSA 1XXLA 2JH9A 1YLAA 2ZIEA 3DXZA 3KKZA 4GUAA 4HSGA 1FPQA 4DA4A 5BW5A 1TW2A 3HA7A 1X1CA 3AXSA 3MTIA 5C1IA 2R3SA 1NT2A 2WK1A 5CM2Z 4YUVA 1AQIA 1YUBA 4XUEA 3P2IA 5CVDA 5HEKA 3TOSA 2EKFA 1O9HA 2GA9A 2P1DA 4DF3A 3CJTA 4KW7A 2PWPA 3ER8A 5GM2A 3KHKA 3MHTA 5EKXA 1XCJA 2H00A 2AVDA 2KW5A 4ZTBA 4PGHA 3KQSA 2AN5A 3KR1A 3MGGA 2ZTDA 5DX0A 2ZULA 1NW8A 3PX3A 2B2CA 4WXHA 1UFKA 1V39A 4M36A 3GRYA 5DPMA 3UJ8A 3DR5A 4GC5A 2PXXA 2IH2A 4E31A 1YZHA 1AIPC 2OO3A 3RIEA 2Y1WA 4RTPA 2MROB 1HMYA 1JQDA 2ORED 4K6MA 2Z6UA 1A5TA 2ZWVA 1EAMA 5DM0A 5ERGB 4RTQA 4X61A 1ZG3A 2OOBA 3I9FA 1KR5A 2HNKA 2L2DA 3K9PA 2NXCA 3EMBA 2LVQD 3E46A 2O05A 1OQYA 3GGDA 5GM1A 3UJ6A 1H1DA 1VEKA 1HT2E 1L3CA 2PXCA 3NW9A 5DWQA 3OFJA 2BWEA 2GAFA 2YX1A 4FT4A 5MHTA 2V7EA 1XDZA 1IY9A 4HG2A 1HQYE 3G2MA 5EMMA 4EK9A 2JY8A 3HEMA 4EVIA 2ONZA 4PYMA 3MMPA 2AZTA 3LKZA 2C7PA 2ZCJA 3DTNA 2QE6A 4QPPA 3UFBA 1WHCA 4C04A 1NW5A 5FWDA 2GS9A 4E2ZA 2CL5A 4AZSA 3P9CA 1SVUA 3DMGA 5EOVA 4CTKA 2I7CA 3PX2A 3FPJA 3B3JA 3DUWA 1QAOA 3FUVA 1C7YA 2VS1A 1NE2A 3OPNA 2H1RA 2WA2A 4RTNA 2P7IA 1QZZA 2NXNA 2OB2A 2OY0A 2Q41A 4FZVA 1SG9A 3FPEA 3P9NA 1PJZA 2ZZKA 3E05A 2JUJA 3CJQA 4MWZA 3SSMA 3QOXA 1RI2A 1D2HA 2WZJA 2KNAA 1YZ3A 2PX2A 3MCZA 1OAIA 3TLJA 4F84A 1MJFA 5JR3A 4LWPA 2FHPA 3UJDA 4HTFA 3HVHA 2Z6AA 5LQAA 1RJEA 1V92A 5GIPE 5K8VA 2JH8A 3HCFA 4PGGA 3A4TA 3A27A 3BUSA 3OCJA 3LX6A 1P1CA 3PVCA 3SX0A 3PTAA 3EEOA 5DFLA 4KRGA 2JY5A 2ESRA 2IH5A 1NW3A 4DCMA 3DH0A 4R6XA 1OTRA 2ZIGA 1WGNA 3JWGA 5HIJA 2PGXA 4HEOA 4QTUB 5K0JA 3LDGA 3FPGA 3GO4A 5E2BA 5FHQA 4QQKA 1INLA 2PXAA 4CXMA 4MQ4A 2UYQA 1L3IA 2XYRA 3KQVA 3L8DA 1XB2B 5B1SA 3GU3A 4PIPA 1MHTA 2ZZMA 2O07A 4PYKA 4BP3A 4OA5A 3FYDA 2LTUA 3LSTA 2B25A 4IV0A 1OKSA 5DTQA 2JZ0A 1HJPA 1O54A 2EJUA 4AUKA 1R4GA 2BR5A 3A26A 2ADMA 1T6OA 1JQEA 3EGEA 5E9JA 5IH3A 3BWCA 1DO0A 2AOWA 3LBFA 4L7VA 5E1DA 3FUXA 3KQMA 3FZGA 3FTCA 5K0FA 1Y8CA 3MQ2A 2XYVA 4G3OA 2AOTA 4GC9A 2KHHA 5T64A 4P7FA 4YUXA 1BVSA 1TTEA 2IH4A 1F38A 3LCUA 3R9XB 4U7TB 2JHAA 3B3FA 3WSTA 1DO2A 5E8JA 2DPMA 2OZVA 3EMDA 2DI0A 5G02A 5LQRA 2K9DA 3ER9A 4AZTA 1IXKA 1ORIA 5CVVA 3BWMA 1PRYA 5HIMA 5FUBA 2FK7A 2YXEA 1EJ0A 1N2XA 1EIZA 2AOUB 2QM3A 3EVGA 4BLWA 3HP7A 4O29A 1B42A 3LPMA 2JY6B 2OOAA
chains in the Genus database with same CATH superfamily
1TYEB 5K45A 3TI7A 1RWXA 3ORRA 3R0QA 3COZA 1XDGA 5L8RF 2XVXA 3HNRA 4BO0A 2IOFK 2UZ1B 3E84A 5ALWA 2AFHB 3TOVA 4DTCA 2WF9A 3SE0A 4DCSA 5A9SB 2O8VA 5M3BA 2DP4E 3J27B 1CHNA 2DZDA 3N5CA 4ZOLB 1KSHA 2XTNA 1X7WB 4AJJA 1U3CA 1UP7A 2QP3A 4EATA 3U31A 2PZJA 4JEMA 5TARA 4EQ6A 3FE2A 1CR0A 1RYHA 3BXOA 2ZPAA 5H0IA 4Y6RA 4WMLA 4OO3A 2X9QA 1F8FA 3Q6NA 5KVQA 1M73E 3I3OA 7MDHA 4JP3A 3IIIA 5EXXA 1A9QA 1UK6A 2GTPA 1NL3A 3G8AA 2QYTA 3H0KA 5JDCC 5J2UF 1Y33E 1QDEA 4AY3A 3E21A 2PX4A 5LP6C 3OQOA 4AMYA 4IBEA 4WK6A 2Y1EA 3K2BA 1E2FA 4H15A 2F5OA 3W3AA 4UEKA 4AFNA 4HAOA 2HSEA 3LU1A 3AQIA 4OB8A 4ZOEA 4KPUA 3PNVA 1H1LB 4GL4A 5LL6P 1JG3A 4WA7A 3FY4A 1JA0A 2BUAA 2P4EA 2VTVA 1RQLA 4GWLA 4M9ZA 2CD9A 2XOXA 4WOCA 3IPRA 4TL7A 3KJHA 1XGKA 4PO8A 1AGPA 2JLSA 4AVYA 2D59A 3SDSA 4J1TA 3ZJ4A 1Z0KA 5BPVA 1YB6A 2YWXA 4QASA 5E3HA 4QJ3A 1FP7A 1D7AA 3QPAA 2R6DA 5ADUS 4GDFA 1MORA 5HQ3B 3LK7A 1ZIOA 2VZ8A 4WY5A 3UBMA 4E7OA 2F3TA 2PE5A 3SHTA 4D96A 3H4JA 2ZRAA 3ID6C 4RZSA 2QTMA 4IJWA 3VSAA 3HJNA 1VCOA 1K5GA 5E8RA 5B36A 2VDLB 1L4HA 5AJHA 4TMTA 2R8PA 2D5CA 2Q5FA 4L4ZA 4O4LB 1XIVA 3HSKA 2JGRA 3O8OB 3OSUA 4IXDA 3NONA 3IJ5A 3GLIA 1MU0A 1LLFA 2WHXA 3BRWD 1CS0A 5D84A 3S1SA 3U4MA 4ZRNA 4RTRA 3GX1A 3WL5A 3MB5A 5FULA 4IHKA 4PTLA 1VJ1A 3C3XA 2XE8A 1QVVA 2Y93A 4R8KA 4HBZA 5J4LA 2DXIA 1EDBA 2F5PA 1WF3A 2VDPB 4FFVA 1O77A 2D7GA 1Y3BE 2ZWMA 4K2AA 5H9VA 4IIXA 5K3BA 2JAXA 5EEGA 3BC1A 2EFYA 1V3VA 4AZ0B 1TO6A 5I6DA 4I3FA 2CJFA 3ZJVA 2JCVA 2P2ZA 2V5VA 3T94A 5AOCA 1QWOA 3DE1X 3B1WA 2C8JA 1CR1A 3LUCA 3NFYA 5ALKA 5K3DA 4QARA 3OJXA 4F5ZA 1OBHA 4PC1A 3UA4A 1YS9A 2DWQA 2V6IA 5JBIA 2XWQA 4PAWA 4D3XA 4E12A 3Q3EA 3GNQA 3KJEA 2TS1A 3DKKA 2QN9A 3RSGA 3H18A 3D3NA 3WLFA 4F38A 3U44A 1M1YB 2MJLA 4CKBA 3J2PB 3R3YA 4IKPA 4PPYA 2C78A 1YUNA 3QPDA 1DX4A 4JI6M 1TFRA 3MWYW 3GK3A 5TSDA 3G82C 4C3ZA 3EVEA 1P44A 1VSUA 4IZHA 5JI2E 5ALZA 2OHOA 4GZ5A 4NCKA 4AQ7A 2ZI5A 3LUDA 1Z5ZA 2FZ4A 1G8JA 1HF3A 1N2EA 1ZDMA 3F6EX 1A5BB 2NMVA 4BVEA 1AVTA 4U8GA 5T6MA 2VP2A 2OFWA 1JHMA 1A9YA 2YMMA 3DBOB 3QKRB 3TM4A 3V4FA 3IUNA 2OBFA 2D1QA 3L3BA 4W82A 2OMEA 2EJTA 2YUIA 1VXOA 3EULA 1E77A 4X6UA 3H4MA 3IAM6 4HGZA 3UMBA 3DTYA 3LYAA 4RHFA 2PT9A 2OM6A 3ILVA 3KJQA 3H2GA 2DFPA 2EG5A 2ZRLA 4BUCA 1NRIA 2IYOA 3WIEA 1HNZM 1NI4B 4IIEA 1ZQ9A 1F4IA 2HCBA 4AJLA 2HN9A 1GGMA 1KI8A 4QU5A 4F9FA 4M7RA 1CZRA 1JFFB 1UFOA 3AHFA 5BSTA 4B7AA 3PUZA 4XCQA 3TSYA 1SBYA 4OOFA 4F9GA 5L3VA 1GTSA 3VZRA 3PDWA 3H5IA 3C7KA 3OF5A 3KZMA 3OU7A 1QQAA 1GN9A 3FR8A 4DDHA 3NC1C 4WLFA 2FWNA 3GOQA 3INTA 2X3YA 5DIFA 5EINA 4EA8A 3HN6A 3SMQA 3LVWA 1IAQA 5AKJA 2DHDA 2F64A 2X8LA 3OP4A 4MQMA 4A0FA 4OX9B 1BCRA 1JIQA 1YA4A 4J1TC 4I4TF 3RAPR 4JI4B 1Q0TA 2B5VA 1ZGHA 2G9VA 4QAQA 3C3WA 3GFGA 2XMZA 4DGQA 1DFIA 4F4CA 3WV4A 1XTZA 3H1BA 3Q3VA 4TVBA 2R46A 3BXZA 2FMIA 1GTVA 3H19A 3CLKA 1U9CA 3LRPA 2OESA 3Q3GE 4BTVA 3F5SA 1VI5A 1ULHA 1Z5WA 5LMNB 2IY8A 5DKFA 4F4UA 4M21A 3PR3A 4LF8M 1N2GA 4GW3A 5JH7F 1EWRA 3QWFA 4XUDA 3AU8A 5DIZA 3BORA 2HHAA 4C5BA 3PL1A 1Z13A 3JAWB 4G9EA 3L79A 5JISA 3AM3A 4MUIA 4OY3A 3HDTA 2E18A 5MN4A 3ROPA 2P2LA 4EGQA 1DBRA 1M34B 3I4FA 3WFJA 2WAXA 1VLMA 4HQKA 2IYRA 3CISA 4MP3A 3CNEA 1P2FA 2B8NA 4OLFA 3HGMA 3LNTA 2FUG1 4FEAA 4MB7A 4GXRA 5CNKA 3SLGA 5CDUA 3PE4A 2ZBUA 1RZVA 3NDRA 2NP7A 1KY4A 2A7QA 4L6V6 3LVVA 4LYFA 5IJ0B 1IXRC 5DBHX 2ZUCA 2QN8A 3AUAA 2VRCA 2W4MA 4ALLA 4Q9JA 2DG2A 1YDMA 3V4PB 2GUWA 4RIFA 2C4VA 4MCIA 4ND5A 1XDWA 3RVLA 1FMJA 2E49A 1YC2A 4KE9A 1J6UA 1X8JA 1XA3A 5LP6A 1HSZA 5C8YB 3GJXC 5DRTA 1QC5B 1VHJA 4REQB 2BP7A 3M33A 9ATCA 1WAMA 3JZMA 1IEVA 4B9AA 1XK6A 2BDUA 3Q12A 5FKJA 3ZGLA 3KAQA 3KYCB 3LWZA 3GJ7A 4NFSA 3N2KB 4E5SA 4AKTA 4P08A 2ZBKB 2GK7A 4ARZA 1S2IA 3OZWA 4L76A 2GAIA 4MS3A 3FCEA 5T4HA 4Z1OA 3KFUG 1PD1A 4ZI7A 4DKJA 5JJBA 1PL7A 3RYFA 5EWMB 5IKXA 5LCXA 2VAPA 4FBLA 5LYJF 1M2VA 1X2EA 3OLVA 4Y6QA 4GQIA 1YGYA 2YYAA 5CITA 4TM8A 5JARA 4KQ9A 1PTJA 1DDIA 3DAGA 2E4ZA 3ZWDA 4B7HA 1LKZA 1UWCA 4PS0A 4TPKA 3HRHA 1U81A 1YHYA 5IDQA 1RRCA 2HPVA 1FK8A 1D5CA 3STVA 3M6XA 1M34A 3BMXA 1XZ8A 1E1CB 2BDTA 4G5OA 4KZPA 1X1SA 1ZK0A 3FKQA 3M3DA 3RJTA 1HDEA 4JR0A 1KAGA 4XWKA 5IAAA 2E6KA 2XDQB 3DVSX 4WK4B 5BRJA 3B74A 1W4CA 1SWVA 2P0EA 1U1CA 2PU7A 2QNBA 2YBDA 3E3NA 3JZIA 5AM0A 4PCLA 4IJEA 3HDYA 4IIJF 4BXOB 3CF6E 3VC1A 1J00A 1L4LA 5EMJA 1BFKA 2DWNA 1JGTA 4RPHA 5T3UA 4BL5A 4WCFB 2JVIA 1I13A 3OZCA 4LXIA 4QDTA 1EFUA 2GLUA 2R6AA 2RIPA 1DAIA 1IBKM 1M6YA 1XCMA 3M83A 2QRMA 3PWZA 2C20A 5AVKA 3WNBA 4XKJA 3SI7A 2QNRA 2O0MA 1WTAA 3VLFB 2WP8J 3EVZA 3F46A 4JP1A 3FOZA 4W9NA 1JJVA 4IQ4A 3RH0A 1OH5A 3K9OA 5ED0A 3CSUA 1E2NA 2PNJA 2FSHA 3VZSA 5JATA 3D3QA 1W76A 2QN7A 4JFAA 1EFTA 1NJ5A 4OX9M 2IYXA 2OLJA 1K82A 2BCEA 2QV0A 3VR2A 5DGCA 4C0XA 1NLYA 1IBLM 2XF3A 1S0UA 2HTEA 2ZSJA 5CBPA 2VDWB 3OBIA 1L5ZA 3UTCA 5EP3A 4UW9A 3U9TA 3QJGA 5LWQA 1S3SA 3J7AS 4IH9A 1SO8A 5TQJA 4J2HA 2IYEA 2F8TA 1UFVA 3C6ZA 3KTOA 4HXGA 2XQKA 1JAHA 2UAGA 1KH3A 4HRXA 5B3AA 4LRYA 2VPPA 3VZBA 1KO5A 4BNWA 4LF4M 3PPWA 3QBEA 1VCMA 2G8LA 1TDJA 1YJBA 4MICA 4E22A 4YMGA 1FJXA 2GB4A 1YDEA 3SS7X 4DCJA 4E6PA 5A4IS 2QJWA 5JS6A 4V0ME 2AG1A 4F46A 4ZO8A 3HB0A 3ROKA 1XJQA 2R6GA 3RIXA 1W1WA 2M32A 3CUWA 5KSPA 3WS7A 1E2DA 3SC4A 4EB6A 1U98A 2P4SA 4TVKA 2QV7A 3TFOA 4PVCA 3LVRE 1I6LA 1JLKA 5DNDA 4XQ9A 1YCFA 3DT9A 5JLAA 2PV0A 4C76A 2JAUA 1N3IA 5E95A 4V2IA 4PNZA 3M5PA 2BHLA 1XT6A 2D2EA 1MR3F 4GM4A 1CKEA 4PRYA 4EYSA 1GNVA 3H16A 3GHHA 1XTVA 2N47A 3R0ZA 3B1XA 4HLNA 2DZLA 3H9JA 5I9IA 3T1TA 1YIAA 4YJ3A 4M1SA 4HDRB 3SN6A 1H9CA 1XWIA 1WA5A 3PXUA 1FFWA 3LVQE 2ZUTA 2GSWA 3TUJC 3VVBA 3ZHYA 4YMVA 4DV5M 4B4DA 3A28A 3DM9B 4X66M 3R77A 2JIPA 4RVFA 3FNQA 2IXTA 3WRXA 3D4BA 4RA9A 2QUIA 5F98A 2DWZB 3I9LA 3CWQA 1JHZA 1O89A 4WN9B 4FWTA 5F3DA 6CHYA 3IBGA 2JH9A 4U7WA 4IILA 2QCUA 3T0FA 2QTHA 1LBHA 3MTIA 2C84A 4YUVA 1I4OA 1UXKA 2Q4TA 1ZBQA 3C8ZA 1DAOA 2EW8A 3KEMA 2P6MA 4PZDA 1NVMA 1IBSA 4UNQA 4FMCB 4YX9A 3OC0A 3E9MA 2IHKA 3BRQA 1DRJA 1GZHB 3HDVA 2HHCA 4G5QA 3W5DA 4PZ9A 3I01A 2BFWA 2YC2C 3FNHA 3NHSA 4O4HF 2QQFA 1Y9EA 1X9IA 3IIEA 1RAIA 3HO6A 2QL5A 4NE2A 4F3RA 1GL6A 3MGGA 4HX2A 2W2QA 2OV4A 4D9HA 5K09A 1GUZA 4G8CA 2VATA 2YJ5A 3FAZA 3TDMA 3ZGYA 3CX8A 2R5WA 3MUOA 4ZI7F 5HXAA 1UMCB 1BHO1 2QTGA 2D7DA 2QW0X 1Q84A 2ODQA 3KVOA 3DS8A 1Z8NA 4J1NA 1A5TA 1J56A 3QIVA 2ODPA 3O83A 1HEYA 1ND5A 2F9FA 3V34A 4IDFA 1AIPA 2GCNA 2O20A 1LEHA 2L2DA 1F12A 1NYQA 2FCRA 1MJGA 1SCJA 2NVBA 2NXCA 1O0CA 1USVA 1H1DA 2CXPA 4ANRA 1TVMA 1FU8A 2L17A 4KMOA 3ZV7A 3OCXA 4D44A 1UBLS 2IX3A 3CLSC 3I4YA 2DPGA 1ZN9A 4BFUA 2Q5JA 5BSRA 3H84A 3HDHA 1THGA 4UCFA 4AUMA 4C01A 4Z3KA 1KK3A 5C5DA 1KEKA 3DTNA 1SCUA 5K6AA 5J5VA 2B36A 3DE6X 4WBNA 2C9DA 5ADWA 4KR2A 2B9VA 3Q9LA 2D2IA 3C4VA 4JYMA 3FVQA 3A4YA 1OJ7A 4AMUA 3TUIC 1K9SA 1Z0DA 1JI0A 1CPYA 4LJ6A 2O7VA 1WMFA 3HWX1 4GICA 4BBPA 4D4KA 3FFAA 1T36B 1JMKC 4Y28F 3TQQA 3EXHA 1R8QA 4Y67A 4J0FA 4ZO4A 3WE7A 4O0LA 4HEA1 2ZZKA 3E05A 3FIUA 1P2VA 2CJPA 2Q2QA 4MEAA 4MWEA 2B98A 3S2FA 5HJEA 1H2AS 3QKUA 2UUCB 4JL8A 1KI3A 1DJLA 2C59A 3QEKA 2ICAA 5ECWA 1CUFA 3TEJA 2BGUA 1I0IA 4DE5A 1JYSA 4DNOA 5LQAA 5THKA 1K66A 1TQ6A 2OD7A 4OI2A 5I9LA 3BUSA 3PVCA 1N1GA 3VC3A 1Z12A 4RPCA 3TRJA 4X62B 2G9UA 3EEOA 4DB2A 4KRGA 2PS1A 1YR7A 4LFBM 3FPBA 2TECE 4CM9A 3OEED 3O9MA 4D0LB 3AMVA 2XQVA 1UR5A 3HB1A 1X2BA 2R1UA 4MWTA 3GO4A 4AQDA 3O82A 1ANKA 2QLTA 1A9PA 4XM2A 5ALQA 2GZAA 1JXOA 2IYYA 2XYRA 4MB0A 3JYNA 4U9HS 1PJCA 5B1SA 2O07A 4Z3OA 3KOWE 1KJNA 1I1QB 3GW8A 3O4HA 4HPWA 4O25A 3TH5A 4GX5A 1MABB 4IOMA 4OK5A 3TLYA 3VTZA 1I10A 4DC1A 3A26A 4KREA 4AECA 4N40A 5IPFA 4B3TB 4AKGA 1WCWA 5KWSA 4M9XA 1O87A 3ZU3A 1EWQA 4WFIA 3FTCA 5K0FA 1P4GA 2GZ1A 4LJKA 3CS3A 1J8QA 4P1ZA 3LV8A 4A8TA 1R9JA 3NHZA 4OREX 3S6JA 4X66B 5JS7A 3OZAA 1Z5NA 5COQA 3T3OA 1TEZA 3PF9A 3H2ZA 3M1LA 4M7WA 5FP0A 1KS2A 3NXSA 2K9DA 2PMBA 3R4CA 4UPEA 1Q14A 3RIMA 4E5PA 4QHYA 2BMEA 1FNBA 2LCFA 2VTDA 1KFVA 4XX0B 3EVGA 3IPYA 1AF4A 1AN0A 3TZBA 4CKEA 4Y6PA 1A72A 2ZB2A 5DGHA 2X0EA 3NWBA 5G41A 1X3LA 3PEUA 3NTQA 4CNQA 4IRXA 3JASA 5B37A 4QVKA 1XL0A 1TGUA 4AM8A 2B21A 5FA5A 1SULA 3SNKA 5FV7A 1N34M 1J9ZA 2QRNA 1R3UA 2VVTA 3EXFB 4P17A 4L15A 1EQAA 4LNUB 4ZV4A 3T34A 1XZJA 2XD9A 4KH0A 4PC3A 3PEEA 2JFWA 3IMFA 1WHSA 4FR2A 5HPYB 4MKIA 5BWBA 1TJNA 2SBTA 2Y1DA 1XTRA 1QH8B 4OQEA 2X0FA 2PH5A 2ETXA 4JXJA 4LBWA 4A2WA 1FDUA 4EHAA 3Q7EA 2FR8C 4LF5M 2Z95A 2R48A 2ZJBA 3DMFA 3PJDA 4R71A 1U3WA 2VQFB 1QPZA 5GOTA 2ZS8A 4NKRA 5FLKA 1P39A 1TXGA 2YV2A 1ECPA 2EFDB 2W6ID 1FBNA 3OMXA 4OSPA 4ZXPA 1KIAA 4FFOA 1G8KA 3NEJA 4QC2A 2RBGA 1Y6QA 1HZJA 2VZ0A 1C1KA 4FQ5A 2REOA 3W8EA 3V1YA 1JR3D 3DULA 4C78A 4Y7CA 2BW0A 1E7YA 5KWVA 1C29B 2VEDA 3ZXXA 2H5XA 5JAIA 1KQ3A 4OXKA 4LRUA 2B30A 4WUTA 1OXTA 4I5FA 3K5IA 3PGXA 1SM4A 3MGKA 3URKA 1ILEA 1DI0A 5JAMA 5JLJA 4EG3A 3CF4G 3GG9A 2J0VA 2VHCA 1W73A 3OQHA 2ZVDA 1AKNA 5C3UA 3D6NB 1CWUA 2RCNA 2AFHE 5C0OE 1Y1TA 3KS9A 2WT9A 4HK4A 3DZCA 4NVRA 2XCLA 5BSGA 4J0DA 1XNGA 3KB2A 3W7BA 3ESAA 3IAAA 5FQOA 3IMKA 2I6SA 5JSZB 4X41A 1N5LA 3OU6A 2CB9A 5EWMA 3TW0A 4L9WA 4B8ZA 4G1EB 1ZM2A 2B7CA 2H29A 3AY3A 2RK4A 3DPSA 2AZDA 1FCJA 1ZNWA 2JGJA 3N9IA 2OCLA 4R9UC 5TQ2B 4ZN6A 5HGXA 2GFHA 4WA8A 4BE9A 3RVRA 2VT7A 3C7AA 3W3AD 3NHYA 1I3OA 2YN0A 4FBMA 4L57A 1M33A 2ZRGA 3DCYA 3OT1A 4N3CA 2P5UA 4URHA 4AX4A 1ZM3A 1XNJA 1RYDA 2TSYB 3QFRA 4PYLA 4CTOA 4TLEA 1QYWA 4ZQFA 3T3EA 1XEWX 1UKYA 2ISCA 4PAGA 1XU4A 2ZRHA 4QIHA 3V7FA 1AD2A 4DQXA 1YE5A 3P19A 4ZOCA 4DV1M 1JDNA 1BC5A 4IIUA 3TXXA 5KB3A 1FFYA 1EFVB 4BJ6A 1YWGO 4JU8A 5DWVA 1DE0A 3VH1A 1UMBA 3CPJB 2I7DA 2ZIWB 1E5DA 2XE4A 4FT2A 5H1YA 4JOSA 5F77A 3KWJA 3V8QA 4EYQA 3G5MA 5JTTA 1E6KA 2RGNC 1XDDA 1XZGA 5LXTB 3FOFC 1VKHA 1C4KA 2I54A 2ZG6A 4UPDA 1HYQA 1NG1A 1Q50A 1MQ9A 1UC5B 1CE8A 4MJ3A 4EA7A 5JC8A 3NORA 1EVQA 2HMTA 2OCGA 1IXZA 2CVHA 2VQSA 2WZDA 3LWDA 3HY5A 3QWAA 4WL0A 4CIYA 3QI2A 5LUAA 2XXAB 2EWMA 2RB4A 3QRWA 3QEBZ 1IHYA 3E27A 4HPJB 1J1ZA 3C7CB 2ZZNA 2J46A 3BH6A 1YL7A 3HXQA 3JYHA 3QVUA 3U5ZB 1VTKA 4F1IA 4WINA 2GDZA 3DBHB 3UJAA 2KB0A 2O57A 4OLHA 2PWYA 1I33A 3BTVA 3QVVA 3DC7A 1LUAA 5SY6A 4BWYA 4FGWA 1C9KA 1FW8A 1NW7A 3TLKA 4OI0A 1LVUA 1UBFA 2W0MA 3CUYA 2A9FA 3D5EA 3O8OA 1W2GA 1YKFA 3R23A 4W7HA 2YY7A 5LIPA 3KSBC 5HZMA 1PGQA 4C05A 4JQYA 4LJ5A 1SU6A 1A76A 4UUBA 4BNIA 3N75A 1JEEA 1S2GA 1ZX1A 2HUPA 5HTOA 1EUDA 1BVRA 3H5AA 2B92A 4LNAA 1A04A 1WBDA 1S5PA 3W7AA 4CPDA 4D9JA 2EC5A 4ZC8A 5K4GA 2P5YA 1FNNA 4D80A 1T5BA 2ZRDA 2W98A 4JQZA 1EZ1A 3EW9A 2J5RA 2OECA 2Q5LA 3QP9A 4DPLA 1FP4A 4MMYB 2AI2A 4DV6B 3V8BA 2WMDA 1QRRA 5LMNM 3QU7A 3FDZB 2P7HA 5UKDA 5IUNC 3TR0A 1UKVY 4U2FA 4KZKA 2JBAB 4MQEA 4OXRA 4YFVA 1UMBB 2X2OA 2GPWA 4N7BA 5JPDA 1UJNA 2V7VA 4CMJA 1J5EM 4H2DA 2C1XA 3MEQA 3PFCA 4YR7A 5C32A 2FPMA 2QX6A 2FXVA 4PICA 1FTGA 6AT1A 4LI3X 1ZGCA 2KI5A 3A1FA 4U00A 5KKNB 1N5RA 1ZUWA 3FKSA 4OL9A 4GPD1 3GPBA 5JAHA 2BGGA 1SD1A 2J6HA 3D8UA 4JI4M 3TLGB 3E03A 1G3QA 3SSAA 3THSA 3ROQA 4J03A 3PQEA 3DZIA 1IUOA 3NHPA 5K0ZA 1M83A 4NF2A 5HKLA 3OHSX 3SZGA 3KQYA 1IZ0A 1R88A 1IOZA 1YBFA 2HJGA 3ECCA 3JTEA 3WLAA 1YRWA 4F12A 4R41A 2PZMA 4IWYA 4RNCA 2JKZA 4ZQGA 5GIOE 3RYCA 4B45A 4C21A 4Y18A 5FQNA 1N33M 1ZS9A 3ZDZB 1AZWA 2V7WA 3KPUA 3PRKE 1N6KA 1QIEA 4C6RA 5CEFA 1JMYA 3WYFA 2FE4A 5E9AA 1D6NA 3H9QA 4R8RA 4E2YA 3HRIA 1ABBA 4LOKA 1H05A 4JEHA 2YFHA 2DCMA 3K0HA 3TL6A 3H2JA 1N9GB 4DBLE 2IEAA 5DEIA 1N34B 1B3RA 4JP8A 5E6UA 4PZZA 3AHDA 1ES9A 2NNWB 3DVQX 2LGJA 2VHQA 2ZIUB 3DDOA 2VUHB 1C1DA 1LDMA 1W35A 2IS2A 4QU9A 3R09A 3GFVA 4MRRA 4FX2A 4BJ5A 3KWLA 3RS5A 4U7DA 1VFPA 1JQ5A 1L5FA 1QHYA 3EVFA 1K0UA 1U9YA 2AE1A 3IMCA 3JRWA 3M6LA 4FYXA 1FMLA 1XB2A 5LU8A 4OFWA 4OIMA 4K9DA 4D8VA 2GD0A 5JY6A 1WEKA 4I81A 2UVDA 2I6TA 2F59A 3FDZA 1KEVA 2B2NA 2CMGA 4ZAWA 1LSOA 3K94A 4GMHA 3ZGVA 2GAAA 3L46A 3G7SA 2HL6A 3WQQA 1JDTA 3ZY3A 3W5BA 2O48X 4QDKA 1DX6A 5HZKA 1BXGA 1TKCA 4W4TA 1QE5A 3EFEA 5HYVA 4XIJA 1IJKA 2RI6A 1WCIA 3QFFA 2DGDA 1F6BA 4DDVA 4RH0A 4BX2A 4I4CA 1KP9A 1KC1A 2XBUA 3IECA 1WW3A 3SLRA 4CF5A 5I7FA 3AX6A 5D87A 4ESVA 1XROA 3KSUA 4DQKA 1SCBA 2GXAA 1GN8A 1WXFA 2ODTX 3C6XA 3S68A 2CFCA 1NNI1 4JROA 5SY9A 4L0QA 4L5BA 1T36A 2YYZA 2VYVA 1V8FA 3O84A 3HP4A 1RXYA 2GCEA 4IBDA 4BMSA 4QAJA 3ANLA 5FO0A 3HKEB 3DLIA 4EHDA 3U62A 1KMMA 3W0LB 4KRFA 2GMWA 2AH5A 1NAIA 2V9ZA 3A0UA 2QMQA 3N39C 3QZUA 4OVZA 1FF9A 1G0OA 4MB2A 5ENDA 2WTUA 1AGNA 6PFKA 5B58C 3ER6A 4U5XA 3ZD7A 1K4KA 3D5TA 2OSBA 2PKEA 2X0DA 3A46A 5AJVB 3SX2A 1UBTS 1BMFD 4B17A 4DABA 1M0WA 1P9LA 1CW2B 4CJ6A 1TCBA 2IYFA 3B2NA 1N0WA 1RWVA 5DX8A 1UZNA 5HGJA 5L53A 1GIAA 2IYPA 1Q0RA 2XVYA 5E6RA 1W9HA 1YQWA 3KOXA 2QXYA 3ZGNA 1XVLA 5T7BA 3DE4X 5L8VA 3CO5A 1Y7IA 3EUWA 3TX2A 2XUQA 3KUCA 1B8OA 1I80A 3N6VA 1YZNA 1GGVA 2HWKA 3KDSE 2NZXA 2ORIA 2V6FA 2J3MA 3EPPA 3FCCA 4M76B 4A0SA 2C92A 1IG0A 4JI3M 2R96A 3HRKA 3GC6A 4PBSA 5K3AA 2DZOB 3D4OA 2RK3A 3N6XA 1UANA 2P9FA 2Q3JA 1I24A 4RLSA 4BQSA 2Q0HA 3OKCA 4Z53A 4W5NA 2NPOA 4JNCA 4ZOLF 2Q6IA 2IY7A 1IN5A 3QUBA 1YO6A 1HZZA 2VG8A 5FLEX 1T4CB 4OUKX 1KORA 2OLEA 3N2YA 3P0RA 3VPBA 3GFBA 1E2QA 1QF9A 3BMNA 1T0UA 3G6WA 2NP6A 2FWIA 1I2CA 4C0LA 2H1LA 1CQZA 4JI3B 4O3FA 5E7MA 4KFUA 4XPZA 3S28A 3VHLB 4HCJA 3VNRA 4BKOA 4UHEA 2WVGA 2P9JA 3TDNA 4X3CA 3SARA 3OMWA 2FJ0A 4UHBA 5B3KA 3LOQA 5IKOA 3QEOA 3EY9A 4Q66C 1G8SA 4NXNM 5IT4A 5JBQA 5DTRA 3RC1A 2QTZA 4RNDB 1XVUA 2W2LA 2RH8A 1MIOB 3ETGA 2JJYA 2XLCA 4UVEA 3M0EA 1VPLA 3GEEA 3JQ8A 2CNWD 5FOWA 2AN9A 3WAGA 3OTOB 1OH7A 3LXMA 4WEQA 2IUUA 2B82A 3QEAZ 1GGHA 2JB9A 1BWRA 4KE8A 5EXDA 1KXJA 1QNFA 2D1RA 4NE7A 1A9SA 5F2KA 1A7AA 4TKUA 2D3TA 3IP3A 1G2OA 1TAHA 1WKVA 4HAXA 3MXTA 3DFKA 4QGHA 2NSDA 3SIPA 1RLOA 3AYXB 3GZTB 1GNPA 5A4MS 5KNDH 1E9DA 3T6PA 5ITUA 2HAKA 2P91A 3USCS 2FSVC 1JXQA 3KB8A 4QSHA 1QP0A 3E1GA 5GY7A 4CMEC 1S4MA 4JQCA 3RKRA 4FDMA 2R8EA 3A9VA 3SQMA 4FI3C 3AEQA 4LVUA 3TKYA 1Q3CA 2Z3WA 3UK1A 3WISA 4CKWB 3GLHE 4QJIA 1UBHS 4UULA 2XUKA 3RC2A 1GFSA 5KNLA 1Q12A 3EXG2 4OQMA 1JIIA 4PW0A 5IBRA 2C4HA 3I30X 4DZRA 1EK5A 4XQ0A 4XRGA 1CJCA 4XJVA 5IAOA 1T4CA 1VE7A 4TX1A 3LFTA 2G07A 1RKVA 4ITRC 4D8YA 4KH1A 3ZHRA 3IIMA 5CT8A 2G63A 3SZOA 3EXIB 1JJIA 1YZLA 3I39X 4UU7A 3WRYC 1NUAA 2PBLA 2W2KA 4FIZA 3NT4A 1YVDA 5KTKA 2KSQA 2QLNA 3LVBA 3ZWBA 1XRSB 1UBOS 1E1DA 3FZYA 3IV7A 1QV7A 2XDAA 3IUJA 2UVPA 3Q2KA 3Q9NA 3QWIA 4GMXA 1EMDA 4LNHA 4WDQA 2AHOA 4X7MA 3RNLA 4DF3A 4NXNB 1LSSA 3CX7A 2J9XB 3KHKA 4I1SA 2GN8A 1Z06A 2FFJA 2QBYB 4CDRA 1OX4A 1W5AA 1NBME 4EDFA 4IBCA 1LDYA 4EF5A 2R8XA 1TM7E 2O23A 5BN4A 4D9GA 3DPIA 1NW8A 2W2OA 1SCDA 3PNOA 3ANNA 2W6CX 3GRYA 1RXWA 1PJBA 5DN6A 4GC5A 3T9FA 4EZEA 1NMEA 4X65B 3IPAA 2MROB 1M67A 3KOOA 1MVOA 2WUDA 4LJ9A 4GAEA 3X3HA 2ES4A 2GBFA 3FWKA 3IV9A 4IFBA 4PV7A 2WUVA 1DG9A 3NYQA 4PANA 3W9YA 5KJFA 2QVCA 4PYRA 2J9FB 3TQFA 3VPDA 3QY0A 5JFOA 5DHRA 3ICQB 2FE1A 3KXPA 5IBPA 1Z63A 2E87A 2PT7A 1T5HX 5A5FA 3G79A 4R2MA 4I9NA 5ICMA 1CEXA 1QRUA 2AKEA 2C83A 3R3WA 1T1EA 4G3XA 4IDEA 4XVCA 3THYB 1K3WA 1XRMA 1Y63A 1OC2A 1F7UA 2YFYA 1MDBA 1VDZA 3OOYA 3Q0IA 4DG5A 1E9RA 4UQLA 3HPQA 4NZPA 2TMDA 3PKIA 3O8CA 3CZ5A 1FS5A 4RA9B 1TX4B 2CNNA 4OHPA 2D74A 4NPAA 3O47A 1E9EA 1L7NA 4Y2JA 4KHZA 4BIIA 5BN3B 4WLEA 2FX3A 3PVSA 3AHJA 1HE1C 2FS1A 3CUEF 4C6SA 2EBFX 5JCPA 5EIEA 1TI7A 4NENA 2ACEA 4P8RA 5JBNA 3P9YA 2XWBF 3U3OA 5JTUA 2GRUA 2XZPA 3O2QB 1EUCB 1IHOA 4DMMA 1KZ4A 1TJYA 3OTIA 2IU4A 1VRVA 1NXXA 2N1BA 3L7YA 2BGLA 1RI2A 4US1R 1F2UB 2KNAA 2IH4A 4HEHA 5TY0A 2J3QA 3F74A 5JR3A 3PFIA 1WBJB 4JJ4A 2PGNA 1V5FA 2XLJA 2R47A 3HCFA 3N1UA 1RIIA 2ZYSA 1VHDA 1U3GA 3DA1A 4MV6A 3DVAB 2H2AA 2VQDA 4IDCA 2N46A 1MHPA 3OZGA 4BP8A 5AW7A 1NQTA 3O4VA 4G67A 1O96A 4GMGA 4GYKA 2I66A 3M9XA 1PGPA 1W29A 4TUYF 5AK5A 4FE7A 1OTRA 2O52A 1SEVA 1VDDA 4EI9A 1PJ2A 4M2LA 2JCBA 4ND6A 4NS1A 1GTL1 3JQDA 1YNSA 2GSDA 3QKIA 1EX6A 3A6DA 3QFCA 3S8YA 5FBWB 4HWSA 3NBQA 3RV4A 4MVJD 4U8HA 4ZKDA 4J9VA 2PT5A 3ZCBB 3INNA 4DA6A 3DDUA 2EJUA 3IDZA 4G4GA 5DHUA 1UBNA 1T6OA 3TWLA 3QMMA 3IVMA 3BTUA 3IULA 3LBFA 1TECE 1NBOA 2GHQA 4NAUA 1JECA 2FFRA 3O2JA 4NS4A 5CEJA 4X6YA 2DFVA 4C7BA 5IG2A 4DCTA 1OI2A 4CV2A 3F2VA 1BMDA 4O02B 4KXQA 2G04A 3IKTA 2HEIA 2JHAA 3TAHA 4IBBA 2AF3C 4KFCA 2OCPA 3DT6A 2LXEA 2HIGA 2WMNB 4D4GA 5LQRA 2C00A 5EJ5A 1VB5A 3IELA 4YH1A 4NOKA 3KZ1E 4MOWA 4Q02A 3KYCA 5ARDA 1HG1A 2AOUB 1SVLA 2ZUWA 4JVLA 5FUMA 2A9RA 3G5AA 4XYEA 2DUUA 3DTVD 3QX7A 3T6KA 5JJIA 1B6TA 4J7CA 2CHUA 2CV1A 1NQUA 3A4LA 2TMKA 2FSGA 4XXHA 5IASA 1K89A 1E6CA 1R16A 3CN7A 4NMMA 4CIWA 4DJAA 3A7DA 1CV2A 4ETIA 1D1QA 3C7TA 1Y1KE 1G41A 1L6RA 3H9BA 1IY1A 1B0UA 3MJHA 3I73A 5KCZA 1WKBA 2MSWA 4IO0A 1JDBB 6ABPA 1K27A 4X44A 1RYEA 1B93A 3A31A 1SIWA 3G0DA 1OBCA 4IYRA 2CV2A 1ZISA 2A1TS 2JGNA 1XQYA 3DE0X 3RYHB 2IRWA 3TG8A 4N8EA 3PQ4A 3T3HA 4CCWA 1J5EB 1QIGA 4Z6YA 3COWA 3L1HA 2HA2A 1WXQA 3N8IA 1RKXA 3OX3A 1YQQA 1L7RA 4WKBA 4ZYLA 1WU7A 3RRBA 1KRWA 1FUKA 2AMJA 2QAIA 2J6CA 4JSTA 5TGZA 2Y1LA 4G09A 3FHLA 3DDCA 2FW1A 2X2FA 1GFZA 1UM8A 2IE8A 1ZQ1A 2R2GA 4KWEA 4OSOA 1GQYA 2PHZA 1MJ5A 1RJ9B 2BFEA 2GI4A 3JQ6A 3QXJA 5AHRA 4BNYA 1DIBA 1BWPA 3LCRA 2GJ9A 4Q4CA 1E9VA 3AEYA 4BRZA 3AXTA 3FNEA 3ZHQA 3WRXC 1C4XA 1SOAA 3GIWA 3KXEC 2VRBA 3HCDA 3R5KA 1GUYA 2WQ7A 1GU0A 3U1VA 4DB4A 5KYTA 1CY7A 2GXQA 3DBRB 5FHRA 4CQMA 1XMQB 1SVSA 4RZUA 2IHVA 4IJQA 4L73A 4TVSA 3F73A 1QFXA 4A73A 4NJOA 1F1JA 5JH7B 4HDCA 3TL4X 3ETHA 4JOBA 3M6MD 3SVLA 1YI8A 4EJFA 3VH4A 3U6QA 4NHEA 2YIDA 4QLAA 2RHRA 4WOBA 2ECFA 2ZE8A 3R8FA 5FL7A 3WO0A 4B75A 1L4UA 2A3NA 3C15C 4Z9AA 5TR9A 3W5IA 5KYWA 4D4JA 4EKDA 2HT1A 3ADKA 4DC9A 4OBWA 5T67A 3JATA 2EDCA 5K3FB 3FYCA 2WTNA 1P72A 3LX4A 4G4SO 4J0EA 4LG1A 4RF5A 4G5HA 5IDXA 1SHZA 2BFPA 4N5NA 1SKQA 3L7KA 4Q18A 5BWLA 1GABA 1EESA 2Y27A 3LTEA 4YAKA 1J4AA 4KLAA 1X13A 2AUNA 3G0BA 4NZOA 1YH3A 1ZFNA 3D6MA 4DDUA 1MZVA 1L4NA 1VIVA 5CVVA 2JK1A 4GO1A 4TYWA 4A5OA 4LRWA 3GVHA 4DJ5X 3ZLVA 3CWCA 4YQFA 4HMQA 2ZTLA 1B16A 1ISJA 2X6QA 5K03A 2BM8A 4CTNA 4UTNA 2LP4Y 4N5IX 5EZSA 3ZCQA 5EZQA 2FLWA 1HNNA 2XCIA 2ZBFA 3U0VA 5L4NA 1MC4A 4GKKB 1CP2A 1QYDA 2EFCB 4QU8A 4YJ3B 1W87A 2R8RA 2IVFA 4MGEA 2ZI6A 3MA0A 2EXXA 1Z7BA 3W6UA 2B4RO 1VJTA 2R84A 3AU9A 3KSDO 2PGOA 5KOYA 3NCHA 1D04A 1F8GA 4XB1A 1LSJA 3IFSA 2A92A 3H3JA 4P31A 4L08A 1UJBA 4KNYA 4JP2A 2DF8A 2YOFA 1OW3B 3BL5A 3JVEA 4I9UA 4MEJA 3CX4A 5CLQA 5CTJA 4CM4A 3HX3A 2R6R1 3QE4A 1DGHB 1QQTA 2NGRA 5ERXA 4YAIA 1YR8A 2YN4A 4RE5A 4DYHA 3O5AA 3FTEA 3DV0B 2B3TA 1JA9A 3ZXIA 1UBGA 2QLBA 3G2JA 4IS2A 1OXUA 3OZUA 3QM1A 1X42A 3HV2A 2BFCA 3BDAA 3OE5A 2YZMA 4Q00A 5EE3A 2RD2A 3BBZA 3CGGA 4TWBA 3ZJTA 3ZNOA 4TSRA 1N5JA 2BDEA 4KWCA 2BHTA 3VV2A 3ZD9A 1VPVA 3WIOA 3TMKA 2FZLA 1M74A 2IP4A 4FEGA 5A4JA 3MVEA 3IP8A 2O8BB 1EZ4A 2P4HX 3UZUA 1LD3A 4B3XA 3OQ1A 3B1ZA 5JVDB 3SFVA 3QOYA 5HZHA 2BGRA 3MLBA 3OHMA 4IIHA 4BEJA 3OVMA 3EA4A 3ND8A 3HY4A 3OWOA 4PXYA 1XMQM 5J5AA 4ZTZB 3A05A 1MRSA 1HE4A 1NNJA 3LCVB 1R1DA 2QN1A 2GF0A 3MXOA 4RH3A 2P3LA 2A9JA 1XU9A 1PZFA 2FP4A 3HXLA 4P93A 4BP1A 3OQNA 5LP6F 2FCAA 3WC4A 4WN3A 2JBWA 3H6GA 4KQFA 1U8UA 4UCWA 4LCBA 2VQ6A 2JNHA 1MC8A 4BNXA 5I7HA 1NQWA 4D8UA 1M0EA 2HPAA 4FXPA 1L4BA 1NNUA 5HOQA 5FI0B 4Y2XA 1GDTA 4TTSA 4UXJA 2G4VA 1EH5A 4GRDA 2B3DA 3GJ6A 1NYTA 1QUFA 3SS8A 5C1BA 2W9XA 2XZTA 3ZE1B 2C03A 4LDQA 5K9ZA 3AERB 1AB5A 1QMPA 3ODGA 1WIVA 3RFWA 1R8XA 2FWPA 2QVGA 4NCXA 4PLYA 5IJXA 1NVWQ 1IVNA 2WOJA 3A1NA 3AL3A 3OM8A 2QQEA 2H1SA 4MQUA 1MB4A 3V3KA 1W94A 4HQOA 2IIQA 4ZODA 1Z5CA 5TPZA 1FSGA 2E85A 4EG5A 4M9CA 3AJDA 2WIFA 5DFAA 3BGWA 3HJUA 4EECA 2C61A 1KO4A 5IKEA 4DR4B 3DKRA 3UWKA 3PR1A 4FNOA 2Z9BA 4O8ZA 3E4RA 1RSZA 2Q28A 3NX4A 5JRZA 2SNIE 1Z4MA 2OK8A 2RB5A 3EUFA 5M5BA 1W36C 1KVUA 2BAGA 1E3JA 4RFSB 5KINB 3BD7A 4DA7A 3IHLA 4UAUA 4RY8A 3ZGOA 3CT4A 5KYKA 1CBUA 1OX4B 3PZBA 4KRXA 4C1BA 2OBYA 3FYUA 4IMJB 1PYOA 1KZ1A 1Y81A 3O7MA 2AJDA 2BF7A 3C48A 4CLRB 1YUMA 2ZM6B 5AW6A 2Z6QA 2BRUC 3QX8A 3MWJA 4RLFA 4UTZA 3LQFA 3VYWA 3PXXA 3TE7A 4N5DA 4YEDA 4P3XA 3I01M 2XTMA 1QGYA 1R4NA 4HDSA 3ZEIA 4D2IA 3I04M 2X0IA 3B36A 3STXA 3FB1A 3I2FA 4CUKA 2Q7OE 1QM5A 2C5AA 2N0SA 5FNVB 2FPPB 2JGIA 2OCYC 2ZTUA 4JV5B 4EPWA 1M1UA 2DTXA 2VXBA 4IY1A 1X8LA 1L4GA 2Q27A 4FLEA 4HEJA 5CHEA 1IXSB 3EOAI 1OYOA 3GFPA 4KBFA 4X91A 2X0RA 1L3BA 4BMYA 1YTUA 3SGLA 1U5CA 5REQB 1YIOA 1YACA 3HKDA 3UOAB 821PA 1U2ZA 1R2QA 1VHQA 2C4KA 3TQTA 2D1TA 1JYEA 4KV9A 3GA7A 4GBED 1JV2B 3L92A 4QG3A 4PFSA 4CG1A 5AW0A 1F48A 2IA5A 3R6LA 2FI1A 3M1AA 4GKAA 4O4JF 1CY6A 2EBWA 3CJRA 3FB4A 4OYHA 3KG2A 3FJYA 3ZVLA 4AWXA 1NF8A 2GTHA 4DNQA 1MGOA 3DZHA 1T5IA 3ZYZA 4L72A 3EVBA 3VK8A 2WJ3A 3WLHA 2WT4A 4PYQA 3AIOA 4YHHB 3OZSA 2REQA 3USZA 3KLBA 3CG0A 4BJ1A 1MO3A 7MHTA 2DKFA 3WKDA 2G9NA 4KO2S 4DT1A 3FTFA 4MMXB 4CLOA 2B1GA 1NJ6A 2PUVA 4XCXA 4YDSA 3SEAA 2GF2A 1W85A 3AV3A 3VJLA 5TEWA 3KCNA 1Q44A 4C2BA 2QMEA 3BWBA 4FDVA 4A6EA 2P2SA 4HGQA 4OW0A 3MOGA 5JCJA 4ENPA 4O6VA 3ST7A 3AP3A 4RZ2A 5H68A 2GPBA 4OAQA 3V46A 3D0RA 5KQSA 1W96A 3ELYA 4OQDA 2ZJZA 3RAEC 2QT0A 5DBFA 2IPMA 3YASA 3FKJA 5BV8A 4CEIA 2C2KA 1IC6A 1KP3A 1U28A 4RD1A 3I9NA 4F3TA 1ZICA 4M54A 1NDHA 3KX2A 1DBQA 1NVBA 1ZIYA 4IWNA 1EI9A 3GPXA 3AZPA 4ZT4A 9LDTA 4JVOA 4ARZB 4CF4A 1KZGB 1H1LA 1VHLA 2GD6A 3EZFA 3HCOA 3KOZE 3FTNA 4QBIA 4URXR 3WGKA 1F9EA 2G6BA 3FSRA 3OX2A 3VSCA 3ZV5A 1C8LA 5EIBD 1TZJA 2R6CA 1FMCA 4KK4A 3DKVA 3JR7A 1NKVA 1O6BA 1BHQ1 3R44A 2R45A 1WXGA 4OHBA 4ECEA 2VJDA 3BAZA 3FPSA 1XFDA 3DD1A 5EJEA 2F4NA 4L8GA 3WDLA 3IALA 1E3WB 2HRZA 3D8TA 1GRNA 3ZZNA 2AG8A 2BY4A 4AT1A 4DMUB 1IM8A 1E4VA 2W6OA 3KJZA 1CT9A 3L8EA 2MR5A 1ZNQO 4N12A 3UB3A 2MH8A 3PFBA 2EF0A 3DLCA 4PSCA 3VPFA 3CLRC 3BH7A 5JSZA 5EJ8A 2PH1A 1SD2A 5CVCA 3JVDA 2HK6A 2XMRA 1RXCA 4KIUA 4MIOA 2O8CB 5IT5A 4Y9DA 5CA1F 3U3ZA 3RKSA 3GZNB 2YWGA 1I94B 1XHBA 4RENA 4QLOA 2C07A 4JOCA 3AM4A 2FA9A 1EB9A 3HSYA 2ILTA 3IMEA 1PYGA 3CG4A 4I1VA 1E3LA 5ELLA 3VU9B 1Y0BA 5IZCC 5HIIA 1NYLA 2RKBA 4BNFA 2APLA 4E3ZA 1V48A 2ARKA 4NARA 5C31A 5TE9A 4DIDA 2A0YA 1Z3CA 4REMA 3TIFA 2FLKA 3FFXA 3LDFA 1YDFA 2PKRA 5A2GA 3SJZA 3LO5A 4KQJA 1GD1O 2FFQA 4WECA 3V33A 4DA9A 1P1BA 4FMDF 4BB5A 4L6CA 3W8FA 3IBFA 2ONKA 4YV1A 2NU6A 1REQA 5KNCH 2BI4A 1PSWA 4TL9A 5DZSA 2OYCA 2GJAA 5HE8A 4WY8A 3V8VA 2PBRA 1SQ0A 1U0TA 3E22A 3GEMA 4EUHA 3JZAA 3FMGA 3BXEA 1Y9AA 3LCJA 1QH0A 2A9KA 3NO4A 1LFAA 1HTBA 1P2SA 1TYDE 3CINA 5GAJA 4FNGA 2GRJA 2VP0A 1U5AA 1H2ZA 2NTVA 2FX5A 1SG6A 2O0JA 1F06A 2QG6A 4PNPA 4X1IA 4L3VA 3KD3A 1B0ZA 4C0BA 2W2TA 5H37D 3MW8A 4K6GA 4Q9AA 4AC9A 1PN3A 1UCFA 1C9DB 5BUSA 4AG5A 4DR2M 3ZCTA 1N6NA 2HX1A 3P4UA 3R3UA 3ICCA 5KZMB 3JALA 4G4NA 1G291 1UMDA 3UKOA 1E1QD 1ECGA 2XMQA 4YV7A 1KAOA 1E2PA 4ABTA 1DXQA 5DYNA 1JFVA 2C2MA 3ORQA 1DVRA 2GJ8A 2HHJA 2XAUA 3I8XA 1SNYA 4WXHA 3EC2A 3ITEA 4I55B 2CCJA 5IJAA 1XZNA 1N4AA 4PQRA 3EBLA 3TECE 3LQQA 4QYMA 1YZHA 1DLJA 3KKKA 3UQZA 3K70D 1CNEA 1JJAA 3AKDA 3CU5A 3JQFA 1T9DA 2Q7DA 4CEJA 2BRUA 5ITXE 3ET5A 3LGXA 4LYAA 1WDWB 3TIVA 2WJPA 2F43B 4FFBA 3OUTA 4ZAYA 2GZMA 4B7XA 2REBA 3AVXA 4G01B 1X1RA 1JWAB 2HNKA 1YQTA 3F9CA 3E46A 2JK0A 1WO8A 4S12A 1JXMA 2DUWA 3WHIA 1CUHA 4DSZA 3IT0A 1HT2E 2B5OA 1UJ4A 2X58A 3EBPA 4JSYA 3FFBA 4WXRA 3F6SA 3UWSA 3OJWA 2V7EA 4TUYA 3ZVKA 1JHOA 1Q1AA 1ZC4A 3HN2A 2CNKA 3HZRA 2ZPTX 1JFTA 3HEMA 4N3NA 1FVHA 5D3MB 5T3YA 5JV5A 1OTYA 2VJYA 2P0YA 3Q7RA 1AC5A 4E2ZA 2QL9A 1C7JA 5CDTA 5ALEA 2DJIA 1Y4UA 1RCFA 3GLVA 4XOIA 1Q11A 2V54A 5TX7A 4CCYB 3VKHA 3ZE6A 1COWD 4BVLA 5BOSA 3KJIA 4PZPA 1JLHA 2NXNA 2X42A 3ED5A 4HAUA 2W2KB 4RK4A 2OB2A 2NUAB 5K99A 1NHWA 1UP6A 1LPBB 1J0BA 3GPIA 3MF4A 5A02A 3O0DA 4ENSA 1LQ2A 3ZI0A 4B6GA 4G0OA 4P36A 3CJQA 2VNHA 1RPAA 1WP4A 2V98A 2J45A 2QR3A 1M8JA 1PGJA 3B60A 4L7QA 1DGHA 3LYLA 3T5BA 1L8LA 2V45A 4NG5A 2OZKA 4UE3S 4NC6A 3MT9A 3UJDA 3N74A 1WB4A 1V37A 1MXFA 3KQLA 1QRAA 2A6PA 4CMGA 2I71A 1EVYA 2A0XA 4K9MA 3ETEA 4X24A 3CR3C 3H2KA 5TMEA 5EE0A 1EP9A 2WU3A 3TVYA 3JWGA 1MW8X 2QTFA 3DEIA 2X3UA 1GXSA 1MAVA 1DIAA 4FQ7A 4LOLA 1N9GA 3BICA 1ZZGA 4NOMA 5KTTA 3WNVA 4MUXA 2HKJA 1RWPA 1L3IA 2XCQA 2ZI3A 3VHQA 3F78A 1YBAA 2DECA 2G6TA 4BX8A 4N5LA 3UICA 1E2UA 1TZKA 1HJPA 4CMBA 4Y2VA 1EE1A 3GH1A 2PD3A 2C9CA 1JQEA 1KDRA 1TQ4A 4CDMA 3HM9A 1B3BA 1DO0A 3H97A 4ESHA 3A2NA 4D57A 5BMVA 1RJWA 3TL2A 3E3MA 4R7TA 1ADBA 1E1NA 4F6RA 5C4IA 4A9AA 3P20A 4JY7A 1TMGE 4EFLA 1D9XA 3U4CA 4P5PA 4D0GA 1GU1A 3FCUB 3HDJA 3DO6A 5BN3A 1CHDA 4YGYA 3V3TA 3F6PA 2WSSD 2P6UA 3HC7A 5A6VA 3VOBA 1F20A 1TADA 4BECA 3ZK9A 2QVXX 3BWMA 4O4IB 1DLIA 1Q7GA 1EJ0A 4DXAA 4F4HA 1IHDA 2PR7A 5LNK6 2AUTA 3OZTA 2CRUA 1BN6A 2QUJA 2Y4NA 1ARZA 4EVQA 1HFEL 3OPMA 2AQHA 3CONA 4ZEXA 5JRDS 3MD9A 5K01A 1SUSA 4LF8B 3CX3A 4TM7A 1BVUA 4NX2A 1EE8A 1AHNA 1XK7A 3DVAA 4US0R 3ZWPA 2C7QA 4B3SB 5DOZA 4D6XA 3TQSA 1HYEA 1UKCA 3D3JA 2PX5A 1R6AA 5ARBA 4NOLA 5IRCD 2VSQA 5GINE 3N53A 4WZBB 5AUPB 1RABA 3LW7A 5LR6A 1E0SA 2HBRA 2IEGA 4I9FA 4N7MA 3WLNA 3ZDBA 3TFQA 1YCGA 4FWBA 2Z1MA 2GPNA 4DY4A 1N8TA 3H11B 4XASA 1O08A 1Z7YA 3HR4A 1ZLYA 2WNIA 1PBNA 1U9IC 2BELA 2ZVJA 3UT5B 5FAKA 3NH9A 1ZD2P 4LGCA 2JBHA 3ONVA 2UXCM 1M1YE 3TM5A 1HNXB 4Q7LA 3D31A 3HKBA 2E0IA 1PR6A 4PHGA 4XSVA 5LMUM 3VI4B 1QZEA 3V4ZA 1N8KA 3SIRA 5JXGA 2GCGA 3R7AA 2O2GA 4ILEA 4EUSA 5JDIC 5CFMA 4XTCS 4ASUD 2WQZA 5CFNA 1V35A 5IVPA 2ZWAA 2DY0A 3CEJA 1G5PA 1SUAA 1PJIA 2I80A 1FUIA 1XEWY 2GZDA 4P3KA 4UDNA 3BXWA 1IDN1 1E69A 3BGIA 3G1UA 1ZOOA 1EDEA 1KYVA 4WKGA 2CBGA 2UXDM 1GZVA 3BJEA 4L5AA 4QU0A 1CIPA 1RRMA 4FSDA 1PR3A 2J3LA 2OHVA 4AN4A 3T5AA 4R3UC 1X74A 1ZK1A 3I5MA 1Q83A 3PGKA 2NM0A 4FJ1A 4DUZB 2IYUA 4CGYB 2JARA 4ESEA 1HURA 5AK6A 4R2XA 2O2EA 4OA8A 1GVNB 3LLVA 4WCFC 5E4JA 2I1LA 4HDNA 1E32A 4KAFA 3GXBA 1EDZA 2GVZC 2C96A 4YY3M 3LPCA 4BAUA 2GO1A 3E9EA 1A8HA 4YP9A 4K03A 4OVKA 2FZCA 4HQFA 3AIKA 2V7BA 3CRVA 5K20A 1W6RA 1RR6A 3ADBA 1TR8A 2F1JA 1XN1A 4Q3EA 1YB5A 3LRTA 1XZIA 5E1BA 3GV0A 1E5XA 1YBVA 1VEJA 4CI9A 5KQDA 1JSCA 1QB7A 1RWNA 2BZGA 2TRSB 3MWLA 3NWEA 5JG7A 4R5MA 5JSKA 4B3RM 4A82A 1WQ1R 4GEWA 4WPGA 1NP6A 1Z2DA 1PNOA 1TC1A 2LVAA 2ERCA 4XPIA 4DV7B 5DOVA 3BHMA 2H7XA 1YU9A 4G4QA 5DWDA 3TGWA 4AMBA 3G1WA 2B4TO 4B7ZA 2FEMA 1VJCA 4M8NE 1EWYA 4QXQA 4HAYA 4JBLA 3V4OA 1Z35A 1B4DA 1BX0A 1Z6XA 1RHQA 3H6HA 2HXYA 3KEGA 5CNIA 1U2GC 1YD7A 2MYPA 3GWGA 3OQVA 4H08A 4IRMA 5E6SB 3UK7A 3V8NA 4D45A 4E5YA 4EJSB 5JAPA 5SZKB 3AEQB 1W0JD 3ONDA 2FH0A 1TW3A 3QITA 3RREA 3U3XA 4WY2A 2O01F 4V1CI 3S81A 4DV0B 4HKTA 1YTLA 4KIGA 4O4JB 3UJ7A 1ZMBA 5KQLA 2AR7A 3BQMB 1RPZA 2HSDA 4WN9A 1AKYA 1YVRA 2C3MA 4Z0HO 1H4SA 1QVAA 4X62M 1P18A 2UYGA 2Y1FA 1E3MA 1IIBA 1XJ0A 4HZUA 3WG9A 2Z57A 1HLFA 2YWDA 3EQ8A 3GLGB 2XLBA 1G4AE 3AUKA 5FPKA 3CW2A 4CFZA 1I8TA 2H57A 1GTJ1 1RJDA 3H2BA 3PQ6A 4KX5A 4F6CA 2QW1A 2Y8EA 4GT1A 2EBUA 1FNMA 3DMRA 1YZYA 4C07A 3OT1B 1HDXA 3OOHA 1JQ3A 1XXHE 5ABPA 1I7DA 2XEXA 3CLTD 4LCJA 1Z56C 2JLZA 1S96A 2ATXA 3PJFA 1YDHA 2P11A 4YAOA 5CG1A 3GDHA 2OQVA 2V7QA 4EW1A 1QOPB 2IKQA 4FU0A 2P9TA 2BBTA 1Z4LA 2H1HA 1X8KA 1FYVA 5JAUA 5BN4B 2C2YA 2EX1A 2I22A 2W4IA 2B5WA 3QEJA 1NSFA 5HJ2A 3UC5A 1ZJ4A 1R0CA 5FTLA 2GN9A 2L6OA 1PQPA 2GTIA 1Z3IX 3ONNA 1R74A 4BFVA 1FTQA 1GPYA 3PTLA 4FJ0A 3ZTWA 1KYZA 2Y71A 2R68A 4UE6A 3PPXA 3BWEA 1SUBA 1IL0A 1QIKA 2X9LA 2XYQA 1AK9A 5KSZA 1TH2A 1TJPB 1AMUA 4YAFA 4D81A 1MDFA 2JGFA 3HYLA 1G8FA 1YE3A 5H3LA 1SUDA 1TPYA 4MDFA 1LPNA 3ABOB 2I6GA 3GDOA 3L7LA 4WX2B 3IEIA 4DSTA 4FS3A 3RGPA 3KWMA 1Z5GA 3Q5GA 4E4YA 4I8XA 5IC6A 3L0DA 1TNDA 2EZUA 1H6CA 3QVGA 3N2GB 4LDPA 2NUTA 4EW6A 1SHJA 1U8EA 1LCIA 1B2RA 1XF1A 2ACKA 4TWIA 3WZLA 3ZDFA 3I8OA 1M5TA 3EDCA 3B13B 4FNMA 3ZWMA 5FWXB 1BDMA 1K63A 1K06A 2HSGA 2HA3A 1CQJA 2EYQA 4Q48A 2C82A 2KBFA 2REXB 4JT2A 4HNQA 1ML4A 1N0UA 4QPJC 4DOMA 5LLTA 1N8NA 2Z7JA 1R6BX 4QBKA 1ZCAA 2WLTA 3ECAA 1QG0A 5HNKA 1L5RA 3L6RA 3C3PA 1E3EA 2R25B 4TRMA 4ZJZA 1M7GA 4BKMA 1IUNA 1H1TA 1M0TA 4Q34A 3UY4A 1NO1A 1WSAA 1AJEA 1AY0A 1I2MA 4BLUA 1GL9B 3L1UA 3F4KA 3FMOB 5C51B 2ZRQA 4TRJA 2C54A 2OZPA 4IYJA 4DS3A 3MYYA 2OXFA 4PGMA 1GAEO 4LOJA 1WXHA 2WJVA 3UMGA 4MW0A 5DVZA 2AW5A 5B6PA 1T0BA 3PLAE 3ZTYA 1A4XA 3UQYS 1E2BA 1XAGA 1XTUA 3IQFA 4X45A 2VRNA 1WB9A 2QN2A 4GMFA 3DZKA 3RT1A 3AM5A 4PO3X 4BX3A 3R0JA 5C7IO 3FI9A 3SXPA 3U17A 1DJOA 1JVNA 4YK7A 1G5HA 1MO6A 5IMBA 3KOXE 3N0VA 1WZNA 3CRNA 2YVAA 3F6RA 1MN3A 1ULAA 5FEUA 5JC1A 2XGSA 4IDOA 4LJYA 1R18A 1Y3AA 3GRVA 2GK3A 4KFRA 1Q5PA 2H4FA 3JZFA 3ZLTA 4DNXA 1C0PA 4P7JA 4TUYB 3DG9A 5K4AA 3FSEA 4RY2A 1DAEA 5EZ6B 3KYBA 4PLVA 3T1YM 4F8JA 4B83A 3QE9Y 2JZ1A 2PD6A 2BSQA 2F8LA 3BK1A 1T29A 2VF8A 2YV1A 3UXHA 1U2SA 3TLEA 4Q5IA 1JHDA 3C14C 3FMFA 5EAIA 3TZLA 3TQRA 4BQOA 4LZPA 1U1FA 2RH4A 4L5JA 1NJSA 4GLJA 4B6OA 3GFOA 2DT5A 1SXHA 1X3SA 5G1NA 2RKOA 3WDSA 3PX7A 1C3OB 3HNPA 3O9ZA 4HQ6A 1UZMA 3GFQA 2GK4A 1CB7A 2PT6A 2CV0A 2ECOA 2UZ0A 3A9UA 3BGSA 2R1ZA 5FTKA 2EGUA 2Q8NA 2M1XA 1WUJS 4C87A 1Y89A 1Z7WA 3ELBA 2B8JA 3W3ZB 3PJRA 421PA 5BQXA 1DEAA 3WMRA 2P0AA 1WY7A 1TUBA 1G2QA 1Y4SA 1YIDA 1T2CA 1DWUA 3CRQA 4ZWNA 2UZIR 3VR5D 4JUFA 4W5HA 2J3HA 1T8SA 2QSZA 4IIJB 4OKNA 1G2IA 2EWWA 1TZCA 3HYCA 3M5WA 2KDLA 1LLCA 5JAQA 4RPGA 2GYVA 4R2JA 1AU9A 2ZCVA 3RBAA 4CMCA 1JQKA 1MCZA 1CQWA 1WR8A 4QPDA 5D5HA 1EVJA 5BSVA 5IHPA 4Q4HB 1C0IA 3HCNA 3AVTA 2LVOC 2GQFA 3HH8A 3KWFA 5KUTA 4FGJA 3NDPA 4DV6M 2HIAA 4KPUB 3UM9A 1DAGA 1GKKA 3W4KA 4X7PA 2CLOB 2ZUBA 1UBSB 1ZOLA 2JIRA 2JJMA 1QIFA 1YS6A 1VSQA 1P9RA 1BD3A 1XEXA 3KFLA 1RZRA 2FEAA 4BWVA 3EVNA 3LM8A 1VJ5A 4AKHA 2C5BA 3EYAA 4RXTA 1IQUA 1KZHA 3VTFA 4Z54A 4LOHA 2VHJA 3A3OA 3FX2A 4GNKA 1ZMWA 1D6JA 1D9ZA 2VHVA 3G2PA 1R8YA 3QPVA 5ER9A 2J3KA 5HQ3A 1JEYA 2F5SA 1L8XA 2Z98A 1EUZA 1SXJE 4K05A 3JPYA 3IOEA 3HL4A 4F7WA 1U8AA 2GK6A 2VK1A 4TKVB 5JSYA 1EHIA 4DL9A 1CSEE 1OBOA 4A10A 4DA8A 2FUEA 2DAEA 4JEUA 3WAKA 4GITA 4UM7A 3AY0A 2EW2A 2G77B 9ABPA 4RYLA 3MJFA 2PLAA 1N32B 4LDJA 4D5GA 4FYJA 1HFKA 2VWPA 2F5QA 3ANXA 5EIOA 2OCXA 4OXNA 3WI7A 4DM3A 1P7WA 5GVSA 2XMPA 1ZM4A 5E4TA 4S05A 2WM8A 2G1PA 3GLGE 2VR1A 4OHYA 3I12A 5KJ1A 1COZA 5AKGA 1NJ8A 3VH2A 5A0FA 4OD0A 1V6CA 1WW2A 3LCMA 3RS7A 4POOA 2RJ3A 2DWOA 3QSGA 4PU0A 4AYXA 2IE0A 1NT4A 1IH8A 1N2SA 4DVJA 3CVUA 1EFPA 1W25A 4UARA 4BS9A 4PN7A 1B8UA 2R44A 3T06B 1BH6A 1EWVA 2Q3BA 1XZMA 4QOGA 3K71B 3ROZA 2P9CA 3DOAA 3IIKA 3BAFA 1LPSA 3AWDA 1JS1X 1AB6A 4E5MA 3UT5A 4ZEMA 4CL3A 1F2TB 1PQWA 1WB5A 1OFHA 1XTPA 3NM6B 3PUXA 4N3GA 4Q1BA 4CN8A 4WXYB 4ZCRA 2L7IA 4KU4A 1AKVA 4FKZA 1GV0A 4R8SA 2AG5A 4FHEA 4WDRA 4XGKA 1DX9A 3ICVA 2Q4DA 1WMBA 3ITKA 1H8ED 3ZCXA 1QE3A 4EVRA 5J43A 1GG5A 1UBKS 4GR5A 1HOTA 3WP0A 1JZSA 1GPH1 1T2UA 4AF7A 1Y4ZA 4AXXA 4C7MA 5BY2A 2ZQ5A 1WF6A 5C1IA 1MIOA 2QD1A 5CM2Z 1ZCJA 5LYYA 5ITWA 1ZJ6A 13PKA 2ORYA 2RHDA 2FWJA 5ALGA 3V00A 3H8JA 4Y1RB 1QGUA 3CJTA 5DB4A 3GN2A 1LF5A 1ZVJA 2A3RA 2L09A 1W0JA 2FPKA 2W6QA 3RJZA 1TMOA 5ESXA 2H00A 1RM3A 3EEIA 4ZTBA 1U02A 2WAMA 2XUFA 2WKSA 2DWUA 3ZG6A 4ZI2A 3DOJA 1USWA 1SA0B 2NO1A 3KFXA 3WK8A 5DPMA 3DR3A 2PA0A 5ESRA 2PMFA 2ZBGA 5ECGC 1LC0A 3VZQA 1X7XA 1Z7GA 2Z6UA 1V4BA 1J2RA 1GQOA 2LDBA 4NBLA 1QFZA 2HXGA 2JFOA 4YRSA 4KITB 5DHTA 1ODLA 2Y1CA 3FWNA 2LVQD 5GM1A 3N3AC 5G4LA 5B2FA 3D9QX 1IWOA 1FP4B 3NW9A 3VR2D 1B6RA 1VHWA 3NIDB 1ZJWA 4FT4A 1W5TA 2WIDA 4EGSA 4R4JA 1S89A 3LQ4A 1UXGA 3OH8A 1CJVC 2NXWA 3IQIX 4AWAA 4BYMA 4MVJH 1E7QA 2ONZA 1E9FA 1W93A 2OO7A 4OXXA 4ZVSA 4FHCA 1OIXA 5FJJA 2V59A 2BMWA 4ZVNA 1U9IA 4B6FA 1CQPA 2ZSFA 5A2QS 1SVNA 4G1FA 1WDKA 1MP0A 1HI9A 4FGLA 3OECA 2QE7D 4TVOA 5HOEA 4URUR 2EW1A 1A98A 3MTDA 3TN7A 4YPOA 1S8FA 1T3SA 2QPAA 1NW4A 1ZP6A 2VS1A 3D1VA 2QTTA 4TMWA 4FUTA 2QMUA 4HNGA 1LQTA 4CISA 2ATVA 2IEBA 3R6WA 3DHEA 2QX7A 5AMXA 3S8EA 4JCCA 3CN9A 4MI1A 2KHZA 5IVDA 3W2HA 3P9NA 3TVDA 4CE6A 1T13A 1XF9A 1CRLA 2BFFA 2R11A 5FTMA 2VF5X 4FW8A 4P2BA 2Q62A 3OLQA 4DMRA 4P4TA 4R2WA 1DS6A 2CHEA 3B70A 1MJFA 3H05A 4HB4A 2FHPA 2WB2A 4B7GA 3H1PA 3MMZA 1SELA 4PGGA 2HUNA 2VXYA 2VUIB 3OCJA 5DI3B 5LDHA 1A8UA 3ESZA 4KHPM 1SBCA 2DR2A 1SU8A 3DKIA 3LUBA 5JSFA 2XJ4A 3I9JA 2WZQA 1GCIA 1G5TA 3MRSA 5HIJA 2JLVA 4ZQIA 3AF6A 3IH5A 4Y2SA 1I51A 1H0HA 1WLSA 4Z5XA 1EM8B 5JYCA 4MQLA 4B32A 4AK9A 4WERA 4WADA 3THYA 4L5IA 1UZLA 3ILSA 5DNEA 1OKSA 2B0JA 3QYJA 1EE9A 2HW8A 5DBIA 3TK1A 3M6AA 3VVLA 5JQGB 3HUTA 2ADMA 2Y66A 3BWCA 3E7DA 1MB3A 4MLZA 1OT5A 3PUWA 5T8KA 3L9WA 3FZGA 1KYTA 1TQHA 1LQUA 2ZP1A 1CULC 1TLFA 3MYRA 4C7JA 3AV0B 5I8ZA 1A9XA 4DV5B 2FPPA 1BVSA 1DWOA 2CL6X 1XJCA 1Y8AA 2WV7A 3OTWA 3LCUA 3T4EA 1BEZA 1NQVA 4QYXA 3WGNA 2YWHA 5YASA 3V7YA 4LYEA 3LUJA 3RVOA 2DI0A 4KPYA 1MX5A 2K2QB 4U2CA 3OQIA 4MPPA 4CV3A 5JMWA 2PTGA 1HE8B 1BOFA 5JYBA 4FVMA 1EIZA 4KWIA 4ZEOA 1YDWA 1EAYA 1B42A 3PYXA 4TMXA 2OOAA 2JIZD 4LQ4A 2NAPA 1UBCA 1OYYA 4V0MA 3QKSA 3UYLA 4Z9XA 3AFGA 1AKTA 2VSNA 2UVQA 3I62A 4JSRA 2BKAA 1MC1A 1ML3A 3GD5A 3OA2A 2YASA 3PXDA 4G5FA