1SG9A

Crystal structure of thermotoga maritima protein hemk, an n5-glutamine methyltransferase
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
274
structure length
274
Chain Sequence
SGAERKIWSLIRDCSGKLEGVTETSVLEVLLIVSRVLGIRKEDLFLKDLGVSPTEEKRILELVEKRASGYPLHYILGEKEFMGLSFLVEEGVFVPRPETEELVELALELIRKYGIKTVADIGTGSGAIGVSVAKFSDAIVFATDVSSKAVEIARKNAERHGVSDRFFVRKGEFLEPFKEKFASIEMILSNPPYVKSSAHLPKDVLFEPPEALFGGEDGLDFYREFFGRYDTSGKIVLMEIGEDQVEELKKIVSDTVFLKDSAGKYRFLLLNRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel mode of dimerization via formation of a glutamate anhydride crosslink in a protein crystal structure.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Unknown function
molecule keywords hemK protein
total genus 90
structure length 274
sequence length 274
chains with identical sequence B, C
ec nomenclature ec 2.1.1.297: Peptide chain release factor N(5)-glutamine methyltransferase.
pdb deposition date 2004-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05175 MTS Methyltransferase small domain
A PF17827 PrmC_N PrmC N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1sg9A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1sg9A02
3FUVA 2EFJA 3T7TA 1F3LA 3FTDA 4E32A 3I64A 1VL5A 1VEGA 2PSSA 3GNLA 4PIMA 2L4EA 3EEYA 3IEIA 5ERGB 3UFBA 5CD1A 1L3CA 3ME5A 3SVZA 3ERCA 2I9KA 2V7EA 2XYRA 3UJ9A 2DKLA 1EFUB 2AVDA 3P8ZA 5E2BA 3EGVA 1NBHA 4RX1A 1XB2B 2UYHA 1JG2A 3LDUA 3FPFA 3AY0A 1ORIA 5K0NA 3G2OA 2JY5A 5EKUA 1BKYA 4YV2A 1QYRA 1PJZA 1XCLA 5CM2Z 2L2DA 4P7KA 1TTEA 4P58A 4HC4A 2FYTA 3FPGA 2PV0A 5ICFA 5DM0A 2DENA 2NP7A 1R8XA 2P3LA 1R00A 4QDKA 5DTRA 1D2HA 3B7PA 3P9IA 3P2EA 1KYZA 4FP9A 5GIPE 5U4XA 5LQJA 1G41A 3DMFA 3LKZA 2XBMA 3DR5A 2HTEA 3FRHA 2YQZA 3ELDA 2ZWAA 5KYGA 5BW4A 2Y1XA 4E31A 4HTFA 2Z6QA 1UWVA 5FTWA 3TLJA 2YVLA 3HVHA 3MTEA 5CVJA 5B1SA 3JWGA 4QDJA 3FUTA 2VDVE 2PT6A 2VP3A 1NW3A 3LCCA 4WP2A 2A14A 1OTRA 1L9KA 4E2WA 3MCTA 2AS0A 2AN3A 2PBFA 4U7PB 3R6TA 4BP1A 2PX8A 1P3QQ 2MR9A 3KKZA 4PNEA 2PLWA 3NJRA 3O31A 2DNAA 3KPJA 4ER0A 4GF5A 4CTKA 2ZIGA 3GXOA 2BWBA 4KWCA 3ER8A 3CGGA 3S68A 4ATNA 1NT2A 4OA8A 2ZTCA 5P8WA 1BVSA 2IDJA 2JHAA 5JI2E 2P7IA 4NECA 4PINA 3UJDA 3BWBA 2CMGA 1L1EA 4DA4A 1XCJA 2GH1A 2GS9A 3PFHA 4RTOA 3ANXA 3GO4A 3TQSA 2ZBQA 3R9XB 1VG5A 4F1IA 4R6WA 1AV6A 1IM2A 5K0BA 1YZHA 1DUSA 2K4MA 5K0JA 3SSNA 1QANA 2JZ0A 3MGGA 4PYLA 4UOEA 3OU6A 2JP7A 4R71A 3D2LA 4OQDA 2NXNA 3EVAA 2PT9A 7MHTA 1M6YA 5EGSA 3FTFA 2EJTA 2MJ5B 3JWHA 4GEWA 1Y8GA 4BLWA 1JTEA 4X63A 2CMHA 2DHYA 3EVZA 3NWBA 5K0LA 2YR0A 4RTMA 2UYCA 2BH2A 1ZMVA 3E7PA 1ZGAA 1HQYE 2JHCA 1SKMA 4QVKA 1V39A 4BLUA 3UBTA 3A25A 2JZ1A 3CVOA 3P9KA 4RVDA 4RTPA 5HIIA 2YUIA 4R8SA 3L8DA 2ZTHA 4FGZA 5M5BA 5EHIA 5HEKA 8MHTA 2DPMA 1WG8A 4PONA 3REOA 2ZVJA 2R6ZA 5BXYA 4PYQA 4KDCA 3GLFE 4X60A 2O06A 3EVDA 4GOND 1BC5A 2BZGA 4FS8A 1KYWA 2RRUA 1QAMA 2BM8A 1MJFA 3EMBA 2UYOA 4UN2B 2G8NA 5E9WA 3R3HA 1GO5A 2IH4A 3OZRA 1RJFA 1NKVA 5DTQA 1XDSA 5EIFA 1SG9A 4DZRA 4HGYA 3GJYA 1U2ZA 4HGZA 4PYJA 3TMAA 3SM3A 1I1NA 3GRYA 3DMGA 1F4IA 2NXCA 5CIYA 4FSDA 2QNJA 4POOA 1N7IA 2ZWVA 3G88A 4OQEA 3EVBA 1NW8A 3IV6A 3KQQA 1ZG3A 1IM8A 2DAGA 5CVEA 3SX0A 3AWIA 1HMYA 3A27A 3AXTA 4FT2A 2Z6UA 3LX6A 4YMGA 1F38A 4BY9E 1BOOA 4IV8A 3G5TA 2UYQA 4Q7JA 3FTEA 1P1CA 3OCJA 4FSXA 2Z6AA 2B9EA 1HT1E 3KQTA 2AVNA 3MTIA 3P2KA 2G1PA 3LDFA 3LGAA 2H5XA 1A5TA 4OX9Y 3Q87B 3UWPA 2QSFX 5HILA 2WK1A 2HAKA 3R24A 4WVLA 1T43A 1RI1A 1QAOA 3ELUA 3I5UA 1YLAA 3H4JA 3CCFA 1R74A 4AZTA 5HOQA 4DBGB 5EMJA 2OYRA 5K8VA 5HZMA 1WR1B 2AOUB 3FUXA 2LTUA 1OQYA 2NYUA 1KR5A 3LBYA 3HEMA 3K9PA 1NW6A 3KQWA 3E46A 2ZLBA 4RYLA 4EK9A 5KS2A 2YXDA 4HG2A 4ER5A 4DCGA 3HNRA 1QAQA 3SXJA 2HMYB 4RVFA 5KVAA 4CKCA 4QPPA 4AZSA 3GU3A 3E05A 1XDUA 3PTAA 4E70A 3KQSA 2OOAA 1AF7A 3FPHA 3HVJA 2JY8A 2LD4A 2ADMA 1WJ7A 4R05A 2QY6A 3UJ8A 1PGYA 2VDUE 4LWPA 2OXTA 5CCBA 2B78A 5HFJA 5GOZA 1JQEA 3IECA 2PXXA 3G8BA 4PIPA 5E9QA 4V0RA 5DXJA 4GOOD 2C7QA 1VBFA 2XVMA 2DAMA 4GC9A 1KPHA 3TFWA 3TKYA 4KIFA 1VP3A 5DTMA 1JR3E 3UJAA 5MHTA 4M37A 4X41A 4YUZA 1UFZA 2MGWA 1Q02A 4IV0A 3BKXA 4C07A 2PX4A 2KNZA 2PJDA 2HV9A 2P3OA 3HA3A 5EC8A 1M0EA 3PFGA 2ERCA 2ZSUA 2OB1A 4MIKA 1INLA 1VP9A 2AOWA 3VSEA 5LR6A 3LCUA 3DLCA 3PT9A 1FBNA 1FP2A 2NNWB 4ISCA 5LQNA 2AZTA 4C04A 4ZTBA 3DP7A 2OO9A 2ZBPA 3FYDA 5DM2A 3CBGA 2V74B 2IH2A 3C6KA 4PYKA 3M33A 1Z3CA 2VDWA 3ER9A 3FPJA 5F2KA 3VC1A 5FQNA 4MWZA 1SUIA 3QV2A 3VYWA 4PYNA 4DCMA 1SQFA 2LVNC 3I9FA 3THRA 4E30A 2P7HA 3G2PA 3P97A 1I9GA 4LWOA 5GP1A 4XCXA 4C05A 2FHPA 3OU7A 4R6XA 3HVKA 2O57A 4A6DA 3HP7A 4YV1A 4EMSA 1RI5A 2YX1A 4G56A 2FPOA 5EMKA 5FHRA 4ER3A 3KHKA 1WXXA 3MB5A 4QVGA 1XXLA 3B5IA 3GLHE 2JUJA 1TPYA 5E2AA 3BZBA 3EVGA 5T6BA 1Q0TA 3KR0A 2OB2A 4A6EA 1WGNA 1JR4A 2LBCA 5FCDA 3GRUA 5EMMA 3P9NA 3P71T 3QOXA 1EAMA 4XUCA 2JY7A 3M6XA 3ORHA 2BR3A 3LHDA 1HNNA 5C9ZA 5DXAA 3T7SA 2BWEA 2GA9A 2VS1A 3G7UA 2ZIFA 4O29A 3FUUA 5EG5A 5GIOE 1JQ3A 4P7GA 1ZMUA 4DMGA 1SVUA 5EQJB 5FQOA 3TOSA 3DTNA 1WZNA 1E94E 2R3SA 2JY6B 4RWZA 5T67A 1DO0A 3BGDA 4C08A 1XJ5A 3SMQA 4EVIA 1VE3A 3OFJA 2K0BX 5DPMA 2ZBRA 1JG1A 1SQGA 2EX4A 3UZUA 5E1DA 2GLUA 4PCAA 3EGEA 3DH0A 4HSGA 4JXJA 4V0QA 3TM5A 2P40A 4E2ZA 3BWMA 3KPUA 1RJGA 3SGLA 4OBWA 1IXKA 5C1IA 5FWDA 1CUKA 2DAIA 2JNHA 3BUSA 1Q0SA 3C6MA 3OZSA 4GUAA 2HWKA 3GRZA 3UJCA 5BP7A 3KQYA 5EZSA 1P1BA 3EMDA 3PX2A 5CUQA 5EEHA 2JJQA 3DULA 5FWAA 5KQRA 1VIDA 2QYOA 1VLMA 4RV9A 3GDHA 5DWQA 5K09A 2OPBA 1R6AA 1WXWA 3PLAE 1AIPC 5DLYA 2AOTA 4CKEA 4DF3A 1R8YA 2ZCJA 5K05A 5FULA 4RTRA 4HEOA 1EJ0A 4P7JA 5IH3A 5LQAA 2C7PA 4AX8A 4M7RA 3X0DA 4F2LA 2GAFA 1R4GA 1O54A 2G71A 2I6GA 2WA1A 3BKWA 1DV0A 2PY6A 3AXSA 5EHGA 3B89A 2AN5A 3OU2A 4GEKA 5DRTA 1WGLA 1OAIA 3FPEA 5CCXA 3IHTA 3NWEA 3UA3A 2VZ9A 2BR5A 5E9JA 4QTTB 1O9GA 3HCAA 5D1HA 2Q41A 1BHJA 4OBXA 4K6MA 1DL5A 2IDKA 5EZQA 1L3BA 3TRKA 1G38A 2HR1A 3A4TA 1HT2E 1D2GA 1XVAA 2L4FA 2CL5A 3B3JA 3GWZA 4PYMA 2YXLA 4GBED 4LECA 2AR0A 1YFJA 1DCTA 3PVCA 5EPEA 1JQDA 2IH5A 4KDRA 5ICGA 5LQKA 3KPYA 1ZGJA 2FRXA 2EJUA 3M6VA 4RTQA 4RTJA 2B3TA 1KYIA 1X1DA 1QZEA 1NW5A 2QRVA 3HA5A 4PGGA 2AOVA 5EEGA 4YUVA 2C7OA 4E2YA 3OFKA 3EGIA 3PX3A 3NMUF 3U81A 5K0EA 1JG3A 3BXOA 1YF3A 4KW7A 2EJSA 3E23A 3F4KA 3ELWA 3HCEA 3E8SA 5KQSA 2IBSA 3LECA 4YMHA 2WA2A 1ZHFA 1G55A 3THSA 1N7JA 2ZTDA 3A7DA 1VPTA 2UZ4A 3NDJA 2H1RA 1T6OA 1L3IA 2G70A 2QRVB 4RVGA 4PGHA 2ZFUA 3CJTA 2AOUA 3KQOA 3KU1A 4GC5A 5DM4A 4C03A 1YB2A 3HTXA 1WIVA 1JG4A 3PB3A 4QTUB 2LVAA 4MHTA 2PXAA 3KPWA 3LSTA 3PS9A 3EVEA 2NP6A 3K9OA 1JTFA 1X1BA 1G8AA 3LL7A 1IFYA 1YZ3A 4IWNA 2G3QA 2FCAA 1FPQA 2R0IA 1XTPA 1ZV1A 2CWBA 1PRYA 2N47A 1OR8A 3OZTA 4MTLA 4Y2HA 5DRYA 2IFTA 5DSXA 4EKIA 5LSAA 2PVCA 2JHPA 1NV9A 2JG3A 5EKXA 2O0LA 5EOVA 2O07A 2NXJA 2EKFA 1NV8A 1N2XA 3TPZA 2ZZMA 3F92A 2P8JA 4CKBA 4RSRA 1EIZA 1JSZA 4AUKA 1G6Q1 3B3GA 4WXHA 3MHTA 5GM1A 1KXZA 3IYLW 3OPNA 1H1DA 3C0KA 3GRRA 1C7YA 3VC2A 4GOLD 4DKJA 1KIAA 3R0QA 5DT2A 3UJBA 2LVPC 3K6RA 4C4AA 3DXYA 3DLIA 3M6WA 3V8VA 2JH8A 2DAKA 2ORED 1FP1D 4M36A 1P39A 4QPNA 2OY0A 5FA5A 2F8LA 5E1MA 5G02A 3CKKA 2OO3A 4RTNA 3EVFA 4HTFB 4KRGA 3FUWA 3FYCA 4RTKA 5F2OA 3JWJA 3C3PA 4PYIA 1EJ6A 3DUWA 4HH4A 5LQUA 4H0NA 4KIGA 1G60A 4PWYA 2AOTB 5F2NA 5E1BA 1G4AE 1VEKA 3NVKI 5HIKA 1VQ1A 1RI3A 2ONYA 3KQMA 3G89A 3ELYA 4ER7A 1WHCA 3MCZA 2OKCA 2GPYA 3DXXA 3KQPA 4L7VA 2B2CA 1UIRA 2B25A 1G8SA 2BR4A 3G2QA 4FR0A 4M38A 5H02A 4B17A 4AZVA 3KPVA 4PCLA 2CP8A 2IIPA 3FTCA 3G2MA 3RIEA 4EKGA 4LG1A 3T6PA 3A7EA 5JR3A 5ICCA 4CXMA 1ORHA 3LKDA 2XVAA 3AJDA 1X19A 3JWIA 3UA4A 2P41A 2DZLA 4XUEA 5FA8A 1WY7A 2H00A 3MMPA 3OE5A 3BWCA 1QZZA 5JUWA 5K01A 2PGXA 2C7RA 3HCBA 5EVJA 2DAEA 1KPIA 1P91A 1UFKA 3C3YA 3HCDA 3TM4A 4E2XA 1DO2A 2XYVA 5LQCA 4DQ0A 4RTSA 4G3OA 1IY9A 3LBFA 1AQIA 3LPMA 2KNAA 4KVZA 1OKSA 3T7RA 5K0GA 2PX2A 3RW9A 3SSOA 3Q7EA 4Y30A 1YUBA 4R8RA 4C06A 2OZVA 10MHA 2LVOC 2P3QA 3I58A 3MAGA 5E8RA 2BM9A 5DM1A 5EMLA 4FZVA 2YTZA 2OBFA 5C0OE 5HIJA 2XYQA 5E1OA 4PYOA 2P35A 5CVUA 5GM2A 1MHTA 5K0FA 2OOBA 3MERA 2QHOB 2WZJA 2ZIEA 2EKKA 3HVIA 3BBZA 3KR9A 4GOMD 5CVDA 5D1NA 1JSXA 1Y8CA 5E8JA 4EQZA 2KNVA 3GGDA 3KR1A 2EG5A 1D2CA 1X1CA 5FHQA 1TW2A 1TR8A 1KHHA 2HNKA 2I62A 3CJQA 2G72A 2O25A 9MHTA 4X61A 3HCCA 3LCVB 3MQ2A 3NVMB 4CTJA 2IGTA 1ZKDA 1ZMWA 3P9CA 5DX1A 1VDLA 1NW7A 2Y1WA 2PWYA 3SSMA 4YUWA 1EQAA 3O7WA 3BWYA 2NXEA 2ONZA 4HRAA 3B3FA 3T0IA 5LQRA 5K03A 4RTLA 4YV0A 3M6UA 3E21A 2FK7A 2PWPA 3TKAA 4IKPA 4AZWA 3WSTA 2DI0A 4YUXA 1X1AA 1AQJA 4P7FA 2GB4A 1VEJA 3NW9A 3IHPA 1YFLA 3GLGE 5GINE 3GRVA 3GIWA 1HJPA 2AOXA 1NE2A 2FK8A 1G3IA 2KHHA 1SUSA 1ZQ9A 2CKDA 2PX5A 3M4XA 4ER6A 3EPPA 3ID6C 3UJ6A 4F86A 1FJXA 3LDGA 2CWWA 2K9DA 5DX0A 1V92A 3TR6A 1M6EX 2ZZKA 2KW5A 2QE6A 2JH9A 4F84A 1MN3A 1I4WA 1O9HA 3HCFA 3M70A 3DOUA 3H2BA 5IKMA 3DMHA 2AN4A 2ZULA 3EEOA 3P2IA 3BT7A 4CWAA 4E33A 3G8AA 5FUBA 4Z2YA 2LVQD 3GLIE 1XDZA 3CC8A 3K0BA 4BLVA 3EVCA 1EG2A 5DSTA 4U7TB 2ESRA 3QOWA 1XXHE 4XUDA 2IBTA 3HA7A 3SR4A 4GQBA 3NDIA 2QM3A 3NTVA 3OE4A 4RVHA 5FADA 3UJ7A 3HM2A 2DULA 2ZW9A 4DM3A 2PKWA 2H11A 1RJDA 1TW3A 3A26A 5BW5A 5ICEA 5DFLA 1RI2A 2YXEA 4QQKA 5T64A 3FE3A 1RJEA 5K0CA 1B42A 5HIMA 3G5LA 4BP3A 4F85A 5CVVA 3BGIA 2E5WA 4QQNA 2HWJA 1NBIA 4YUYA 3V97A 4X1OA 1KPGA 4MQ4A 3RODA 3DXZA 1WS6A 3KQVA 2PXCA 5EIWA 3CJRA 3I53A 3GCZA 2ZZNA 3KR2A 5DX8A 1R18A 2I7CA 5GWXA 4OA5A 2IP2A 3O4FA 4FT4A 3BGVA 1IXSA 2IPXA 2P1DA 3FRIA 1RI4A 1KP9A 2MROB 2O05A 3FZGA
chains in the Genus database with same CATH superfamily
3FUVA 5EJEA 3PHIA 3ZGVA 3R2JA 1CNFA 1UL1X 1MG0A 1L3CA 3PDCA 5AFSA 4WNIA 1MB2A 2BEWA 2HMUA 2VTKA 5KDDA 3KVNA 3L82B 1UOPA 4H16A 4MV9A 4RJLA 4JLNA 4L7QA 4B71A 1E5TA 2ZTVA 3CR8A 2WSIA 2AB0A 4M6WB 2I3BA 2EUCA 2D3TA 1TTEA 2F1KA 2W2PA 4Q24A 4X66M 3K9NA 3BBLA 5ICFA 4M9XA 4IVRA 3HN7A 1QONA 1KMMA 4G0PA 1GNSA 1U65A 3TE7A 5A62A 5ITXA 4DV3B 4MVXA 1ONOA 1QIFA 1JHDA 2ODAA 3DMFA 3KKMA 5GONA 4BXOA 1DBQA 3M6FA 3I0MA 3GXBA 5BMOA 3S2GA 1XMVA 2A1IA 2EJVA 1QQAA 1DAFA 1F0NA 3RRNA 3ZBTA 2UUBB 1E5QA 4RSGA 1A50B 3ZWPA 3O3OB 2FZ4A 2X86A 3JWGA 4PX9A 3SDZA 4D0NA 3LCCA 3PUKA 3EF0A 2R1ZA 1OLUA 3KRTA 3R7BA 3BIFA 4W9NA 3OUTA 3TRIA 4Q39A 2AS0A 2CC2A 4KH1A 3K32A 2TMKA 721PA 3D0KA 3WZLA 4LJKA 5AM2A 2Z2XA 3O31A 5CR9A 1DIBA 2N46A 5AUQA 4CTKA 2RJ3A 1X7WA 5LMUM 1F1BA 1NF3A 1F9AA 4M1KA 3RG2A 5LMZA 3F71A 4GD3Q 3AHIA 2BFFB 4CEJB 2PGAA 1MDFA 5K3DA 2Z1DA 1OZAA 1DJPA 1T9CA 1EFRA 2OG1A 4OXXA 2Y0EA 3BMCB 1IHXA 2OBNA 2ZBDA 2ISSD 4NYJQ 1QIJA 4YRPA 4CQLB 1V43A 3JQBC 1XCJA 4FZ5A 1B6GA 3GO4A 5E4YA 3A1EA 3IIMA 3R9XB 4IO1A 4MVJI 1OLUB 5B5SA 3DE4X 3IEVA 4BYGA 3K2IA 4O4IF 5KREA 1US8A 1IXRC 1ZW1A 1BW9A 2V5VA 1EYZA 2AT1A 2V9ZA 4L28A 2IUFA 4BNMA 1J8VA 1F20A 1C8KA 5F9MA 3VU9A 3GVHA 1ZC3A 1Q1GA 1IEVA 2J31A 3ETEA 3GMDA 4KRYA 4KGDA 4BAGA 1M6YA 3CH7A 2C77A 3HGQA 4D26A 4BLWA 1PJCA 4IDBA 3BJEA 4X63A 2LKDA 3NWBA 2APLA 3QU4A 2QUBA 1IN4A 3DF7A 3L7IA 4KVAA 2GOYA 4N5LA 4WKBA 3LFHA 3RADC 1JEQB 5DYNA 1UMBB 4FDTA 4D02A 2VT7A 1CJUC 1QNLA 2LE0A 3RK1A 4CM4B 4DG5A 4CRWB 3CFYA 4CUZA 1PU2A 4LCBA 3TTSA 1BMQA 1G2PA 2ZRGA 4GIBA 5EWJB 2AFRA 1S7GA 1E2UA 1KY3A 4X60A 5AQ1A 1OD6A 2OC9A 5NULA 3MJCA 4MPJA 1OILA 3VDUA 2RRUA 2C94A 1D1PA 1H6DA 2Y1DA 3WIOA 3FDZA 3WKAA 2LKCA 5L6MB 1PLKA 3OZRA 1T35A 3VZBA 1QB7A 3DUFB 4MW1A 4FI3F 1U1IA 1UMBA 2BHLA 2HMAA 4M7OA 4MLPA 3E84A 2V96A 1MB4A 4RPJA 1F4IA 4Y6OA 3A9VA 3BQ9A 4TZTA 4PTLA 1ODFA 1QU2A 1ZHOA 4F9TA 3G88A 4OAPA 2PMDA 2AA3A 3LWDA 3KQQA 2B1JA 3HHEA 2JCBA 5JCPA 1G8YA 4HQKA 4A73A 4ZDJA 2ZIWB 3WGQA 1C81A 3LT2A 1FMJA 2ZWPA 4AQDA 1Z0KA 3LLCA 3PWSA 2Y71A 2UXCB 4UZFA 2P2YA 2ETXA 2AX3A 3Q4GA 1A5TA 4Y6PA 1BDBA 3WMRA 2Q46A 3EXHC 2JHFA 2I3DA 2WK1A 5HILA 4I0WB 3KT6A 1XELA 3CG4A 4G41A 3H4JA 1KSJA 1R5LA 1VPVA 2C2YA 3IUEA 3MRVA 3PQ6A 5TMEA 3VZQA 4DBGB 4CW7A 5KOIA 3OWHA 1E0KA 1PZNA 4M9ZA 1CUFA 3LJKA 1XT6A 3ZV5A 4B4VA 1BE8A 1HEUA 2BDTA 2HPHA 3HHZA 5J2UA 3LBYA 3N2IA 3K9PA 1NW6A 1R4MB 1X7WB 2ZLBA 5C7YA 4W5QA 1D0SA 1NVWQ 2HQRA 4MP8A 4OI4A 1Z56C 2M1XA 5AVVA 1T2VA 1H5UA 3E48A 3D4PA 5JAQA 5CB6A 4IF6A 2I34A 3AM3A 4JI7M 4UD6A 5CPFA 2B98A 2RJNA 3AW9A 4TM8A 4UM7A 2XRMA 2NU9B 3T34A 5CLFA 4U4AA 3GG2A 4DBVO 1OGYA 5BV0A 4RESA 4FKZA 4WQMA 3NC0C 2QY6A 4P33A 5HDBB 1BAPA 2H2IA 2E4XA 4A1FA 2R66A 2VZEA 2I3ZA 3OM9A 5D6NA 1TA0A 4C6SA 2R00A 4C89A 3KKLA 5CCDA 5BWOA 1XQ9A 2BISA 3L8MA 1Y9JA 2FU5C 3IAM1 4Q1AA 4Q4AA 4TT3D 1YL5A 2IYEA 2KI5A 5EYPA 4BIIA 4JP2A 3IRVA 4M6WA 5DTEA 2GYWA 4L5YA 2GUWA 4BO1A 1LVHA 1D07A 2WT4A 2CLCX 2JGIA 1DJQA 1ESMA 1U3GA 2XMDA 2ZSUA 1KWKA 1P81A 3UMYA 5ULLA 3DLCA 2IS2A 4FDLA 1KVQA 3V55A 4BO4A 3WKCA 3GT7A 1ECJA 3C6KA 1YDEA 3QKTA 5BO5A 1U7UA 1Z3CA 2XNHA 5B58T 3FPJA 4MP6A 4C2BA 1OIWA 3PJRA 4E30A 2LVNC 4YDHB 3U2QA 3T1TA 4E5KA 2XCRB 2Z57A 4XCXA 3R7AA 3IIEA 1G0NA 2FHPA 2C5BA 5FWYA 4G4QA 4A6DA 3GPUA 3OEYA 1Z25A 3QYEA 2ZANA 3U5ZA 2DH6A 1E2QA 1FDSA 2JLXA 4XWOA 4JIMA 3BFKA 4N5DA 1CF2O 2R7LA 5KTTA 1TM1E 1TM4E 4TMWA 3BILA 3KQUA 3HFSA 3ESBA 3BZBA 4PZAA 1QCCA 2QVXX 3UPTA 3U4QB 4YECA 3NHFA 5K3CA 2ZI9A 5FCDA 5KJ1A 2XB6A 5DHSA 4JI1M 2JLCA 3N74A 4IDAA 1CS4C 2A9RA 1MIHA 2MSWA 4CBVA 2JY7A 4KLNA 3ZCBB 3WLHA 2NU7B 4G4NA 2FPIA 1VLQA 2R5FA 4RE5A 1I4TD 1NNI1 4KX3A 1JR6A 4AMVA 2JIMA 4NAUA 3FUUA 4IOJA 5EG5A 2C9MA 4CQJA 3UWMA 1ZM3A 2VRCA 3SVTA 2XNDD 4OAQA 1J2EA 3DEAA 4A3VB 2YN0A 3TOSA 5HQTA 2VR1A 3AUKA 1DDOA 2VNKA 2QD4A 3TRHA 3BGDA 1WOYA 2EZ4A 2ZXFA 2RGEA 3U7HB 3LWNA 1XA3A 1SHKA 5JSFA 3FWHA 2YWEA 4P3PA 2YHIA 3KVOA 4JXJA 5K8CA 4HSGA 1QGOA 3RGSA 3K0FB 1E6WA 4X62B 1Z5UA 3GELA 1IXKA 5C1IA 1PL0A 4K6HA 1PEKE 1E3LA 4BDTA 2AKAB 5BN3A 2EW2A 3V33A 3ZBPA 1E0JA 5EZSA 1P1BA 1AKMA 1QGAA 1DC8A 3PC7A 5FWAA 3SR0A 3G3EA 4RAQA 5ER6A 1ISSA 1N2GA 2WTXA 3VPAA 3L5OA 5JNUA 2O14A 1O94C 1RPAA 2WW8A 4EKYA 1IK6A 3NCTA 3G9QA 5KUTA 4RVUA 2XUJA 3BRWA 1KO7A 4L9AA 4DLZA 1J5EB 1QYIA 2XUKA 4L8RC 4YB8A 4BRWA 1ZH6A 1FX0B 5LBUA 1LSJA 3NEJA 3EIOA 3M82A 5D1HA 2BRUC 2W00A 1CQIA 3PNPA 3EF1A 3LHKA 1CETA 1XF1A 2DY1A 4OSOA 1Q1QA 3CVVA 5ADUS 1Y48E 4H1VA 1C7RA 2DJIA 3IDOA 4GBED 4CM8B 2F17A 3NEYA 3MHVC 2ZRMA 3SIWA 5KO3A 5LN1A 4CCYA 1OPRA 1PKEA 3ZHVA 4WRRA 2PJZA 1CR2A 2VPTA 3SYRA 2QRMA 3WNVA 5GGYA 3EBOA 1NUTA 1FS4A 3LCMA 2BEUB 3A28A 1H2XA 5ESXA 5BW4A 5J47A 1OJ7A 2CYBA 2VXBA 1JLMA 1W4ZA 3DE2X 3FWZA 3G59A 2W6CX 3IESA 4CMCA 1R3DA 1JG3A 2C57A 4L9RA 3ENNA 2GEUA 1FF9A 1YDWA 4TTAA 1L2CA 4M0UA 2FW7A 3OPVA 4AP5A 1S2GA 3V2HA 4K86A 3A7DA 2I33A 2W2VA 4RHTA 2QUHA 3KKKA 2PZJA 1XWWA 3WL8A 3D3QA 4CMJA 5CFRA 4HO1X 5A04A 3KT3A 2K5UA 4OGGA 3ITEA 2CVPA 4DYDA 1P5ZB 2WJZB 2FLVA 3H8JA 3QWFA 2L2QA 1XGKA 3EVEA 3OC6A 1EFVB 3LQQA 1EGVB 1RXYA 1WO8A 1UT8A 2CWBA 5A06A 2GGSA 1NUSA 3NI2A 3R3UA 4WV3A 3V1UA 4RABA 2PWZA 4RORA 4BX0A 3EIQA 1X8LA 1V2GA 2W2LA 3I83A 4Q4JA 1DO8A 4ZO4A 1W19A 4PO3X 1F2TA 2B2NA 2XKBA 1RHKA 3F4BA 3LUBA 3K05A 4KXNA 1A4IA 1R2QA 4WXHA 2P6MA 4HVLA 4KQXA 3ZOKA 1KQGA 4YRZA 1JHUA 3EGDB 1C7YA 3WL5A 4GOLD 4DE5A 1KOLA 4DRZA 1WVMA 4EB6B 2X0EA 1DUIA 4KQIA 2V6FA 3DLIA 5EQTA 1HDOA 1LUAA 3DPIA 4KQWA 4G2TA 5G0UA 3ZHTA 1ZWLA 5KDOA 1M54A 2X2PA 3NV7A 2A59A 4QLBA 1MABB 3FUWA 5DYIA 1TF2A 2A9OA 5FYQA 4FNAA 3ZLTA 4L1KA 5JZOA 2ZREA 4PYIA 1JXOA 3DOOA 2OGTA 1X13A 1XKQA 1SNYA 4QJBA 4IICA 4R7TA 3T52A 1E5XA 1FZQA 1VYVA 2AYYA 2ODPA 2B37A 4RLHA 2YZKA 3TD6A 4LQCA 5CITA 4I1PA 5TMDA 1EXNA 3MCZA 1GARA 2OM6A 3RRZA 1FDWA 1I3CA 2YIVX 4JJIA 3MQ4A 4A16A 5JADA 4YAIA 5KWSA 2R60A 2H9AA 1BKDR 3U9SA 1NHWA 3KPVA 5U4QA 3FTCA 1YHZA 1ZJJA 2WVJA 1GCOA 2AUMA 4FUTA 3VR1A 1U2SA 1Z4MA 4EKGA 4ALMA 1SCIA 2Q0HA 2QZ9A 3L7MA 4MV4A 2OUIA 3RC1A 1ULUA 2Z3ZA 3A3NA 3WSVA 4AXBA 3FMFA 4E5MA 1XXHB 3ZYZA 5LQRA 3B6IA 4HMPA 1P2SA 4YJHB 1QF6A 3H2IA 4OJTA 4L8LA 3FG9A 1Z8HA 1AGPA 1TYDE 4IQ0A 2W2MA 2ZWIA 3IIJA 3DCIA 3G9ZA 4O5AA 5EVJA 3GV0A 3P9YA 1CUDA 3GJ4A 5HBGA 3M4JA 3UYKA 1ZZGA 3PUIA 4PCUA 2HWWA 2Q2NA 3J81k 2RSLA 2ASVA 4J0EA 4CIBA 3Q88A 1DXHA 1XLVA 2XBUA 3RWBA 2GZSA 4F4HA 5CGQB 2HJSA 2QZJA 1OI2A 1P3DA 1XZMA 3VM6A 3MOGA 4A2PA 2JIZD 3H11A 3PHCA 4ZT5A 1Y1SA 3I58A 5GGXA 4UC0A 3B1FA 3KD3A 1DRUA 2AW3A 3VR4H 1JIXA 3C4JA 3GGCA 3TSYA 1DAGA 4WJLA 1U81A 2EBWA 4UFNA 2NGRA 2AUTA 2TECE 1IBCA 5AKEA 5EE5B 4BV3A 4N0QA 4BCDA 5MGBA 4DPKA 3W34A 3OT1B 2VJMA 4MA0A 3SOPA 4EA6A 3ZW8A 4J90A 2XADA 2RKOA 4KBFA 3CZQA 1HL7A 1O1YA 2P5UA 3QQPA 1L2BA 1G2QA 1VDLA 4Y2SA 2Q0SA 4F11A 5DK4A 1JHOA 4U63A 2C84A 3I5XA 5M3BA 4FUQA 4PAGA 2ENUA 4LOIA 2NSLA 2CUZA 2YL2A 3QU2A 1EVQA 4UVGA 4AL4A 3ZR4B 1URPA 1T5SA 2WLSA 3BQNB 1JB9A 2B1IA 4PXAA 3OIYA 3ADOA 4B45A 4QHSA 2IT1A 3OOYA 1G3IA 2KHHA 1JALA 1KI4A 2REOA 4J1SA 3ZUGA 3F90A 4AZ3B 3CINA 4GFDA 1RWOA 1N92A 2GJ4A 1HL3A 2WOJA 4MV5A 4X9XA 2QP4A 1N36B 4YRJA 3TINA 4ZYUA 2NYVA 4WCFC 4XLZA 1T8PA 2J67A 2ZZKA 2QN7A 4U5QA 2JD2A 4F5DA 3MJDA 2OCGA 4CQNA 4QTZA 1QXSA 4JJFA 1G7CA 4FYIA 2ASEA 2XOXA 4BAZA 2WBLC 3DOUA 1T2NA 4FCTA 1W9MA 2F8MA 2Y6UA 3HRHA 5EIAA 3P9XA 2HQOA 1H2HA 2PCJA 2ZQYA 4EFDA 4EW2A 3VQTA 4IG4A 3AVTA 3AFGA 1N0UA 5KQLA 2A1TR 1RIFA 1ZD8A 2QVGA 3CC8A 2H9IA 1B2RA 1U0RA 2JJ1A 3BM5A 4X93A 1F2TB 3TQTA 3QOWA 1RPZA 2BHNA 2YJ3A 5CFPA 2IK8A 3OE4A 2AH5A 5AVZA 2ZWMA 3KOYA 1MAVA 1Q15A 1VXRA 2CJYA 4FDUA 3RABA 5AW1A 1ZVMA 2ZVDA 1GPKA 3BWEA 2B4QA 2I1WA 4XKJA 1U3FA 4AW9A 4ALKA 3JWPA 2BGLA 3MINA 1CJVC 3JRNA 1N8TA 1YR3A 2I7TA 3SX2A 2EFHB 1ZLYA 1O4VA 2FQXA 4TXLA 4HEQA 3C16C 4GMKA 3FNBA 2KZUA 4R1NA 4RCZA 2JD0A 4XX1A 5AK3A 2Q5JA 5DLDA 1QLWA 1F51E 3O4FA 4Y98A 3RVOA 5K8TA 4JOCA 1N1GA 2V45A 3GLQA 4CF7A 1J0XO 1GUBA 1BDMA 2EFJA 2X4DA 1RLOA 1HRDA 4LCEA 5KNDA 2PSHA 4FYMA 2AEFA 4Y6LA 1KNQA 1KKLA 3ME5A 3DDWA 2JAQA 4HL6A 2CVHA 1JQJC 1YV9A 3CWCA 4Q1FA 4RCVA 4D79A 5IDXA 1GRNA 2D3WA 2IXDA 3DAYA 5FBWB 5IZ7D 3W8RA 1FYFA 2HBYA 4QYMA 1Q7GA 3WXMA 1RAIA 3AESB 4OFZA 2YINC 2Z0MA 4GKJB 2NG1A 3N70A 1C3EA 4JJGA 3WNZA 3JQAB 1YONA 3P27A 3FOWA 3PCRB 3D6NB 1Z39A 2GEFA 1REQA 3QU5A 4TWZA 4GPTA 5FPQA 2AFIB 1TMKA 2B21A 2R5NA 1OZ0A 4BKQA 1DIOB 1XE3A 1KNXA 2JLSA 2P9HA 4Z0HO 4E5NA 2ZYTX 1A5BB 1RYNA 2L82A 1MO5A 2ZYHA 1F6BA 1ML4A 1BWSA 4UAUA 4XUGB 2GXAA 1AHNA 2QMOA 1RP7A 2J48A 5T4BA 4PNZA 5E4JA 1DMSA 3DZFA 2RGNA 3KSXA 3K4PA 2KWIA 4EMTA 4HOYA 4MMXB 1VGQA 2IYTA 2AN3A 3A10A 3AHCA 3MCTA 3DWEX 1CKEA 4NAVA 2VDKB 5JPDA 4OLAA 3TAUA 2RHGB 4WIAA 2DBRA 4PNEA 3NTOA 1WWKA 2DNAA 1CIVA 2O0MA 2G0NA 1PT9A 4JEMA 3NGLA 1TADA 2J3HA 7GPBA 3FZYA 4LOHA 1TO1E 3BCRA 2WAXA 3QPVA 1CK4A 3S4YA 1ZOOA 5IABA 2ZT5A 4WHMA 2WIFA 3F9IA 3L7LA 3B2NA 1WKCA 3TXXA 2P7IA 1CUAA 1G63A 4PINA 5AI6A 3T5GA 3T7AA 4BUJA 4GW3A 2Q6LA 1K2WA 1KEUA 2C0QA 5ALYA 1UDRA 2E18A 3FCAA 1YRAA 4EG6A 4URUR 1S0UA 2B8TA 1DUSA 1KAEA 1FU8A 1P2BA 3ICOA 2PSJA 1A9ZA 3M5CA 2CXXA 1IM5A 5EGSA 1Z62A 2CJWB 4AWAA 1BE6A 1J09A 2C07A 2D59A 4PG7A 4B3MM 1WUJS 2YMQA 2YR0A 4X97A 2CZQA 2IXTA 1EPUA 2FZEA 3QKUA 3SNKA 3L8EA 1WZUA 1TLTA 3DMNA 4IDGA 5J43A 3L8DA 2CHQA 1Q1EA 2ODNA 2XMBA 3D4BA 4HQ0A 4X62M 1GTG1 3D6AA 4QPDA 3OHMA 3OP4A 1HNXB 2R6ZA 1GSAA 1CC1S 4J6EA 2AZDA 1JXQA 1XTZA 2D2EA 3O03A 3AEKB 1MO4A 2JKVA 3CKMA 1LK5A 4XSGA 2ZBGA 3JQRA 2JJ8A 3J7AS 5AUOB 3NC4A 4AXXA 1GPNA 2HIHA 2XB2A 5TF0A 4JV5B 2Y20A 1JHRA 3AJEA 3CLTD 4KOAA 4ZO8A 4AJ1A 2HMWA 4ARZB 1YBVA 3GJYA 4XYEA 1FUEA 4WKOA 1NRXA 2VF4X 3MWDB 2ONJA 3EPJA 1JFVA 3FTPA 3MHPA 1JIKA 3HB5X 3WHLA 4RY0A 4ZAXA 1SVMA 1KI7A 1WLYA 3A6EA 5LYJB 5FFMA 1YBMA 1PWHA 1Z13A 3IEUA 4OQEA 3TSWA 4CEHA 3GGJA 3PI7A 2ZM5A 3QUQA 4FT2A 2Z8YM 1F3OA 1DIGA 2EARA 2QRLA 1OMOA 3OKFA 2SCUA 4H7DA 4U2BA 1MZPA 4G0WA 2QGZA 1C2YA 1PT8A 1R8QA 1N1MA 2BGJA 3NGXA 3PXBA 3DFMA 2QBYB 2RHDA 4NK4A 4KSBA 5A9SB 2WB4A 4EW1A 1X7DA 4XVRA 4I7EA 4NK5A 3BXGA 4CIXA 2PPVA 3GLSA 3HKPA 3G9XA 4AJ9A 4H35A 1GV0A 1ZRSA 5IXYA 1RI1A 2PS3A 3ELUA 1RM5A 2R8RA 3CCFA 4IYRA 3ZNQA 3PGMA 4D9IA 4FM9A 1H9CA 5DHFA 4F5YA 4EPXA 3JQFA 3FYSA 1HFJA 2WJHA 3S29A 2ZUTA 3NS7A 2KJQA 1VHQA 4OUDB 1WDWB 2WWFA 5JMOA 1W87A 3KWFA 1U4SA 1NQXA 2G5GX 1WR8A 3C5EA 1U94A 5DNUA 3IALA 4JI4B 1DMRA 3IQDB 1JHMA 4P0TA 4ZANA 4B8WA 5BPFA 5JECA 4YFVA 3CH5A 2XJ9A 3PTAA 3ESCA 4ZAFA 1W0CA 4N9QA 2H63A 1V7QA 3GVXA 1E9EA 4GH9A 1Y9EA 2G17A 3UJ8A 1PGYA 4B73A 2QX6A 5F12A 5CDUA 2X22A 2WTEA 2PS1A 5SZHB 3BEOA 1XG5A 1ZK1A 5K3FB 5A7FA 2FR1A 1OW3B 1S2NA 3F3KA 3G7SA 5CXXA 2CV1A 3WICA 2X8WA 3EQZA 1H5NA 4IIUA 5DLPA 5CCEA 5FBQB 4MTCA 3V4PB 4B2YA 4BMXA 3MRTA 4FOPA 1PZGA 1IHDA 3TBFA 5MDHA 1T3ZA 1JG7A 2MGWA 1DPGA 4QBGB 2BI4A 5CJJA 3A8TA 3OG9A 3CH6A 3I5MA 1HFWA 3PFGA 1TL7C 4A91A 4G09A 1W1IA 1INLA 1Z2DA 2E4ZA 2AD5A 2NNLD 1FBNA 1U2GC 1X80B 2PEZA 5LQNA 1EFTA 3GAAA 2UYGA 3VNQA 4AC9A 3G0BA 2FPKA 1F17A 5AW6A 1NVMB 4Q9KA 1CYDA 3EQ2A 2MR6A 1IBRA 3O8QB 3DA8A 2XE8A 2B4KA 5ADWA 2WTAA 3I9FA 2ERYA 3DD5A 1RWPA 3LAWA 4PRKA 1Y1PA 1IVYA 4OL9A 3WLAA 1P33A 4Y2YA 5T3UA 3O1JC 4LDJA 3HP7A 4R9UC 4IEFB 4YV1A 2WYOA 3ND5A 1U3CA 2FLWA 1RHRA 1SVNA 4GR9A 2E7ZA 1ZOPA 4ZICA 4WOPA 3KHUA 2VK8A 3H1BA 2Z95A 2NVBA 3HUFA 4FFSA 3SXUB 4YYEA 3B5IA 3UHJA 3T61A 1ORYB 5F1KA 5IJZA 4LI3X 3K9WA 1QH1B 4CM4A 4ARBA 5F64A 1GTRA 3IA7A 5JSUA 1QQTA 5JI3E 3IKJA 3OEHD 2Q49A 3QOXA 3QX3A 1ZGZA 3AJAA 3QWBA 4MA5A 2FE8A 4OQYA 1HQDA 1TRKA 3C6QA 3N8HA 4Q3DA 1UANA 1UEJA 3QU7A 2X15A 4I46A 2BWEA 4V3CA 1UUFA 2C98A 1OBVA 4LDQA 3RANA 1O6ZA 3KQHA 2Q6IA 5JAPA 4JMPA 3VZDA 3C8DA 3D1JA 5HRCA 5T67A 2GF2A 5BQ5A 4RWZA 5TXGA 1E6KA 1EX9A 1XJCA 2Z4SA 3WYAA 2HREA 1DKRA 3HBAA 4XQ9A 3B36A 4IV5A 1TKRA 4TTIA 2AG1A 3HADA 5H7XA 5LJIA 3R5FA 4MO9A 3QTLA 1ZOIA 1QH8B 3RLIA 4FSHA 5A9RA 2EEPA 1XNHA 2RMKA 3WO1A 2QTNA 3V8NA 2DZOB 2FE4A 5CTJA 2DBQA 2GZ3A 1CUKA 4E14A 5CDYA 2P1RA 4IBJA 4J7UA 3HCWA 1KKMA 1H2BA 2VPIA 4YAEA 3VDXA 3VHXB 3K31A 3VSCA 2UZ1B 5BYJA 3QVWA 4KQJA 1CUJA 5KKAA 3V9PA 4GRAA 2OBYA 2WJJA 4UTXA 2BWJA 4V24A 1TC1A 1V5WA 3W7BA 1R6AA 1VMAA 1SCKA 1W9HA 2DCUA 3BFXA 1AIPC 3H5OA 2AOTA 2ZCVA 4ZYZA 3O9VA 4C7OA 4JBYA 4KR2A 1QYXA 2JDIA 2TRSB 4F5EA 2O2XA 4OI2A 2HLPA 1F6DA 1KYXA 4FR2A 1I7QB 3LUDA 1NNEA 1LV7A 1EM8A 2GEBA 2PX6A 5AVUA 3A32A 2IW3A 4L4SA 3G13A 3GJ7A 5LQDA 1KK3A 1YIOA 3IHTA 2QL5A 1HGXA 1LDNA 2EQ5A 3H42B 3V6LA 2WKQA 5FH9A 4RF5A 5JD4A 3IQGX 3FCEA 4WAUA 4QNRA 4RPLA 2KEBA 1E5VA 3KE9A 5IJWA 2HF2A 3BAFA 4KR7A 1IEXA 1Y9ZA 1CE8A 3T7KA 2I8LA 4B3IA 3D4LA 5E0KB 3N2EA 2CLEB 4XTCS 1G8MA 3TDMA 2OHIA 4X92A 5ENVA 3V4OA 1GLNA 1UFOA 2OFOA 1ODTC 4ZO6A 5KJEA 3QM1A 2G9ZA 1TTQB 4NZPA 1VPDA 3LFTA 3LX5A 5DM60 3QPCA 3PX3A 1IHYA 3IP6A 3VDRA 1U7PA 4YHHM 3AVQA 5FXMA 3HA2A 4ZGBA 5ARBA 3VR5H 4JYAM 3NBXX 5FPPA 2BD0A 1B6RA 3E8SA 3OZCA 2GHRA 3QHAA 4OGLA 4UE6A 3W6PA 3R76A 3PQ4A 1T4GA 3DDZX 5IK2D 1C4WA 1OXUA 2FZWA 2JRCA 1W5FA 1LWOA 3DBRA 3WDKA 4NE9A 4XGRA 2ZFUA 3RS0A 4PQGA 1U31A 1QVZA 2DYKA 1D8TA 2ODBA 3C1OA 2ECFA 1JJFA 4HLNA 2C2MA 2I4NA 2RG1A 4DNPA 1AB5A 3TL4X 4F6RA 3TLEA 3QVLA 5DCLA 1KEEB 2NP6A 4WEQA 4C14A 4XFJA 1SKBA 3JAMA 2VPZA 5IJAA 1ZGCA 1ZK4A 3CZ4A 5DSXA 4CMKA 3F5SA 2OO5A 5C2JB 5LSAA 4DLUA 1T1IA 5ILOA 2F43B 2FZ5A 3DW3X 2ZR8A 2HT1A 4RA9B 1N2XA 4IR7A 2A7XA 2P8JA 5JYDA 2NAFA 1EIZA 4TMTA 1NR5A 4GP7A 3W9SA 2F1JA 5GM1A 2C5GA 4RSHA 3TTXA 1ZRNA 1Q7BA 1KIAA 2VSXA 1A3CA 2XUDA 3R0QA 4GBMA 3DE6X 3WWOA 4BEWA 3K0AB 4X1YB 4YJFB 1CQJA 4N0DA 3W5JA 2P4UA 4I50B 4U2DA 1OYWA 5B1YA 2ONCA 4BAUA 2PR2A 3OE1A 1U0GA 1T0JB 1WCWA 1DEKA 3CKKA 5T41A 1OTHA 3K9LA 1XHBA 1GGEA 2GHQA 3CEJA 3FMGA 2ZAYA 5ALLA 1ABFA 1AZWA 3COWA 1D03A 4GLJA 4JB2A 4TWBA 4PBTA 4BFYA 2AI2A 1O89A 2W2QA 3GEEA 3IAUA 4ID3A 3A9WA 1A5ZA 5F2NA 4CE6A 2DWZB 2WHYA 4QFCA 3E6AA 2BGUA 2V6JA 3JAKA 4TV8B 5KNLA 4LF8B 2N1BA 3UUWA 2GPYA 2O5EA 3H5NA 621PA 4OFXA 3QXGA 2Y68A 3TLGB 1MLDA 4AZVA 5JQGA 4G4OA 1XEWY 2X7JA 4FINA 2HTFA 1D6NA 2HSJA 3GD5A 1Q7CA 4LG1A 5K20A 2OPHA 1HE2A 4XPIB 5ICCA 3T1HB 4EECA 4RLSA 1U6IA 3L1KA 1WXFA 6AT1A 3CF6R 4BMOB 1OIPA 2WDPA 3ND6A 4Q7QA 3M34A 1BA2A 1D5CA 4YC7A 5TQJA 2FZVA 4GP9A 3UK7A 4YDSA 2VRBA 4NFLA 3SQLA 1P91A 5JT1A 4IBCA 1GNLA 4UARA 5FOSA 1HDIA 1DO2A 1YHNA 3EFBA 5AQEA 4E2XA 4ZI7B 3PQ5A 4G3OA 3T12A 1C0IA 1D2RA 2ODQA 3WLPA 4DKXA 3Q12A 5AVYA 3U1BA 3ZDDA 2VNJA 1NU8A 4YJFA 1QVWA 1U3VA 2M5ZA 5CIQA 2M6KA 4DL9A 3GN2A 2AD1A 1AC5A 3HZRA 3PGJA 2RGRA 5DBFA 4QM6A 2JBAB 2P9BA 3INYA 4RZSA 3VO9A 4BB5A 1E2DA 1XMPA 2OTCA 4MPPA 3F0TA 4F9GA 4N9WA 1PFKA 2IUUA 3UAYA 1M6WA 2PNJA 2ZIEA 5CVDA 1W1WA 4WN9B 2OLJA 1YZLA 4HDSB 2FG7C 1G3RA 1GYQA 2OMEA 3PHLA 3DZGA 2KB0A 3U7JA 1D2CA 1KP2A 2I8CA 3UGQA 4EQ6A 4MHSA 4QT4A 5J1SB 3E1SA 4WECA 1VIAA 1CDEA 2ZSJA 5CFLA 2XSZD 1NZJA 4CMIA 1A8SA 5KKNB 4BJ6A 3RUCA 1B0ZA 4GNRA 4BEJA 1C0LA 1RIIA 1EVZA 2JJYA 5L8VA 4M76B 2J41A 1R4NB 1Z2NX 4ALJA 4CFSA 3VR6H 5E6RA 1L4YA 5HJ2A 3WMFA 4YUXA 3Q11A 5C1PA 2FG6C 1NU6A 3L27A 4REQB 4BQEA 1IN5A 2IGBA 5GINE 4NZZA 3GEGA 3NHRA 3I2GA 1TVKA 3ZE9A 4ARVA 3N05A 1B8PA 2J3JA 4XQGA 4YVFA 1O58A 1DG1G 5K1ZA 1BIFA 4R9RA 4XIYA 13PKA 4X6YA 2QPTA 2C00A 1DEOA 4QDUA 4B2LA 1RYEA 3RUIA 3IE1A 4Y28F 1IN1A 2NAPA 3ASUA 1EFDN 1OASA 1E92A 1YBHA 3KZOA 4MGEA 3VR5D 3OETA 1TAQA 4B85A 4F84A 1WUTA 3CT6A 4C4YA 5KX5A 2F8TA 4DR6B 4KPGA 1PR0A 4BN4A 3ANNA 1E9BA 1XQ1A 3V46A 5C1DA 1W36C 1RWQA 3LRPA 1EFRD 5GMOA 3K1ZA 3TLYA 1MFZA 2CLHB 4EATA 2H5JA 1EVEA 4MUMA 2Z3VA 1W34A 1JQAA 2QVZX 5DSTA 5FNVA 5C34B 4L57A 3T5PA 5JTTA 1F14A 1RWXA 2RC6A 1VLLA 2IYNA 4RNDB 5LOVA 3G79A 2FN9A 2DULA 3I2YX 1J00A 1EGAA 3AU9A 1YTLA 2NVOA 1EDZA 2J4DA 3ENWA 3EXAA 5IAKA 1RJEA 3RQIA 3WY9A 3VNSA 5J2UF 4V0NA 1JEAA 4C6HA 1D09A 1F2VA 1FL9A 3O4VA 2BFPA 4B9AA 1XZEA 3BTSA 3LLUA 3I53A 1NMEA 3IT0A 2OT3B 5EXXA 1W4RA 3AIKA 4JU9A 4N5HX 4XSHA 5LB2A 1R0LA 3BGVA 3LBIA 2IPXA 3ETGA 5LUBA 5I3CA 1R8YA 1KP9A 1PVDA 1K8QA 1SCDA 2YV2A 4D80A 1PNQA 1VA4A 1XF9A 2ID7A 2MYPA 3HRKA 3KLNA 4BVJA 5CFNA 4L8YA 1JU3A 2O0JA 2RH4A 2H3EA 1E5DA 3A36A 1RXCA 1SCBA 2ZB3A 2ZE8A 1UBOS 3KJFA 2KSQA 3OKPA 2PS9A 4G5SA 4IUCS 1DKUA 2X0FA 3RKUA 4EYQA 4KITB 1S6YA 4PRLA 3TUZC 3FPFA 4B43A 2WKRA 1G8PA 5F7XA 1FFDA 3VA7A 1BKYA 2IV3A 1PJZA 4P93A 2NPOA 3GLGA 1IN7A 1YQDA 2H17A 3CEMA 3FCCA 4KDEA 4XOUA 5H5JA 4LJ6A 2D2XA 2FYTA 3QW2A 4EG8A 5ITWA 5DM0A 2GZRA 4QDKA 4KREA 3LVQE 1KYZA 5INTA 3IEMA 3DEIA 3LKZA 4RA6A 2PL3A 1N5MA 1DX6A 2AK3A 3OSZA 1X1QA 1P9OA 1IXYA 5AKIA 4EJ2A 1GVNA 4L72A 4LWZA 2W82A 3GRPA 1CVRA 1RXEA 4IRMA 1OWLA 4BVLA 3ETNA 1W5EA 4DRYA 4LEIA 3S2SA 4EBFA 1V3VA 1XLWA 4C21A 4IHKA 3RS9A 4E2WA 4YMVA 3CUVA 4GX2A 4LX0A 2G7MC 3A31A 1KF0A 1P3QQ 1VHWA 2EDAA 2XTAA 3EH1A 2YYSA 1DRJA 1CT9A 1OFGA 2PLWA 4U9IS 4DWVA 1PEDA 2X9GA 1G66A 3WYNA 1HYEA 1RJ9B 4XRRA 1H6UA 1ISPA 1EHYA 1Z4QA 2IPAB 2SNIE 2ZIGA 2WWVD 2EF1A 1NLUA 2Q45A 2WAAA 1ZJWA 4LV8B 3E58A 1N75A 2VTBB 1XOIA 3G2LA 1PD1A 1QTRA 1GWNA 2FSPA 2HRCA 3N8DA 5BQ3A 4NL4H 2VUIB 3CM0A 3U1TA 1DBIA 1JKJB 2BVNA 2GBIA 2GS9A 2IYQA 2ZB8A 3ET4A 2HHLA 3INRA 3FN4A 3LQ2A 3K53A 4B87A 5GADl 1O5OA 1VECA 2ZATA 3CNNA 3EFOB 3LC2O 3N2GA 2I54A 5LL6P 5CMLA 3D4OA 1CLEA 2D54A 2P9QA 3D8UA 3F6RA 4FNMA 4IP0A 3R5KA 3P2MA 5CLHA 1I01A 4IJ5A 3W6NA 5C52B 5L3ZA 3MINB 3R3JA 3HBMA 4ETWA 3QFFA 2YIMA 1DGBA 1WUYA 3JWHA 2KW0A 4W7HA 2VHJA 2AN9A 5JXIA 4C2TA 4KRXA 2BEUA 2ZBVA 1KI6A 3Q8GA 1CZKA 3LPDA 4GPD1 5EJAA 2VDRB 2XIQA 1Y6JA 1JLRA 3VKWA 3KSJA 3JARA 4QARA 4JBGA 3RHFA 4BFSA 4DRXB 1NOIA 3A4MA 3B7ZA 3SX4A 3KFUG 4EIWA 4JQZA 1HEIA 5AK5A 1ISJA 2HU5A 2O06A 1LPMA 7CATA 3EW7A 1IZ9A 4MWDA 2WE8A 5JV5A 3CW2A 3WC4A 1QRSA 2UYOA 2DB3A 1R5BA 2ADFA 2ZUSA 1L4UA 3RJTA 2CLDX 4AROA 1HE1C 3B6KA 5HKBA 3F7OA 4RO0A 5AVJA 3QX7A 4LDAA 1E32A 2X49A 1D1QA 2GA8A 3AHDA 3WX0A 3DE3X 1T25A 2B61A 2DHDA 4ZVUA 4EY6A 4PZPA 5U9CA 2HCJB 2QTBA 1XTBA 1Z18A 1GL7A 3COZA 4P8RA 5CG1A 3L9WA 3GH3A 3OWXA 2C7BA 3ANLA 3B9BA 3D8RA 3N8KA 5EXSA 2ZYUX 4WNAB 4XGKA 2WD8A 4AM8A 3WAGA 3OH8A 1WUHS 1XZIA 1B8NA 2F48A 3RTAA 2CLIB 1KEZA 4HRXA 3R5HA 1U2TA 3B5JA 1C7EA 1ULAA 2H9YA 3C3JA 3K92A 1T24A 1GJRA 2WYVA 4TTPA 3L92A 1W2HA 5B64A 5CDFE 5JEDA 3SYTA 1YVEI 3U4MA 3PRKE 4BNXA 2NVUB 2C59A 4UVEA 2IJGX 4OKNA 2OYRA 1GPWB 1UBHS 3TECE 2R7AA 4EHKA 1P1FA 1X2EA 4LHYA 3DZBA 4Z99A 1M34A 2E1RA 1O87A 2D0PB 3IELA 3WAKA 3SXJA 3TVDA 2WF9A 3D3WA 1OB5A 4D3SA 1AXGA 1FXWF 3WQQA 4HGNA 4IIJB 4DNXA 1GM5A 4AD8A 4RQTA 2QZPA 5C8VA 3LLMA 3RE8A 1SG6A 4Z5XA 1GGVA 4L5CA 1B41A 4OB6A 3MTGA 2EFEB 3CPHA 3RIHA 1KVSA 2IBMA 4OL0A 1K97A 3IAAA 3TAHA 1ZISA 3H6HA 3G8BA 3OP1A 2E4YA 4G5QA 4E22A 1BA3A 2RHRA 3AG6A 4QICA 3W4KA 1IAQA 2XVMA 2P6RA 1A72A 2P0AA 3KOXA 4PZLA 2D5CA 4JVMA 1PLLA 5LMUB 1F0KA 5F78A 3HJSA 1XPOA 3DNMA 1IB0A 5FRDA 1X7ZB 3NUQA 3IP3A 5SY4A 1AQNA 3UBMA 1FNSA 2VDPB 3CMCO 4Y2VA 3GRCA 3RC2A 4LSGA 2W6NA 2YCBA 5CRIA 3C3XA 3RSOA 3B3AA 4WZAB 3Q6NA 4D4JA 5LDHA 2DWOA 1BX1A 4QJ4A 5DWDA 1DP4A 4OHMA 3DFIA 4LIPD 3WGIA 5E6RB 1UKBA 3HR8A 3KOMA 1Z28A 5DXFA 4P34A 5KSOA 2ZU6A 1F4LA 3FE2A 3RC9A 5TMPA 4V0RA 3CUYA 1GEEA 2WZDA 2PCLA 5EIOA 1Y4ZA 3THRA 1N3BA 3EC2A 1F2UB 3G2PA 2NTVA 1C9EA 3IUBA 1IONA 3P97A 4LZZA 2Y1CA 4K28A 2O57A 3AI1A 4NBWA 4Q5IA 4Y9RA 2QQ0A 3FI0A 2AJDA 1RI5A 4Y1RB 2Q3EA 4PVDA 5FHRA 2GN2A 1DKOA 3K09C 1EA5A 1KS9A 2ID4A 2GHTA 1T8SA 2WM9B 4NJMA 1L0BA 5I4CA 5KSZA 4QBIA 4KC0A 3TSOA 2JCSA 2R1TA 2ZIXA 1WQ4A 4HX5A 5HM8A 5ENDA 5JRZA 3B1JA 3M6XA 1PUIA 1XTSA 1NTOA 2Q1YA 4FEEA 1DV1A 4GZ5A 1L6IA 3UFXA 3RU2A 1XNRM 4WBNB 2AMVA 3FB1A 5ADVA 3G7UA 1RD4A 1GZUA 5DISB 5SYAA 1I80A 4W6QA 4MAFA 4B6JA 1BGXT 1R4MA 2EGHA 2AMYA 3NLLA 1A0OA 4LJRA 4ENVA 4MZXA 3ZY5A 4HPWA 1WZNA 3B1YA 2R4QA 5ES3A 1J1IA 1BKSB 2C82A 4MS4B 1VL8A 4II3A 3A6LA 1MQ8B 2CEKA 3ED1A 1CJTC 3QFRA 3HG7A 2ZRAA 1NC3A 1ATZA 1NXOA 4N03A 1KS2A 1MDBA 1NXQA 1P6XA 4RK0A 4PDGA 3QFSA 3W8FA 3OQNA 1Y82A 2O6HA 3ETJA 1O96A 5PGMA 4OK3A 4ZDKA 1E4YA 4LXUA 1O7JA 2XDWA 3GRZA 2FQYA 3MM4A 4L8GA 2VOJA 3EMDA 3VDNB 3TZQA 5DV9A 4DLVA 1Z29A 2GPNA 3HQ4O 3MFQA 7REQB 3BRCA 3NUZA 1TA4A 5AIAA 2P9FA 3JVVA 1GZVA 4FJ2A 5AWFC 1UKZA 6NULA 5A2GA 3KFLA 4J9UE 3IAS6 2WM2A 2FH5B 1RZ3A 3DAHA 1FYWA 4URXR 1VBMA 5IKPA 1O54A 2PVSA 1MEOA 2KZSA 2X4IA 2RGWA 3AUTA 3ESQA 3Q3VA 3FDZB 4JI7B 2YC2C 4PN3A 4MR7A 1IXSB 1P18A 3GARA 4N6OA 4LF9B 5SZKB 4KV7A 3HYCA 3IJ5A 4HAYA 1PJLA 3KTAB 4HTAA 3D8TA 2UVPB 2IDKA 4MRMA 2XEPA 4ZVSA 5A7HA 3GQBA 3V6MA 1P5HA 1IUOA 2CCJA 3WK7A 1VG9B 2EAUA 3EIEA 2GO7A 2K7FA 1XVAA 1JSCA 3QF7A 4FGKA 4LECA 3CWZA 4L0QA 1WB6A 2DUMA 1LC0A 5LZ2A 2VJBA 1L4EA 3DTYA 3NTRA 2OXIA 3WWPA 1JEQA 1KEWA 4K1LA 4ZZ1A 3WDSA 3G0CA 4ZEMA 5G53C 5JPCA 1FNNA 3D3KA 2J0EA 2OV4A 1ZCFA 3VTFA 5ABPA 2AOVA 5EEGA 3PUVA 4E2YA 3FOEC 2QG4A 1SFRA 5J4KA 2UU9B 3AJRA 2YHIB 5CCBA 3SDBA 1D0MA 2VSOA 3H17A 4J7XA 1AKQA 5JG7A 5ERYA 3RYHB 1X14A 5AIBA 2I1VB 3PKJA 3BJZA 4EZEA 5G1PA 2MSCB 4EAAA 2CFTA 5JXGA 1SJ9A 1QG0A 4TYQA 1H0SA 1M2JA 3P9ZA 4KIJA 4JUCA 3DOAA 2PXAA 1VG1A 1KC3A 1SHTX 2C4UA 2O0KA 3NIBA 1KKUA 3FDFA 4WPGA 3RVRA 5EZYA 4AYXA 2G3QA 4KNWA 2G0TA 2R0IA 4HAIA 4FD2A 5ARCA 5LDDC 1Y81A 4ITQA 2HO5A 2UVPA 3DC2A 2O0LA 3I01A 4NNOA 4DV7M 4UUAA 1JX6A 1QR6A 3AF3A 2Q21A 1P5JA 4KE6A 1AUXA 3NEPX 3YASA 4HX9A 2FPSA 2X0JA 3DBIA 4XWGA 1BQEA 3CLRD 3WHIA 4E13A 3UENA 1KXZA 5IF3A 1QHGA 2ZB2A 2VHTA 4XWTA 1TJ5A 2J45A 1TIPA 2LVPC 4QHYA 5JDCC 2QU7A 4K9PA 3CUWA 5TT1A 1FP1D 1H0RA 4W5JA 1ZI6A 4RSMA 3ABZA 1N5DA 1SEPA 2QJOA 4BMVA 5JZVA 3F6EX 5F2OA 1EXDA 5F4BA 2LGJA 1YAHA 4WN3A 4GI2A 1UDXA 3BHIA 4KPEC 2YZMA 4P4SB 2AFVA 2OD7A 3NVKI 2PANA 3K09A 4CEIB 2WJPA 1MQ9A 5LLTA 1V16B 3IUQA 5G1OA 1JHYA 3HEAA 1OZFA 1MX0A 2B2CA 3C7CB 3AONB 4MKXA 3RUFA 4M38A 1UBKS 4TS9A 3D7NA 1X2BA 4HDQB 1YS7A 4MW5A 1BN7A 4AU1A 3KSBC 3SVLA 1IAVA 4NFHA 3CRW1 4UMFA 2H92A 3U6LA 5TT0A 3M7IA 5FA8A 5AP9A 3WTBA 1XA0A 3PNMA 2VJLA 2X42A 5HE9A 2AQIA 4UFOA 2A5YB 1DBPA 1KXJA 1PJTA 2C7RA 2APJA 2EYQA 1FTWA 1TD1A 3C3YA 3SN6A 2H4JA 1MB9A 5L3QB 3RTCA 3RTBA 5JBNA 4NMLA 3C9PA 3MTJA 2ZJAA 2DVWB 1DS6A 3QEBZ 3ZY3A 3T7RA 1FJ2A 2BFCB 2GUGA 2P6PA 1RYFA 4HFMA 4BQRA 9ABPA 1PNRA 1J42A 1V4VA 1BDJA 3RAGA 1DBWA 4PHFA 5BOSA 1BHSA 3E4CA 1RCUA 5JATA 5H4GA 3SZ3A 2NSDA 2PVPA 2ZE7A 1RRCA 2CJXA 2WFZA 1CP3A 4I4TB 1NRJB 4N5NA 5IWCA 1P2VA 3HP4A 4MMYB 1EMDA 3TXAA 1DKQA 4LPKA 6ADHA 2WUGA 2CXOA 1YS4A 2E87A 3F78A 3OCUA 1IVNA 3PA8A 2O19A 1YRLA 2RK6A 1TDZA 3HCCA 3JAWB 1UR5A 1G8HA 2EZ9A 2V03A 2XMGA 4UTOA 1THMA 5IULC 1HYQA 2GN0A 1EDOA 3L6RA 4HVTA 4CTNA 1H69A 4NDNE 1Q39A 4E07A 1OLSA 2I6FA 4PRZA 2R2GA 1OV6A 5DNYB 2J3MA 4AP9A 1Q22A 4MUIA 4PN7A 1NE2A 3NCHA 4CKXA 3LUFA 4J2HA 1FSGA 1W46A 2I66A 2QW8A 2Z9DA 1J0EA 2QXTA 3EPPA 3OFVA 4M87A 4TLBA 5THQA 2VSYA 1JYEA 4HPJB 1LBHA 1KIFA 5FLKA 4BLCA 4HLDA 5DIFA 3I5YA 1SOWA 1T0PA 3HXPA 2QRKA 4GPAA 4ITRC 4L2IA 2XH8A 4MUKA 4F6CA 1YE3A 3QWAA 2XI4A 2J8ZA 5KI6A 1YCDA 4IZOA 2WIGA 1Q3KA 1KO1A 3Q9UA 2ZQ5A 2P9JA 4HQOA 3EG9A 1OAAA 3G8CA 3OCWA 3LY5A 2A5JA 3A6PC 1TIKA 3HHYA 4FYVA 5FUBA 2NUPA 1XSEA 3RVNA 3V7UA 4GGPA 1LI5A 4OBBA 4P38A 4L73A 1TK9A 4CL2A 1PR9A 1KI1A 4XUDA 5CDFA 3DMTC 3TUJC 5FADA 3KOZE 1GZ6A 2EL9A 3QGMA 4R1UA 4PSVA 1ZYUA 2V1XA 2XUZA 5H16A 2ZZMA 4Q1BA 4Q7KA 4KXLA 3WK4A 4NCNA 4GLBA 4M7PA 3G5LA 1THZA 4ZCLA 2KDLA 4NYJR 3ZJVA 2HWJA 2XA1A 1LEHA 1NVFA 3GGGA 3P9PA 4G36A 1FTQA 3N39C 1MA0A 4Y2QA 3VU9B 4PTYA 4IY1A 3VZRA 1ZY2A 3QXSA 3OT4A 1P7WA 4M0LA 2H5EA 4IOKA 1Y8RB 3PHHA 4MVJA 4OA5A 2V7QA 2FV8A 2ST1A 2F1IA 1I13A 4IGIA 1FNDA 5ALMA 5LKAA 3EAFA 3T7TA 4ETIA 2CUNA 2B92A 5CD1A 5J4HA 2YC4C 4EO4A 1XBTA 2G82A 3NJ4A 3U7QA 2DKLA 1WDMA 2JIBA 1M7GA 3CZ9A 3KYIB 1E9AA 1D6JA 1P1RA 1IJKA 3FD8A 3TK1A 1WMBA 1ORIA 2F00A 3C1TA 5ELXA 2W0SA 2GF0A 2FSHA 4NR0A 3DEZA 3IDSA 4CIAA 3RG8A 1V41E 4YRTA 1JRLA 4EPTA 1U3UA 4TSKA 4UM5A 3LVWA 2Y77A 2BIFA 1HZZC 4GITA 3RFUA 2Q1UA 5CAEA 3P9IA 3UTCA 5K6RA 5GIPE 3CUSA 4Q4CA 4R54A 5LQJA 1IZ0A 3VC3A 3ZTTA 4N7RA 3GUHA 3AI3A 3V4VB 1NYLA 4NOJA 1FQWA 3JARB 2W58A 4IIEA 4UVHA 1LJUA 4JX8A 4EAQA 1CIPA 2W2TA 2XUOA 4Z86A 3BD8A 2ZGVA 3FUTA 1O95D 2M6RA 4I55F 1QQWA 3MJEA 4QDJA 5K4GA 2DERA 1JDBC 1YZKA 1GXSB 1L9KA 1VPLA 1AA9A 1ZMTA 2Z5LA 2GN6A 4U7PB 5HUQA 2IZ7A 1H8ED 1U1CA 4IZ6A 5LKRA 3EXFB 2UUCB 1JWBB 3WL3A 5KPJA 2X2OA 2WSMA 3F3SA 4F4UA 4HN2A 3ZDAA 3RUAA 2HPZA 5AVXA 1CFZA 1DNPA 3B2EA 4TLAA 1Y6FA 4HPXB 4B34A 2HA6A 1DEHA 3IKVA 4TX1A 5F77A 4MCAA 4YMLA 3FTNA 3TBKA 3E5RA 1AURA 1NDQA 1N5RA 2R1VB 3WA7A 3BREA 4L02A 5IZCA 1VHDA 2OWEA 3FPKA 3CZPA 3ZVLA 3JVDA 5BQPA 4J6FA 3RE1A 4B5LA 1TVCA 1WE2A 5HQ3A 4A0SA 1I10A 2NT4A 2PWAA 2GTIA 1GDDA 2O3QA 2HRQA 1GNVA 5CLJA 3OQJA 4AS3A 2FP4A 3GJRA 3OFND 2Z9CA 1O6BA 3CUKA 5REQA 1N2BA 2WUVA 3OU6A 4RHYA 1YCHA 4PO1A 5M29A 5FFFA 5TJ9A 1QZTA 1E1QA 4RZHA 1NNLA 4MI9A 3DDHA 3IS3A 2JB9A 2PEYA 2XTMA 4YQYA 3N7AA 4RF1A 1ZVQA 2Y67A 3A1TA 1J97A 4NBRA 4RTMA 4PLVA 3UT5B 4EUHA 3UBTA 3TIIA 2A3RA 4KAAA 5JJKA 4Y6GB 1X9IA 1VDZA 2ZTHA 4YMTA 3M4YA 2WIJA 4PLPA 1AKUA 1UXKA 1GVNB 3FNIA 4JOSA 3T99A 4C1NA 5HTKA 4BNFA 4M0FA 1QS0A 1UXHA 1I3LA 2QX9A 4NXMB 3A04A 5D01A 3U3DA 2ANCA 4JL8A 3O74A 2IWRA 3DBOB 4ASUA 4ABYA 1OXTA 6LDHA 3H1FA 3OF3A 3VH3A 4INOA 1NJ5A 1QPBA 5EJIA 4P08A 3LO5A 1XNJA 2PSFA 3UHOA 3DMYA 3EHDA 1QGDA 3WAJA 3ESXA 1N6HA 2AC7A 2WC1A 5C5EA 4NZOA 3AI7A 4FDVA 1ZM2A 1FYVA 1XTIA 2CFSA 2V7VA 4D43A 1GZ7A 4BMYA 2Z2YA 2QNJA 2YOGA 4ARSA 2JWSA 2R48A 1OJLA 4QUEA 2BHSA 2QROA 1N9ZA 5CW2A 3L49A 3V9AA 2BF7A 5E26A 1OUMA 4B1FA 3AXTA 4EM6A 2DT5A 3ICEA 1FRQA 1XDWA 4YREA 3F6SA 4MVJD 4OVKA 5F4ZA 1P1CA 3RBXA 1X7YB 4FSXA 3TCXB 5H81A 1BWQA 5K4HA 2QP9X 1QK5A 3FNEA 1U8AA 3K5HA 2DEUA 2AVNA 4JWTA 5HKKA 4LTMA 1XRRA 1FP4A 3HBJA 3DKVA 1RJWA 5A5DA 1KQFA 3NASA 3AVXA 2AE2A 1IU9A 3K20A 3I2KA 4U6NA 3UWPA 1Y1QA 4ALNA 2M60A 2I7DA 4M9SA 4IUBS 1O0SA 2D13A 1N0IA 4N5MA 4PNPA 5CB4A 4KKVA 3SS7X 4ZFNA 3LZDA 2UUAB 3T3OA 2PK3A 2G5CA 4HQLA 3ZV7A 1F60A 2IYVA 5KS2A 2CJPA 1SK9A 5CHEA 5A71A 2R46A 4JC8A 3BE5A 3GA7A 3ZE0B 3AEUA 3VVLA 4DEYA 4RD2A 5DK6A 4MRRA 4CKCA 4ROSA 3INTA 1LLDA 3F2VA 1DKLA 1I32A 3MIIA 4ARUA 3KD2A 3KAJA 4DC9A 3S8YA 1AHHA 3UMCA 2WSCF 5B3KA 3OLYA 4C5AA 3NYRA 2ZIZA 1H65A 4AO8A 3DL2A 4NZYA 4NV0A 1P45A 4GRIA 4N5IX 3TOCA 2DHRA 3U13A 4OQMA 3U6MA 4MWCA 4DIUA 3IIIA 4NE2A 1KPHA 3GG9A 1FFXB 1XRNA 2ZBUA 4TLMB 4EHIA 4N0MA 3JYQA 2HHHM 5K7SA 5KNDH 4YUZA 4X41A 3A2KA 4TVKA 4R8LA 1R4AA 4IV0A 2A30A 3BKXA 1Z0JA 4K6KA 1YFKA 2GYUA 5EXDA 5GZ6A 4EGJA 2WQ7A 2HV9A 3RIMA 1M0EA 2E5LB 2A58A 3C7TA 1T15A 2HSDA 4HQRA 4XJTA 1V34A 1USWA 3FMIA 1L1TA 2ZBPA 4G0NA 4US0R 2WWRA 3OZVA 3PWTA 1QLHA 2AC2A 4OX9M 1XEAA 3K5WA 1M6NA 5SY6A 3H8WA 1NUPA 3UTDA 4BGIA 4PG5A 1RMTA 3UWOA 4BL5A 4E12A 5HKOA 2NW6A 1N0WA 1RE1A 3JR5A 2Y0CA 4LYGA 5FQNA 4JVNA 3U4CA 1TCUA 3QV2A 1GRRA 1T4MA 3VYWA 3LTEA 3PFWO 5GP1A 5LU8A 2ZJ6A 1I9GA 5TQ2B 1T10A 3NVDA 3HYLA 3PNYA 3H4VA 3ZUPA 1KYVA 4X54A 2VAXA 4ZCRA 4G56A 3JVIA 4Y9DA 1WF6A 4OSEA 3Q9LA 5EMKA 4E0BA 1GSIA 1E1CB 3FAZA 3JZAA 4ZT7A 1Y5RA 4EUSA 1ZH0A 1XD9A 2XEDA 2EBFX 3MUNA 4A6EA 3SWWA 3K70C 3AKEA 3E4RA 3NBIA 1VI5A 1PJ3A 4ZVQA 2QTFA 4EDFA 2WLTA 3GQ5A 5EMMA 3P71T 4HEJA 1PGPA 2Z4TA 1Q16A 4Q03A 4B35A 1WMDA 1FC0A 2BR3A 3HS3A 3AOGA 2OXCA 1WW8A 4RHXA 3H11B 4QYIA 3SZMA 3T7SA 3EY9A 3SR3A 2DE0X 4U2GA 1T4BA 3FF1A 3ZGLA 1RR6A 1DT5A 2VWGA 2ZSFA 2A78A 4HGQA 1EWKA 4DMGA 3L4SO 4RZ3A 1SHZA 2LW7A 2X3UA 3QBEA 3DTNA 3LHFA 4HAWA 4RHEA 4QREA 4V03A 4YT5A 3TQIA 5AVKA 1P0QA 1V3QE 2OZEA 2WYUA 1VE3A 1YIAA 1GPAA 2QU8A 4KPYA 2DWPA 4V2UA 4BIMA 3EIWA 3VH1A 1SQGA 3D8SA 4P53A 1EK2A 4KQCA 3V4ZA 3X3HA 3N6VA 1L5LA 3WBKA 1VSVA 2A5LA 3TIGA 5AW0A 4M1SA 4H1UA 3TO5A 2GF9A 2YRXA 2ZRQA 1DAKA 4YO8A 2DU8A 4R2JA 4QEDA 3TW0A 3FZEA 1TAHA 3OPYB 2JA1A 3IMEA 2X1HA 4I1VA 3AT1A 4YJKA 3DJFA 4KYUA 3ZU2A 3ZCUA 4P0QB 1ZXLA 1U0FA 3PRYA 3WIDA 2BMFA 5TE9A 2L69A 2QLJA 3EXG2 1VLVA 1W2WB 5LUAA 1ZA2A 5ISMA 5EE1A 2ZT6A 1GPH1 3HJQA 3A4VA 5FTMA 2GAFA 1R4GA 5FOWA 5B7NA 4MQFB 2ZJ4A 4RIFA 1DKMA 4JFAA 1C50A 2HF9A 2IF0A 4IVPA 1JT9A 3ANYB 2FEWB 3IQEA 3L7YA 4DMKA 4LE0A 2PE5A 2WILA 4C7KA 4DABA 4DNOA 3O8RA 4GU5A 3A9UA 2BKAA 2Q41A 1I7PA 2PGLA 4RPHA 1L3BA 2H52A 4MYRA 4DV1M 2YVUA 3GFFA 3UCEA 1WCV1 2JGRA 1PZXA 1JE1A 3CLSC 2L4FA 3Q0TA 1CR6A 4IBBA 3RYFA 3CX3A 2PGIA 1CEXA 1DQPA 1EVJA 1FLVA 2VCEA 4KMMA 5EXPA 4LMPA 4TYMA 3RF7A 3U9TA 4Z1MD 1CBUA 1UZLA 4LWQA 3ZJTA 2Q2EB 3I2HA 5IDVA 1HKHA 4BNDB 3RFWA 3K6JA 1Z68A 3OZGA 1I94B 3R5JA 3MN1A 4REMA 2KX7A 1A27A 1JI0A 1ZXBA 5HGXA 5FUXA 3RVLA 5E4TA 5I9IA 2COUA 2QL6A 5BQXA 5KNBA 3UICA 4QNMA 1VHLA 4N54A 4Z4CA 3H97A 1P77A 4L27A 4E03A 3ELWA 5KQSA 4W5HA 2R4EA 3R8XA 3LP8A 4UHEA 2BNKA 1BS9A 1WTAA 3HU5A 3JD3A 4N8SA 5BSMA 3ZWDA 1ZAYA 3OE7A 5CK4A 3BS4A 3CE9A 1FU4A 3G0GA 3UAVA 3KU1A 1SGWA 1BCSA 1G7SA 1SUWA 2WJ6A 3PHGA 4I8IA 1HK7A 5DNWA 4ZCPA 4O4LB 4AFNA 4C03A 3COYA 1Y3IA 2XR1A 3ZNNA 4CLDA 1LD3A 1DELA 3KOWA 5FAKA 4LG2A 1M2GA 1G8AA 2XV1A 3D3EA 1N5OX 1UJ5A 1YZ3A 3LL7A 3MRSA 2YWHA 4IBIA 1U7OA 1ZV1A 4MTLA 1PRYA 1BSVA 4GWLA 2OCLA 1J39A 1P4AA 4YJDA 2PU7A 1SKQA 1E1DA 2QLBA 1UM8A 4MYDA 3CY6A 4QUHA 1KDPA 3V76A 4TWRA 4TVOA 5HFAA 4JP3A 2JG3A 4ZTUB 2HU2A 3EPHA 1DKPA 3OQVA 4FWTA 2W6JA 1FYXA 2WNHA 2Z5GA 3EQ9A 4M8NE 1VI6A 1PFVA 3TEJA 3ZIAA 4MS1A 2NPFA 3IHWA 4LQLA 5DT2A 3OHPA 1H5QA 1JA0A 1QOQB 3V8VA 3TQOA 3T3EA 3CB2A 4LY9A 1CTQA 3I0NA 3MCWA 5FORA 2OFFA 1WRBA 3T9EA 3IP7A 4HS9A 2JF0A 1A9QA 5E1MA 3NPMA 3H6KA 4MQ5A 3L9XA 3R7WA 3ADDA 3EVFA 4ILEA 2V1CA 2A33A 2QA5A 1GAEO 4QDZA 4K9LA 4LRTA 4W1RA 4CM5A 3U4DA 4C4TA 1M6HA 1ILEA 2WKPA 1TKBA 5BR4A 1RQ2A 1EJ6A 2POQX 3OCYA 4HH4A 5KINB 4LF4M 1YB6A 3M9XA 3KKQA 4KIGA 4I3HA 5AM0A 3ST7A 3AR7A 2XKAA 4Q7LA 4RPIA 3K0AA 1J23A 4X1YA 2WRZA 1VQ1A 2C04A 2FRDA 4JGIA 3CCCA 3ONDA 1SD2A 5FEMA 2Q4TA 1HTTA 2RD2A 1MORA 1XVIA 4PZ0A 4DDVA 5FWNA 4XWWA 1GITA 3ZJUA 4JOBA 2NZXA 2OAEA 2RHLA 4F21A 3QKSA 5CYFA 4KZPA 1NBMD 1Y8AA 1V1RA 3TOVA 2AIRA 4QGAA 4NENB 4DV0B 3B12A 1FSZA 4H1HA 4KOEC 3UF0A 1L4LA 2P41A 2NMVA 4Q4HB 3Q7TA 3OE5A 5JNLA 3B3QA 4OJQA 2EKQA 1FSSA 1SVIA 5KHAA 4RVSA 5KTPA 2DZDA 1Q84A 2QV0A 4E7OA 3T5CA 3PJDA 1R2ZA 2W70A 3H4MA 1KPIA 3HCDA 2QZ4A 4KR0A 3B48A 4LXQA 3GLIA 1JFFB 2FP4B 4GG1A 5DW0A 5CEJA 3LPMA 3SZRA 3GF4A 2DWLA 1NY6A 4L0CA 1QH1A 3CRQA 1Z0UA 1W7AA 2BC9A 2XCOA 3KHTA 2IDMA 2RGCA 3AY3A 10MHA 3OSUA 2MTBA 4GWGA 4DV4M 1L5WA 3G17A 5HIJA 1J2UA 3U37A 1JDUA 3IG8A 2FQ1A 4RNCA 2D6FA 4PDIA 5BNTA 3S8MA 2YWDA 4LGVA 2WNIA 4ZN6A 3G02A 1ZSYA 1W6UA 2XE6A 3COSA 3KXEC 3Q3EA 4PLTA 4GIPA 4IMIB 1X1EA 1O8CA 1ZW6A 2X7HA 3BH7A 2MSDB 3W04A 4I55B 1NI4A 3OM8A 4MW4A 2EJCA 3GEHA 2X8JB 1L5VA 4MNTA 4HZIA 5DMXA 4EDHA 2PNFA 3GCGA 4YI3A 4JZYA 1H8HA 2FOLA 1ST2A 3JQ9A 5HIAA 1M7BA 2H1VA 2V65A 1T1JA 3ODPA 1IPHA 1MVLA 1WVIA 3P0HA 4PPYA 3V1KA 5FB3A 5FJJA 1QVRA 1HURA 4L51A 4BFZA 4F7WA 4NOMA 5EIXA 3GJQA 3JATA 2I3GA 3HKBB 1G5IA 2BFWA 3SE7A 3UIEA 1IDN1 1Y7PA 3C74A 3U49A 1MJ5A 3RTGA 4E09A 4P7FA 3RRJA 2DPGA 3ABRB 4OCZA 3I8OA 1R5OA 2MSEB 1YFLA 2DSTA 1CUEA 3TJRA 3EXHA 3EDOA 2IIVA 1R66A 2AOXA 2I76A 1Y1LA 2J4FA 5KSYA 2A7QA 2DFPA 4G9GA 3STYA 1N34B 1UBNA 3IQZA 4V3BA 1NI3A 2Q3DA 2Y9MB 2CCKA 5KQGA 5DX0A 4BVFA 3MWFA 3AVYA 5LA6A 2VYND 3TEMA 1JF8A 3I6QA 4G86A 3UXYA 5C7OO 5CBKA 1R16A 1O9HA 5JRDS 3HBNA 1C9DB 2W2KB 3HGTA 1MTOA 3E7DA 3H2BA 1LDBA 1CG6A 3FD9A 1PFWA 5L6LB 3EEOA 3OZBA 4JYBA 1JIUA 2BGTA 2Z30A 2DPXA 5LXTB 3G49A 3ZJ5A 3IOBA 3M6LA 2EQBA 5A3JA 2A3NA 1SC6A 2ESRA 2R96A 2IP1A 1A77A 2E89A 2IBTA 3RQSA 1PQWA 1CUUA 1L5YA 3O4JA 1TO2E 4NS1A 4NX2A 1WU8A 4EX7A 1TW3A 4XVUA 1X42A 4MWGA 1VYUA 4GH5A 4V2IA 4LRWA 4D8WA 3EA5A 4UBKA 3T7JA 2R0QC 1LRLA 4MK4A 2QUIA 4Q3OA 3W5UA 4M1WA 5CVVA 1W2GA 4C5BA 3MA0A 1R9MA 4EJSA 5DCUA 3V97A 4ZYXA 2W2KA 3MSXA 1XNGA 4JJ7A 2XZDA 3DXZA 2WM8A 1Y4SA 1BVUA 6YASA 1X38A 4ZCQA 1ZGGA 4YRBA 1F2UA 1RPTA 2ZB7A 3A1NA 2I7CA 4WY5A 2I7PA 2RGXA 2Q6KA 3O93A 4A2WA 4EB8A 1YL6A 1RI4A 1X1RA 4EGAA 4F93B 1QVAA 2PSSA 4BBPA 3GNLA 3IEIA 1K63A 2MJLA 1ZH4A 4CEIA 1HF3A 2VUTA 2FF5A 1MO2A 1R0BA 3L8YA 3OQIA 3E9MA 1XO1A 3B38A 1XHLA 1Z34A 5JE8A 3QHQA 5KQ8A 3SIRA 4F56A 2ZOSA 3U7GA 1J25A 1UBSB 3GAMA 4R69A 4RVNA 1WETA 3AINA 1P7CA 3GGPA 2AMLA 3QUTA 1V95A 1GGJA 2JFHA 2VDWB 1AF4A 4ZCIA 3H2JA 3QY9A 4RY8A 3S55A 3V2IA 2E0IA 3RNLA 3QVSA 5GZ1A 2HJGA 4EITA 3KC2A 2JBHA 4E88A 1R00A 3T3PB 1FRVA 2EC5A 2CMFA 4KP7A 3F7MA 4PLFA 2FSVC 1Z4KA 4TL7A 1NXPA 1E79A 5HZKA 2XBMA 1UBMS 1CY7A 2H4HA 3R20A 2B8JA 2BEVB 5AXAA 2R8XA 1RADA 3IOCA 3HVHA 3NBMA 3WWCA 3JQ8A 1ENZA 1GR0A 3KV1A 1D0KA 2JGDA 2Q8PA 5JCXA 2QDKA 1NJ8A 2PT6A 3D59A 4KSYA 3L0IB 4KV9A 5B3LA 3E9EA 2R97A 3F5FA 1I0ZA 3Q5DA 4ZDWA 1RRMA 3HB4X 1DQYA 1V96A 2YV4A 3NHYA 2GEVA 4ZOCA