1SG9A

Crystal structure of thermotoga maritima protein hemk, an n5-glutamine methyltransferase
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
274
structure length
274
Chain Sequence
SGAERKIWSLIRDCSGKLEGVTETSVLEVLLIVSRVLGIRKEDLFLKDLGVSPTEEKRILELVEKRASGYPLHYILGEKEFMGLSFLVEEGVFVPRPETEELVELALELIRKYGIKTVADIGTGSGAIGVSVAKFSDAIVFATDVSSKAVEIARKNAERHGVSDRFFVRKGEFLEPFKEKFASIEMILSNPPYVKSSAHLPKDVLFEPPEALFGGEDGLDFYREFFGRYDTSGKIVLMEIGEDQVEELKKIVSDTVFLKDSAGKYRFLLLNRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel mode of dimerization via formation of a glutamate anhydride crosslink in a protein crystal structure.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Unknown function
molecule keywords hemK protein
total genus 90
structure length 274
sequence length 274
chains with identical sequence B, C
ec nomenclature ec 2.1.1.297: Peptide chain release factor N(5)-glutamine methyltransferase.
pdb deposition date 2004-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05175 MTS Methyltransferase small domain
A PF17827 PrmC_N PrmC N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1sg9A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1sg9A02
1V39A 3P9CA 4ER3A 3TM5A 2GA9A 2DAEA 4RVGA 5EMKA 4F84A 3HA5A 3BWMA 2NNWB 2P41A 5DM2A 4P58A 5FQNA 2NP6A 1XXHE 5HIMA 1Q0TA 2PXAA 5K0CA 1WG8A 4DA4A 5E9QA 2CWWA 2BWEA 2PWYA 2ZIEA 1D2HA 2DI0A 1TW2A 2PSSA 3BXOA 4PYMA 4V0RA 3THRA 4C03A 4CTKA 4RTSA 2HAKA 2JHAA 1XDUA 3OU6A 1RI2A 1DCTA 3O7WA 2H11A 2IH2A 2Z6UA 1EAMA 2Q41A 3EVBA 4PIMA 5DPMA 4GOMD 2YX1A 1FPQA 5E9WA 2ZBPA 3C6KA 3B3JA 3MCZA 4KVZA 4AZWA 1VLMA 2CL5A 1R6AA 5EC8A 4PYNA 3LCCA 2JZ0A 2AS0A 2P3OA 1JG1A 2VDVE 4MIKA 5LR6A 3REOA 2H1RA 4PGHA 4EKGA 2K9DA 3WSTA 5DSXA 2OZVA 4PYLA 1M0EA 3ERCA 3DR5A 5K05A 5FUBA 2MJ5B 3M33A 5DLYA 2OXTA 4RVDA 2PY6A 2BWBA 5D1NA 4AX8A 4WP2A 3IEIA 4X1OA 1WXWA 5DX0A 4GEKA 3GJYA 1JTEA 4L7VA 4BLWA 1ZHFA 4RTNA 5EHIA 4WVLA 1DL5A 5CVEA 5GINE 2CP8A 1L1EA 4PONA 2UYCA 3MMPA 2PX5A 3FYCA 3G7UA 4PYKA 7MHTA 1NBIA 1NW7A 3CKKA 3D2LA 5HIIA 4E2YA 1WXXA 2PWPA 4A6EA 4ER7A 2VS1A 1Z3CA 1I4WA 3HM2A 1RJEA 5E1MA 5EGSA 1BVSA 2OYRA 5K0BA 3EPPA 4DKJA 2IH4A 1NBHA 3C3PA 3OPNA 3IHTA 4PNEA 1YFLA 2FPOA 4DQ0A 3GXOA 3A7DA 2R0IA 3PFGA 1TR8A 3FUVA 1BC5A 2GS9A 5F2KA 1RI3A 2ZWVA 4ISCA 3MQ2A 4YUZA 5CVVA 3SVZA 5K0EA 3OZTA 1T6OA 2CWBA 4RTQA 1VL5A 1EIZA 3SX0A 1KXZA 4X41A 4QPPA 3ELUA 3AWIA 2DAIA 1G55A 2JY5A 4RVHA 2O57A 2IH5A 2Y1WA 1VP9A 4HTFB 4HSGA 1V92A 3MTIA 5LQCA 5FQOA 2PV0A 2NYUA 3BKWA 3FPFA 1YFJA 3IYLW 2FK8A 2A14A 3LL7A 1A5TA 5G02A 4C08A 3DLCA 3QOXA 3TKYA 1MN3A 2BM9A 4IV0A 1XJ5A 2LBCA 1HQYE 5IH3A 3P9IA 3EVGA 2LVAA 5KQRA 4MTLA 3VSEA 2ESRA 3DXXA 2AVDA 1G8SA 4HH4A 5JI2E 5EIFA 3FRIA 1AQJA 3LDUA 3NMUF 2XVMA 5ICEA 3BUSA 2ZIGA 1BKYA 3NVKI 1IXKA 2CMGA 2KNVA 5LSAA 1JG4A 1YB2A 3ER9A 3FUXA 2P7IA 5K0GA 3GLIE 1G3IA 1IFYA 3JWGA 1ZG3A 3EVAA 4BLUA 8MHTA 2HTEA 5CCXA 2ERCA 4RTOA 1H1DA 1WIVA 2GH1A 1NE2A 5DM4A 5EEHA 5HIJA 4F85A 5K0FA 4DBGB 1P39A 1TTEA 4EVIA 5EHGA 4LWPA 3P9NA 3U81A 2C7PA 3G88A 4RX1A 4YMHA 2I6GA 2PXCA 3UFBA 1HNNA 1N7IA 2PJDA 1AV6A 1F3LA 2IGTA 4QQKA 2C7OA 3DUWA 2G70A 3CC8A 5DRTA 5CCBA 5HEKA 3QV2A 3UZUA 3KPUA 2OOAA 1UFZA 4QPNA 4K6MA 5K09A 1VEKA 5JUWA 3EEOA 2O0LA 1UWVA 5HOQA 4EQZA 1Y8GA 1CUKA 2LVPC 3G2MA 2PGXA 3DULA 2DPMA 4YUYA 4YUVA 2FCAA 1X1CA 2GAFA 3LDFA 3E8SA 3DOUA 4C4AA 5EPEA 1KYIA 1JSXA 3UJ7A 3KQSA 3ORHA 4A6DA 3E05A 5E9JA 2PVCA 2MROB 2PX2A 1L9KA 2DAGA 2JY7A 2QRVB 3EMDA 5KYGA 1B42A 3VYWA 5EMLA 1O54A 4M38A 3TRKA 2VDUE 3RODA 4FS8A 1WGNA 1P1CA 4GEWA 2YXDA 2I9KA 2B9EA 1DO2A 2P35A 3GDHA 2FYTA 5K0JA 3LECA 4ER0A 1WY7A 5K0NA 5KQSA 1BHJA 4YV0A 1ZGAA 4C04A 4LECA 3SSNA 1X1AA 1SUSA 2UYOA 1KPIA 3P97A 4HG2A 4E33A 3LCVB 3R9XB 1P91A 2P1DA 1HJPA 4KRGA 1X19A 5B1SA 3UWPA 4DMGA 4CWAA 2AN5A 3T6PA 1M6EX 1VIDA 2DENA 2ONZA 3B3GA 1G8AA 3FUTA 3GU3A 1JTFA 5BW5A 4YV1A 3OU7A 4C05A 2PX8A 4FR0A 1O9GA 4YV2A 3PTAA 2IBSA 4RWZA 1U2ZA 3A27A 3HVIA 4PYOA 5DT2A 4YUXA 1EFUB 3PVCA 1RJGA 3KPVA 1L3IA 5P8WA 4E70A 2JG3A 3HVHA 2WZJA 1FP2A 3C6MA 5EQJB 2E5WA 4P7JA 3Q87B 3T7SA 4JXJA 2OY0A 5EEGA 3LPMA 1QZZA 3EEYA 3P71T 5LQRA 2AOXA 4X60A 2G71A 3LKZA 3SXJA 3ANXA 2OPBA 2PX4A 3EVFA 3PT9A 4CXMA 2ZZNA 1I9GA 4RTJA 3JWHA 4R8SA 4BP3A 4ER6A 1EG2A 1VG5A 2OKCA 2PT6A 3M6VA 3QOWA 4E2XA 1NW6A 1DO0A 2UZ4A 3KQWA 2IDJA 3RIEA 2EJUA 5FTWA 2YUIA 1YLAA 2NXCA 1VQ1A 3M6UA 2QM3A 9MHTA 3PLAE 3BKXA 4B17A 5C9ZA 3GWZA 2KNAA 2B2CA 2WA2A 3G8AA 1F4IA 1PRYA 2DHYA 4E30A 4X63A 2BR5A 4XUCA 4F86A 3FTFA 1KPGA 1E94E 4CKCA 4M7RA 3P2IA 2NXNA 5HILA 5JR3A 1XCJA 1ZMWA 2G3QA 2AOVA 3P9KA 2L2DA 4OA5A 5CUQA 3THSA 5HZMA 1ORHA 5GP1A 2LVNC 2ZBQA 2YTZA 3KU1A 3GRZA 3HCBA 5H02A 1IXSA 1F38A 2QYOA 4RV9A 4IKPA 2CMHA 3EVZA 5CVDA 2P3LA 3H4JA 3FPEA 5E2BA 4BY9E 3LX6A 3OU2A 2HWJA 3IHPA 2YXEA 1WHCA 2O25A 3AY0A 5E2AA 3FZGA 4E2ZA 3KR0A 2BR4A 2ZULA 3BWYA 4E31A 4MQ4A 4P7FA 3ER8A 3NWBA 1KP9A 1WJ7A 2PXXA 1JR4A 2YVLA 2RRUA 2JH8A 3L8DA 2P3QA 2IDKA 1ZGJA 2WK1A 3OZRA 2HWKA 3BBZA 3M6WA 2HNKA 3KPYA 2ZIFA 4GOOD 3F4KA 4HRAA 4OA8A 1RI4A 3KR1A 4MWZA 1JG3A 4RTPA 3DLIA 3FTDA 5EZSA 1X1DA 2P40A 5EMJA 2G8NA 3OCJA 3TMAA 2AOUB 1R8YA 4IV8A 4OBWA 5C1IA 2LD4A 1XB2B 5ICCA 1QANA 3LBFA 3Q7EA 4R71A 1QAOA 1INLA 3MHTA 2ADMA 1YF3A 3UJCA 5FHRA 1JR3E 3RW9A 2Z6QA 4OBXA 1KYZA 1SQFA 1VPTA 3HEMA 3DXZA 1ZQ9A 1QZEA 3A7EA 2ZTCA 3ID6C 2JNHA 2HMYB 5DXJA 3FPJA 3HVJA 5DSTA 3UA4A 3EVDA 2AN3A 1G41A 1EJ6A 1PGYA 3KPWA 1RI1A 4ER5A 2O07A 5DRYA 4Z2YA 3B89A 3JWJA 4HGYA 4PYIA 1VBFA 5EOVA 4Q7JA 1T43A 5GM2A 1VP3A 2MR9A 3ELWA 2B78A 3VC2A 2YR0A 2KHHA 2H5XA 2P7HA 3ELYA 4PCAA 5GWXA 3VC1A 1SVUA 3LHDA 1WGLA 4FP9A 5GIOE 2IBTA 4RSRA 3SM3A 3C0KA 5BW4A 1RJFA 2XYQA 3UA3A 2K0BX 4R05A 3FPHA 2K4MA 3FUWA 2EG5A 1XTPA 2HV9A 3NWEA 3DH0A 2XVAA 2AOUA 4GF5A 5EKXA 4XCXA 4E2WA 4EKIA 3NDIA 5BXYA 1ZMUA 3DP7A 2OOBA 1R74A 1WS6A 3UBTA 4FT4A 2EJSA 5FADA 2IIPA 2DZLA 3SSOA 4E32A 3UJDA 1Q02A 5HIKA 1OQYA 4HC4A 5DWQA 3MB5A 2B25A 2JZ1A 2L4EA 4KIFA 2BZGA 2R3SA 3NJRA 3FYDA 2ZZMA 3SSMA 2DULA 4QVKA 2ZTHA 5EMMA 3ELDA 5ICFA 4P7KA 4ATNA 3I64A 3AXTA 3O31A 2PLWA 3LCUA 1VDLA 4R8RA 3G5LA 3TPZA 1NKVA 4KDCA 2AR0A 4OQDA 4QDKA 3GO4A 5CVJA 3GRVA 3GCZA 3OFKA 1OAIA 2ZLBA 3KQYA 3HA7A 2G72A 3B3FA 1NV9A 1MJFA 3GIWA 2QSFX 1PJZA 5CVUA 3TLJA 4Y30A 3E7PA 3EVCA 5EKUA 4ZTBA 1UIRA 4X61A 5M5BA 1NW5A 1QAMA 3TM4A 4EK9A 2ZVJA 3B5IA 5DFLA 3KQPA 1RI5A 1DUSA 1SUIA 4FSXA 5F2OA 4AZTA 1WR1B 3A4TA 3EVEA 5ERGB 4FT2A 4F2LA 3T0IA 4Y2HA 3HNRA 3GRRA 1KPHA 4QVGA 3G5TA 1ZV1A 5K03A 2UYQA 3I5UA 4HGZA 2KNZA 4DCMA 1JG2A 3CBGA 3KQMA 2V74B 3BT7A 3CJRA 2XYRA 1YZ3A 3K9PA 4G56A 3HCAA 3HCEA 5GIPE 1OKSA 2OO3A 3DTNA 1BOOA 1M6YA 4KDRA 4WXHA 3F92A 2ZBRA 3OZSA 3PFHA 3SMQA 4AZVA 4GBED 4C06A 3FPGA 1QAQA 4KWCA 3BZBA 1G6Q1 3HCFA 5EIWA 4DCGA 3PX3A 2ORED 4XUDA 3TKAA 4YMGA 2QE6A 3NTVA 5LQJA 3R3HA 1FJXA 3JWIA 1XVAA 3KPJA 2VZ9A 2XYVA 1UFKA 1IY9A 2JUJA 3MGGA 3OFJA 4FSDA 1R8XA 4IWNA 4M37A 3UJ8A 3X0DA 3SR4A 4BLVA 2IPXA 2PT9A 2JP7A 2AZTA 5DM0A 1XDZA 2QY6A 4GC9A 4U7PB 4HEOA 2EJTA 1ZKDA 2JHPA 3E23A 3GLFE 3KQQA 3LSTA 3G89A 3ME5A 4FZVA 3MAGA 4R6WA 4RVFA 3KQTA 3FE3A 2YXLA 5BP7A 4RTMA 3DMHA 2QHOB 3M4XA 2I62A 2ONYA 3FTEA 3MTEA 3CVOA 4GC5A 4O29A 1JQ3A 2LVQD 1L3BA 4NECA 1JQEA 4CTJA 10MHA 2BH2A 3G2QA 5D1HA 5FULA 1G38A 3EGEA 4PWYA 5E8JA 4DM3A 2DAMA 3BWBA 2LVOC 4QQNA 1AQIA 3T7TA 3BWCA 3E21A 1Y8CA 1NV8A 2JY6B 2AN4A 3R6TA 4QTUB 3T7RA 3AXSA 3I9FA 5MHTA 5CD1A 1X1BA 3HCCA 1JSZA 4HTFA 2ZWAA 2L4FA 1ORIA 2HR1A 5KVAA 2QRVA 2EKFA 4RYLA 3LBYA 3I53A 3G2OA 5E1DA 3EMBA 3S68A 3I58A 4R6XA 3R24A 5T64A 2XBMA 1AF7A 4CKBA 2DNAA 1R4GA 3LKDA 4V0QA 2DKLA 4DZRA 1N7JA 4MHTA 3GRUA 2JHCA 1G4AE 1I1NA 3NW9A 4XUEA 1ZMVA 3HP7A 3V97A 2YQZA 5DM1A 4RTKA 4F1IA 4RTRA 3GLGE 1XDSA 1XXLA 2BR3A 2IFTA 4M36A 4AUKA 3OE4A 2N47A 3G2PA 4LG1A 3NDJA 5T6BA 1TPYA 3IECA 2F8LA 3AJDA 4QDJA 1YUBA 2PBFA 4KW7A 4GOLD 2AVNA 2NXEA 2OBFA 5FA5A 5FHQA 2GLUA 1EQAA 3GGDA 2NP7A 3P2KA 5K0LA 3R0QA 5T67A 4AZSA 5C0OE 2EKKA 3GNLA 3GRYA 3OE5A 3BGIA 1GO5A 5DXAA 3K6RA 5IKMA 2JY8A 4PCLA 3TOSA 5DTQA 3A25A 4P7GA 5EZQA 3NVMB 2ZFUA 4PYQA 2MGWA 2GPYA 1HT2E 2QNJA 1EJ0A 2NXJA 2B3TA 5CM2Z 5DTRA 2Y1XA 4C07A 4PYJA 3HA3A 2DAKA 2FRXA 2IP2A 3LDGA 4PINA 2UYHA 2Z6AA 4OX9Y 2AOTA 3UJBA 4RTLA 3KQVA 2AOTB 2CKDA 1JQDA 5E8RA 5FWAA 3MERA 5EVJA 1HMYA 1KR5A 1Q0SA 2JJQA 3UJ6A 2ZCJA 3KHKA 2OB1A 5GOZA 4POOA 5DX1A 5CIYA 1C7YA 1G60A 2FK7A 3A26A 5HFJA 5U4XA 1YZHA 3C3YA 2LTUA 1MHTA 1NT2A 3DMGA 1XCLA 3PS9A 5GM1A 1RJDA 2JH9A 4G3OA 3HCDA 2OO9A 2R6ZA 1QYRA 2ZZKA 1AIPC 3FUUA 3GLHE 3PB3A 4FGZA 1DV0A 1D2CA 5FCDA 3UJAA 4PIPA 2G1PA 1R00A 3CJQA 5K01A 3CJTA 5LQNA 4UN2B 3KR9A 2ZW9A 1SKMA 4GUAA 3M6XA 1P1BA 4EMSA 4YUWA 4U7TB 3K0BA 3BGDA 2VP3A 5LQKA 5FA8A 5DX8A 1VEGA 2H00A 3CCFA 3CGGA 3DMFA 2I7CA 3KKZA 1KIAA 3TFWA 3HTXA 5LQUA 3H2BA 1D2GA 2V7EA 1OR8A 4H0NA 2VDWA 3KR2A 2O05A 3LGAA 3KQOA 1KHHA 4DF3A 3O4FA 5ICGA 4QTTB 1P3QQ 2P8JA 2EFJA 1KYWA 1TW3A 3P8ZA 1HT1E 1L3CA 4CKEA 1IM2A 1VEJA 5E1OA 3MCTA 4OQEA 1FBNA 1NW8A 3IV6A 4KIGA 2ZTDA 3EGIA 5E1BA 2O06A 2ZSUA 5F2NA 2KW5A 2AOWA 3M70A 1VE3A 3E46A 1SQGA 1IM8A 5DTMA 3FRHA 3G8BA 5FWDA 4GOND 5K8VA 1N2XA 1FP1D 2EX4A 2WA1A 3EGVA 2C7RA 3TR6A 2GB4A 1WZNA 3PX2A 4UOEA 5LQAA 1O9HA 3P2EA 3K9OA 3DXYA 3HVKA 3V8VA 1SG9A 4PGGA 5KS2A 3B7PA 1OTRA 5EG5A 2BM8A 2PKWA 3SGLA 1R18A 3BGVA 3TQSA 1NW3A 4LWOA 4BP1A 2FHPA 2C7QA 3FTCA 3UJ9A 4GQBA 2OB2A
chains in the Genus database with same CATH superfamily
5TPZD 2YBEA 3TM5A 5JY1A 4RA6B 5C4MA 2DAEA 1Y82A 4X62M 5EJGA 2M6RA 2BI7A 2P2YA 4NMLA 4CNQA 4XVHA 4DV6B 4RH3A 1H3EA 2PWYA 1FJGM 2W58A 3JATB 5ITXA 3JAWB 4FPXA 4IVNA 3DHNA 4M0PA 2XF8A 3H4VA 2HC9A 3S1AB 4B5KA 5C7LO 4KLNA 2NT3A 1H6UA 1CC1S 1LBTA 4RNDB 4XTCS 4YRIA 4AJEA 1J1ZA 4PX9A 1GY8A 5KVVA 3VHXA 2D0DA 1RRPA 3GJQA 1ZD9A 1N3IA 3GQ4A 3SZ3A 3WWZA 3W78A 4YMVA 1B8PA 3RC1A 2XPCA 4MJ7A 3MJSA 4TYMA 5KX5A 4B43A 5J2TF 3VXKA 4MIKA 3HJFA 2H65A 2O1WA 3OCCA 3Q6MA 5KREA 2XMSA 5K51A 2VYNA 1KYYA 1LX7A 1R2ZA 1Q15A 3IUBA 1XZKA 5AKXA 1W6RA 1CR1A 4WN9A 1JAHA 4O2AA 4CKYA 3DEAA 3H0KA 5HK8A 4YIHA 3BD6A 4NXMM 3HZZA 4O4JF 5DLYA 1PN3A 1R6TA 1ZPDA 1KC3A 2VXCA 3EMKA 3E18A 3PENA 4L5IA 4P38A 4ZO6A 3ZZ1A 4WP2A 1GAWA 3VDUA 2MJLA 4Z4EA 2OC4A 1M67A 4G5RA 3ZD6A 3GRKA 1BXZA 2G9QA 1GPYA 1TAQA 4JYAM 1Q6YA 2IYZA 2G06A 4HNHA 4B3FX 2Q3HA 4RK0A 1AG9A 1MQAA 1J8YF 1I33A 3A9CA 4MJLA 4ZMRA 1KY2A 3PTZA 1WBBA 2C7VA 3M83A 1Z07A 3DKVA 5CK5A 5B12A 1SXJC 1OXSC 5D3QA 2OYRA 1DXHA 4HEQA 3C3PA 2ZI7A 2BMWA 1YVDA 4AI6A 1C0LA 1RKUA 1GUDA 1ULSA 3D5TA 4XASA 2B3DA 5CFPA 1XD9A 2QUAA 4JV5M 3WB2A 2ZWVA 2SECE 3VZPA 5KWJA 1T6OA 4Q3NA 3ESDA 4PHTA 3SX0A 3OOJA 3S28A 4Z7NB 2R1VB 3VJRA 1EK5A 1UKVY 4UC0A 5TT1A 5CEJA 1GGVA 4UBMA 1N2IA 3ESQA 2WJWA 1GU7A 2PNJA 1DMSA 2PV0A 1VGQA 3BFJA 1A7UA 4IIDA 1EGMB 1UZUA 4FOTA 5AVZA 2FK8A 4G0YA 4F9GA 5A6SB 3SATA 4RDIA 4IQ0A 5EYPB 5E7QA 1CHDA 3NBYC 4XYLA 2QR5A 3I37X 3T0GA 2P4EA 4BN0A 4IJFA 2LBCA 2OAP1 3CX3A 3DBOB 4MO9A 3IKMB 2JDIA 1K3WA 3QYAA 1KJNA 4X97A 2R1UA 4NIMA 3F6SA 4ZCIA 4KNYA 1SMKA 2VP6A 2JAXA 5F64A 3CTWB 2BE9A 2GN4A 3U7GA 1UAAA 2I7NA 4B8WA 2F4VM 4RFSB 1NMYA 1L1ZA 2MR5A 4CUJA 1YSYA 3IMCA 2F5PA 1UC8A 2RBKA 3HDTA 2BI4A 2VBGA 1DKQA 1FTSA 3N2KB 4IVPA 2B35A 4LNUB 1P1RA 2WD9A 1ABBA 3DOAA 1KWKA 4GR4A 4K9QA 5K0FA 5FTKA 1TTEA 1XXHA 1HKUA 2BM0A 1TXGA 4JT8A 1RU3A 1LVHA 3OF2A 4FEGA 2MSDB 3NUGA 2H1LA 4H31A 1HNNA 1BMFD 2FW8A 3SHOA 3E3OA 3L8MA 4Q7KA 1UDXA 2ZSHA 2O50A 4MYDA 4Q7EA 3L05A 2GKOA 4M1SA 3A31A 4TMKA 4V38A 4DCOA 4HDCA 4UFNA 2AWOA 2DWMA 1Y8AA 5EYPA 4L5CA 1CEEA 4WCVA 4BQSA 1U3FA 1JZTA 3PIDA 3GQBB 4X1KA 5FYDA 3T3IA 4BV2A 4UNSA 2MOKA 3LQQA 3FHOA 4DWVA 3JQ9C 5KUTA 1LX6A 5J47A 3HPRA 3C70A 1EVLA 1Y8GA 2PGXA 1J1IA 4YRFA 3T3EA 3MWJA 1ZK3A 1QVAA 1CNMA 1W5EA 2DPMA 2UYGA 3D7LA 4YUVA 4HN4B 1WCV1 4HAZA 4FNOA 2QBYB 1ZUHA 1DGHA 5TR9A 1K0UA 3QNMA 4B3GA 2HSGA 2R8OA 1P62B 2QW1A 5F5XA 3ZU3A 4ARUA 2QYHA 3V3TA 3L01A 3VAYA 1JRLA 4D9IA 4HWSA 5LB4A 1OASA 1O54A 3H65A 4JLWA 5REQA 2A0UA 3IRUA 1WGNA 1Z75A 2SCUB 3PJFA 3H5TA 2DHDA 3K1JA 3GDHA 3QJYA 1V11A 3OD1A 4QX6A 4L27A 5B30A 2W71A 1NXVA 1Z6GA 3G7SA 2QXTA 4G1UC 1NPDA 3K70C 2R47A 3GDGA 1D0SA 4A27A 4N6NA 1E3WB 3MWDA 1EZZA 4UM8B 1CUJA 1GQOA 3TDKA 3VO2A 4RMGA 5JD6A 3GVCA 1L7BA 3JRWA 3A6PC 4MLCA 4QVIA 4G1BA 2C8KA 3K2EA 2B30A 2DX7A 5C7OO 1Q92A 2ONZA 3E3AA 1YDMA 1Z18A 1ESMA 2D06A 4CVNA 1VSVA 1O6FA 1PR1A 2J59A 4FR0A 1E1CB 4WCFB 5T5QA 4YV2A 2ZRIA 4KFSA 4M86A 1IXZA 1V33A 2QVLA 3KPVA 4E70A 2HYIC 3T61A 2GN6A 1FFYA 3DZFA 4YAFA 3RIMA 3NIDB 1ODIA 1PAUA 2HSDA 4XH9B 4HQ0A 2R8BA 4KE6A 2O2SA 3WIOA 4D99A 5EFOA 2H4HA 2XE6A 3A3OA 1VCNA 1Y34E 3KWLA 2W6IA 3SXJA 4I3GA 2H57A 1DQZA 3DEJA 3W2FA 2V6GA 4FU0A 3T38A 2JGNA 3RRMA 3UQZA 5JBQA 1CT9A 4XSGA 4LBZA 5IN4A 1OVGA 2K5UA 3RC2A 5FEUA 1MV5A 1EFTA 2Q3DA 1IN4A 1UKZA 3T1YB 4CL3A 4G5SA 2HA7A 2B0CA 5DHUA 1BNCA 4MGEA 2KYRA 4WJZA 3AR3A 4PZDA 3PJDA 1F4IA 4B3TM 3RCBA 3V8PA 4B3IA 1DEHA 1GUYA 1KPGA 4I5FA 5LXTF 2DZNB 1TZJA 2DCMA 4OH7A 4OXXA 1ACMA 3OTWA 1J49A 4HEA6 1V7QA 1N6LA 1XQ9A 3GAFA 1XD8A 1XRNA 3E22B 1EWKA 3O8OB 3EEBA 2YTZA 3EK2A 4NDAA 5LZ2A 1QUEA 2HLNA 4KPUB 2QYOA 2ZRLA 3DHEA 3JAKB 4IKEA 4ARBA 1HETA 3H4JA 2GPWA 2NO0A 4Q00A 5EKDA 4YVFA 3GZ4A 2WUGA 2YXEA 2VDBB 1WHCA 2VWGA 4BGEA 2MTBA 3S7TA 3ANTA 5AXDA 1T9BA 3RWOA 4PX2A 1E6KA 2ZULA 2FMUA 3BWYA 3DVAB 4ZZIA 2IRWA 1R0BA 1WBJB 4WLUA 2Y05A 3O1LA 5FNVB 3PHLA 4PSCA 2ZP1A 3GWGA 4IBGA 1P60A 2JH8A 5LQKA 3QTLA 1JHRA 4F86A 2FZEA 2O2IA 3KPYA 4HWKA 2ZIFA 4WT7A 1KI3A 1R0KA 2B94A 4HAOA 3LY7A 5EZYB 3OIFA 3UY4A 1MQ8B 4QSMA 1D2MA 3T9DA 2B4TO 1LEHA 2ZJ2A 4C6SA 2RI1A 3FA2A 2I9PA 3FD8A 3A37A 3NEPX 2FGKA 4ARZA 2BMDA 2VZ0A 4U39A 4XQ9A 3ROQA 4B3BA 2XZOA 3ABQB 1D03A 1YL5A 4LXXA 3GRCA 4H1WA 1E4VA 4PC6A 1M2OA 4G36A 5KTYA 1YF3A 4GL4A 4QRIA 1JIVA 1UKYA 4YLEA 1M2OB 4DXAA 3BXHA 4JGBA 5J2TB 4QQRA 2ZTCA 4XVCA 2CDNA 3JQBC 2Y93A 1DRUA 1NFRA 4A3VB 1RS0A 3OM1A 3EXHC 4XRRA 2ISSD 3TG8A 5GM2A 4IOJA 1PFUA 4LF8M 3VGPA 3HKEA 3DE4X 3IP8A 5CH3A 1P31A 1UBEA 2WKSA 4NG4A 1CZHA 1NF9A 5B3JC 1XCOA 3SKYA 5B36A 2Q1UA 4L4XA 1U4NA 4X0EA 3UB2A 5IZ4A 4R05A 2GM9A 3KEFA 2C3PA 2XUAA 3D2CA 3K53A 2AYYA 1VA5A 3ONNA 4JLPA 3RRNA 3V8MA 5DW0A 2AG6A 1K7XB 1FLAA 1A7AA 2HRBA 3DP7A 3I1YA 2F8SA 5J4KA 1P9WA 3FN4A 3HV0A 2G0NA 1XLTC 5HNKA 3LZDA 4WY5A 3RKRA 3TZQA 5JJIA 1YCGA 2BV3A 2XOKA 3D0OA 3E9ZA 4MV9A 2I8CA 5JT1A 4AROA 2ZJBA 4MPDA 3K9GA 4UPVA 4FWIB 2KDLA 3SSMA 3UAOA 4UFOA 5CT6A 5K3DA 1KI1A 1WB6A 5JNSA 3LTNC 4KWIA 2ZYWX 2ORVA 1B6SA 4M21A 4Z99A 3VOSA 3I61A 3KZ1E 5EJFA 5TRTA 2YXNA 4E5UA 2J9YB 3ZI7A 3OE7A 1LRKA 3ZBUA 3K6SA 4I8XA 5G0SA 3FOBA 4DLVA 3SMVA 1E2IA 4MICA 1G9SA 4NZYA 4ZT2A 2V54A 3QXHA 1B41A 4YA6A 3UFXA 4EARA 2H63A 4X64B 4ADSG 2QP3A 1GG9A 2V4ZA 5EKUA 4I1PA 5AIBA 1ADFA 3H7AA 5JAOA 1ILWA 2WAMA 3F9CA 2AFHE 1X37A 4JBLA 3SXUA 4AJ1A 3QYJA 4DAOA 5AI5A 4IX1A 1Q84A 1DELA 3A6JA 3OJFA 3N0RA 1FFCA 4JOQA 4MNTA 4WXEA 1V8OA 1GPH1 5CIQA 2WTEA 4F3NA 1JEQB 1OBVA 1MVOA 1XVTA 3PDJA 3RQIA 3FAKA 4FFLA 3VR5H 5KSZA 4DV5B 1J8DA 3BD7A 3PSHA 3J80S 1TUBA 3TQTA 3TLCA 4DLAA 1PX2A 2OCAA 4KDRA 5BSTA 3PFHA 1DAGA 4LISA 4AZVA 4GBED 4U7HA 5D3MB 1QAQA 3HV2A 2XEXA 4H08A 4BFCA 3BCRA 1FDSA 3LD9A 4YMGA 3OWXA 3V4ZA 1L7OA 1WSBA 4J3FA 4P2GA 3QX7A 2HREA 2L2QA 2V7WA 3A1FA 4IWNA 3TWOA 1YBHA 1U8CB 4ROSA 3KDSE 1IDOA 2I2FA 3H6GA 1IRXA 2X0FA 4EAAA 5JMWA 1A7KA 1FNMA 3C3JA 1MB0A 4OMCA 5EWMB 5C32A 5IKPA 4MV7A 3GPXA 1QOZA 2CHUA 2P4UA 4HGRA 3S2YA 2P9QA 4BEVA 3R76A 3KNZA 1QF9A 1YHNA 2H1HA 3QE0A 1ZSNA 4OHUA 3ESCA 2FXVA 2FUG6 1D3AA 3QE4A 4JODA 4NHEA 3LP5A 1E66A 5FULA 4Y0VA 3AR7A 1N9KA 4LYYA 5FPYA 3LYUA 2R4TA 3CLUD 4HLUC 1Q7GA 3KZKA 2AFHA 1E64A 4UUPA 3Q85A 1UBKS 3LW7A 4FCWA 3R6TA 4NI5A 5KCZA 3WYGA 2GZMA 1VFPA 1KDRA 1BROA 1JSZA 4QODA 4BWYA 4CG0A 1OIPA 1ORIA 3DDCA 1JV2B 3PQ6A 1IOVA 1L4KA 3BOSA 2WWWA 5L4LA 4HOYA 4KR3A 2ODQA 2BHLA 3GJRA 1CUWA 3H5AA 4QDUA 1RVV1 4MRMB 4S1WA 5TVGA 4OL0A 1IHYA 3LI2A 4B3SM 2VI5A 1UAYA 4DREA 4P53A 5FPQA 1XK7A 3HP7A 3KU4A 2P9CA 2QJFA 1J9ZA 5DM1A 3A3KA 3GRFA 1CD5A 3AUFA 4QM7A 2N47A 2ZJ3A 5C5DA 3IQIX 3SR3A 2EZ8A 2WU0A 1PGPA 2F8LA 3DQZA 3EQZA 4WFJA 1C1HA 1X1SA 2WAAA 3F47A 2NXEA 2OBFA 2RJ3A 1T4CB 1U2DC 2GLUA 3AY3A 3H9UA 3EB9A 3X1DA 1P0CA 2JZCA 2NU7A 4PZ9A 1TEZA 1C8LA 3TIIA 1SD2A 3GB9A 3BGIA 3ZDQA 1K4YA 4FYWA 4QOHA 3UWSA 4KWHA 4OQXA 4E6EA 1O58A 5BUSA 1I36A 5EERA 3O8BA 1NP7A 1T1RA 4JJ8A 1P5JA 2VQ3A 3EG5A 3L6DA 1GTZA 4IOMA 2N0SA 3NONA 4NP6A 5ELLA 3WRVA 3OETA 1PJIA 4PNHA 2C3UA 4CQMA 3MRTA 2AMJA 4WQMA 3JALA 3IP6A 4AK9A 4B3MM 1PUIA 3OLZA 3INRA 5JNRA 4JX8A 2D0OB 2X6RA 4XCQA 2JJQA 3K9BA 4X20A 1YD7A 2WJ3A 3A6GA 3LVFO 4H7EA 5DX1A 2EDAA 3TWLA 2FCRA 2ZSBA 2NAFA 2PSHA 2HWYA 4II2A 5AW8A 1IY0A 1BXGA 4OLJA 4C1NA 4ZYZA 2O1EA 1NT2A 3E9QA 2HPVA 1XCLA 2CB9A 5I7WA 1RRCA 2C07A 3LU1A 2WFMA 2OLJA 3DKPA 5AJHA 3FUUA 1J0CA 5I7SA 1R2YA 1DV0A 5JCPA 1DUIA 1R2QA 3DF7A 4QXMA 1GSAA 5K01A 3IJPA 1C8BA 2V8OA 3IAFA 1NXOA 3RIXA 4LWQA 3WX0A 5AO9A 2NTEA 1CY8A 1DWPA 1ODLA 2CDRA 2HQBA 2H51A 2J09A 1XF9A 3ETGA 1TM4E 1YRQA 5ALQA 4PDIA 1ZRMA 3DJFA 4IWXA 2AYXA 4X1YA 1DC6A 5IK2A 3FFBA 1OIXA 5AW6A 4TUWA 3IDQA 1NJGA 5A9SB 1K3UB 4R1NA 4XARA 1TW3A 3GP3A 5FNVF 3WGOA 4RY2A 4EL0A 1PYDA 2EARA 5K0ZA 2BFFB 3DONA 3LVVA 1JEQA 1T3ZA 3NHWA 2HPZA 1QV6A 4JH0A 3EGIA 5E1BA 2NO4A 4LVOA 3ZNPA 1HRDA 5B58T 2MMCA 1DDOA 2HQRA 1HUQA 1WOYA 5EWLA 1LI4A 3TNJA 1H6BA 4XIJA 3IESA 2HZ7A 2Z2IA 3KE9A 4HI0E 1XAIA 4LRSB 4LTMA 4W63A 4YASA 1QPZA 3ICQB 5I8ZA 2IQ5A 3NOQA 3G0OA 3CIFA 5KHLB 4YR7A 2IOFK 2SKDA 2XBUA 3H5VA 5LWQA 5DIFA 2GEUA 4KJZA 1NNLA 2FVYA 4MLDA 2CN1A 3BHMA 2I54A 4FMPA 2FHPA 4LI3X 3RSOA 3MCAA 1WEHA 1UMBB 2OB2A 4QAJA 4CMCA 1JZQA 4MZXA 1KJQA 4US2R 3OQOA 2X5NA 3R41A 1YU6A 3OQMA 1RM4A 1AHHA 3VYVA 4D46A 3MJFA 5A04A 1GRNA 1G7RA 1M1NB 3TG2A 3TEJA 1D0VA 1QF6A 1A9RA 3AG5A 3BXOA 4EDFA 3MTQA 1OGIA 2E1PA 4QFCA 5H0IA 4EGJA 5KYYB 1IJFA 1WPQA 2C4WA 2JHAA 3HGTA 1UR5A 1PR6A 1BEZA 4HWOA 3HDGA 3EW7A 5EWMA 2W0MA 1WHTA 3R77A 2UZIR 1IK4A 4G3XA 1SIBE 2I6UA 3IPAA 4HN2A 5DPMA 2UU9B 1W4CA 1ZJ6A 4JU8A 2MYPA 4B3SB 2EL9A 2XFSA 4ZREA 4AMUA 4AWAA 3KVWA 5A0TA 4FBLA 1E2GA 2JZ0A 1G1MA 4QPDA 4ND3A 4WL0A 2ASVA 1R0YA 5LR6A 3WK7A 2C97A 1YCDA 4RL4A 4WBSA 3TUZC 1XE3A 5LVAA 3RWMB 4W82A 1IBKB 3FSRA 2VDRB 2A35A 3AMVA 3BDIA 3IUJA 5D3MA 1USIA 4A0RA 1NA5A 2AF3C 3ODGA 3OQHA 3PXXA 5I45A 4LOKA 3E3MA 1NQWA 3V7NA 3BDVA 4ZT4A 4ACAA 1WR8A 3VRHA 1LBSA 3KYCB 2PL9A 3NXSA 2OZEA 3O1IC 3GGSA 4FIDA 4GEKA 3L2AA 4JI1M 1TX4B 2C20A 2TECE 5EHIA 5F9HA 1IBLM 2TYSB 2UYCA 2XVXA 2PX5A 3VVLA 1BW9B 3QVVA 4JI3M 1E1KA 2QAGC 4NG5A 3CNLA 1LI5A 4FWDA 1ZESA 4ER7A 1Q1ZA 2C2XA 2LP4Y 2J08A 2NXWA 1UKCA 3JQBA 4H7DA 2CSUA 1SPBS 2H1CA 3AR2A 3HM2A 1BVSA 5E1MA 3IDOA 3T34A 4MUFA 4XYEA 1Q0UA 1T5HX 1TCVA 5AVYA 3KDPA 9ATCA 1QFSA 3DFKA 1H23A 4ZKEA 3TLGA 5MN5A 4B32A 3HJAA 4I3FA 2CMDA 2Y0EA 1KVSA 1QKKA 3D1VA 4PO3X 5F2KA 1WV1A 1WZEA 2FH5B 2ZWPA 3CZRA 3I28A 5B3JA 2VQ6A 4WJKB 2O01F 1ETHA 1FDIA 1KXZA 1P18A 3TBHA 4RPLA 2WR8A 4FDUA 6NULA 1KAHA 1SR8A 2OO5C 3F6BX 3NUZA 5FWXA 4YJ2F 4F6LA 3B1VA 4IEIA 1F1BA 1V92A 1MKYA 1Z33A 2Z9BA 4W5WA 1Z4MA 3D8UA 3NETA 4TMWA 5DCLA 5FQOA 5I9MA 4DMFA 4YYZA 1PGQA 2QRPA 2A14A 3A6EA 1B0AA 3DEKA 1AKVA 2ISCA 2I71A 2XKAA 1GZ7A 1GPMA 1CSEE 1ZLYA 2FDXA 3MJEA 1II8A 3OC6A 2FEAA 2JFNA 3P9IA 4IJUA 1WBDA 5C1PA 5JZVA 2GBFA 2H9IA 3I42A 4RHCA 4FONA 5JI2E 4HH4A 3LDUA 3WLQA 1WUJS 3GG2A 2DFNA 2B83A 5FDFA 1HG1A 1PEDA 3BUSA 4D9CA 3NVKI 3GPYA 4MDHA 1KFBB 1JG4A 3R7BA 3FUXA 1SVWA 2WV9A 3GZNA 4C0KA 1PNOA 4W4TA 1ZG3A 3AVOA 4EHLA 3KXIA 1P81A 3WLAA 4ZQIA 5BMVA 2CEAA 1GUZA 1XI2A 3B6IA 3EFOB 4IHQA 4QELA 2Q0XA 1UBTS 1YHYA 5K5EA 3NI2A 3FLBA 1OFHA 2CUKA 2P1ZA 4O4IF 1J25A 3WKBA 3OAAA 4RIHA 4AZ3B 3TI7A 1Y7LA 1ZGHA 4RETA 3KJQA 3QJ5A 1TCBA 4H15A 1V16B 1GITA 5LKAA 1E7YA 1UFZA 1MC5A 1G3UA 1L5QA 4GGMX 1E1DA 3K1AA 1MAVA 4QOSA 4WLEA 3VJKA 5CDGA 1OI2A 2ZANA 4KSBA 3A0UA 4IDEA 3E4DA 3I0ZA 3IUYA 4Q48A 3TKLA 1IJBA 4C4SA 5IBPA 5KIAA 2OO5A 1W8IA 3C5EA 2PQMA 1P8JA 4L8RC 4UAVA 2E82A 2JGEA 1ZMOA 1KDZA 4AP6A 1I4LD 1QSGA 2GAFA 4PPNA 5JRJA 4JLUA 5A4FS 4HRYA 4D43A 1VXRA 2WIAA 4FEYA 4UVDA 5EY5B 2W2LA 3ZC3A 3AHGA 1RE0A 3DE5X 1PKEA 3HADA 1L9KA 3HHYA 1K8YB 1OROA 5MGNA 4FW8A 1KH1A 3E3NA 2X1MA 2BELA 4M9RA 1QFXA 1N32B 4YXWD 3G13A 1G2QA 4RIGA 1XN1A 4XQGA 5IK2D 3HBFA 2R0QC 1QLJA 1VE9A 1XYGA 2ZIVB 4RK1A 1YC2A 1MO5A 3MWKA 2VK8A 3PXDA 4DLZA 4HYQA 4JLBA 1BX3A 4LJ9A 5B3AA 1BE1A 4OIMA 5F12A 1SXHA 2ES4A 1TF7A 2QQEA 1S2MA 4I9NA 5K9ZA 2YWHA 1UP7A 4A0QA 3ECCA 4WESB 4FILA 1KPIA 4Z6KA 2OVFA 3KDAA 1S0UA 1JMKC 1PBTA 1T5OA 1FX0A 2QL9A 4JOBA 5FEMA 1V4BA 3VU9B 2RD2A 5EHGA 3PD1A 4HK4A 4YI3A 1G8AA 2XMGA 4DNXA 4M8NE 4YV1A 4GSYA 3LLUA 3NRJA 4W7HA 3O3NB 5F3WA 1XGKA 1SOMA 4DV7M 1DC8A 2WVHA 1MABB 4L4YA 1Y37A 2V7BA 4WY8A 4YUXA 3B53X 3N7AA 4PYOA 2WVJA 2H52A 2CJFA 3TIGA 1HYHA 1H4QA 3C6MA 3OI7A 2O7VA 4I5DA 4O4LA 3V8BA 1MT3A 2LCQA 5J4VA 3L7BA 1JEYA 4JXJA 4LRTB 2PUEA 4KQ2A 3DNFA 1HTBA 1XAJA 2OY0A 5C7IO 2QY9A 3W6NA 1J70A 4RY8A 2FMKA 3HJSA 1XIVA 4RF4A 4EG1A 5LQRA 1C3LA 1MB3A 2R2AA 1Y4SA 1OTXA 1OW3B 4DA8A 4E5SA 3OIVA 1D7AA 2O59A 3U13A 3OC0A 1TDHA 4E5PA 4R31A 4HUQB 1NVVQ 4ENVA 5JRZA 3V42A 4CR8A 2IA5A 2EYUA 3EYAA 4NAVA 1SGWA 4ARAA 3P2YA 4C0SA 3AR5A 4Y9TA 4DEYA 3QEMB 4Q39A 1TYZA 1UDAA 3FKSA 1A96A 1E9CA 1MIOA 1MU0A 1XOIA 4LJSA 3GWZA 4D8XA 3DT6A 4AYWA 1UBSB 4OHCA 3LUAA 1EUYA 4JITA 3C8MA 4K9LA 2Z8XA 2DLDA 1RFGE 2OUIA 1M33A 2GFIA 2NTNA 4IGAA 4LYAA 1E61A 2LCFA 3W8FA 5HILA 3W5AA 3P9KA 1GTRA 2ZJ5A 4DCTA 1MO2A 4MR9A 1H9AA 3C98A 2WMOB 4CKWA 2RGWA 5IAKA 4R0NA 3WNQA 4ESOA 3VR1A 1U5AA 5CVDA 1G8FA 1JDZA 3IDFA 2HY7A 4NE9A 1ZGBA 3BE8A 4DLLA 5CB4A 2O14A 4OV6B 2NM0A 1DBWA 2PS0A 2QF7A 3K8YA 4OU5A 4G97A 4K9OA 4XSVA 4X85A 4EUFA 2GNAA 1V41E 3NWBA 2WYOA 1OB2A 2IS2A 1SWVA 1R9MA 1DXYA 4F92B 1LPSA 1ZGJA 1D2NA 1ANKA 2PZKA 3AX6A 2BJHA 3B9PA 3GBSA 3HFRA 4MW0A 5FBRB 3RSQA 3C1OA 1U1FA 3DLIA 3GFBA 5EZSA 5EMJA 2J0SA 5ALVA 2YWBA 1JDBC 1UT5A 3V4PB 1Z25A 4CMBA 2Q29A 4AG3A 5ICCA 3L25A 1TGUA 4IV8A 2FR8A 2OFPA 3Q7EA 1INLA 4F3RA 1ZOIA 2PWZA 4NSRA 1VKOA 3TGPA 2I2CA 1P6QA 3EPJA 4PEVA 1ND6A 4KO2S 3FLAA 1I2CA 3DMRA 1JB0F 4LMRA 1LNZA 4V0LA 2HMYB 5ALGA 1PR4A 1S2IA 3CX8A 3KPWA 3ZHQA 4PX5A 4WCDA 2ZUBA 3OA0A 3LH5A 5KEIA 4RGQA 1WW3A 4C20A 3WHKA 4PNPA 4CM9A 4UEJA 1B6GA 3IVCA 3TEMA 2AJ8A 2WFZA 3KEOA 5C53B 1IZ7A 3A9WA 1R5JA 2Q3CA 1E6CA 1R6UA 4TS3A 4WV3A 1A2QA 2Y1DA 1U5BA 4NS4A 4LF7B 2UXCB 2BEKA 1WB9A 2D00A 1NI4A 2YOFA 2ZRPA 1HDOA 2P2LA 1RJFA 2RIPA 5KWVA 4KE9A 1RXVA 3TNFA 1PSWA 1L5LA 3F6RA 5CIYA 4KX5A 1JHYA 3WGNA 3COVA 1NNUC 2CHFA 2ABWA 1WS6A 3AVPA 3DTVD 3R23A 4FT4A 3D64A 3UJNA 4IS3A 4DUGD 1FUYB 4LQLA 4I1YA 4MP3A 1SZPA 2XTNA 1G17A 3DTYA 4HQNA 1IUNA 4OP1A 5JANA 1YIAA 1XTIA 4ALMA 2O8FB 2ZI4A 2OORA 2WJJA 3F8SA 1QK4A 4RK7A 5ADVA 1DEKA 1LPNA 3RC8A 3QK7A 3SSAA 2AEJA 1Q95A 3DL0A 3L4BC 1A76A 3O31A 4PSAA 2PJUA 3RTCA 2ZJ1A 3G5LA 4QXQA 5DI9A 2CHQA 3QHPA 3SAWA 1X80B 3LBIA 4D4HA 1ZAYA 2JFYA 2PQ0A 4AT1A 2HK6A 3OFKA 3HLTA 4TSKA 1G1AA 3AJRA 2QVZX 4Y98A 1XJWA 3UXMA 1MG0A 3OY2A 1TECE 1Z9BA 1DP4A 1CYEA 1JEDA 2WJPA 2ZYGA 3VV3A 4BVHA 3O4VA 5EINA 2JJ8A 3GFGA 3IBSA 2CDCA 2IEGA 2XNKA 3U7RA 1YB5A 3FPSA 3JQ7A 3A1DA 1XDDA 2FE1A 3KCQA 3OT4A 4OHZA 2WT4A 3E58A 2D8MA 5GM1A 4AXXA 1TJ4A 1W46A 4G89A 3RJMA 3TTXA 4EECA 5K6RA 4QEKA 2P4QA 3DCNA 5IULC 3D1LA 3Q7SA 4Y1RB 5LA6A 4EUNA 1JB1A 1L0BA 2KNZA 4Q01A 3DZIA 1NBMD 4XDYA 5AUQA 4I1RA 5BV7A 2XYRA 3ORYA 1R5BA 4ZPXA 2C88A 4XDGA 3M6MD 2M98A 3RGPA 1KZGB 3MFYA 4CQMD 8OHMA 1CB0A 1QYCA 1ACJA 2AX3A 3FI9A 4PAWA 5L95A 1NMZA 3A1WA 3TKAA 4R3NA 1QBGA 1E59A 2V6ZM 1GJRA 4W1SA 1QVZA 3FI0A 3CRRA 5A71A 2RAUA 3KPJA 1H2FA 4M37A 1SBTA 4WMLA 1KOJA 2ATCA 3HXMA 4TV9B 2EERA 3CONA 2QRJA 5DM0A 4D3YA 1RPTA 4W1RA 3G89A 4DHEA 2WSSA 3DQPA 4PLFA 3NS7A 5EQDA 4GPBA 4CDRA 4GSKA 1S7GA 1ULZA 2EZ9A 2FSUA 1BMDA 2I22A 2ZYVX 3L1HA 5FAKA 1GQ2A 3NU1A 1T34A 1Y3CE 4Y6PA 4MLZA 1N6IA 1W4RA 3M4XA 5F52A 2CB0A 2J3KA 3GQ3A 2YFYA 3HHPA 4M76B 4A8TA 2FUEA 1TD1A 2WPDD 3VU3A 2FP3A 2PMKA 3EGEA 5EIXA 1V9SA 4YRAA 4AQ7A 3ZYCA 4UE3S 2YJ3A 4IUCS 4RIEA 3ZK9A 3F4LA 4B6GA 3R6GA 3QUSA 4KLAA 3HKEB 3S2FA 3T7TA 2ZYAA 3GPBA 1NV8A 3T1HM 5MHTA 4QBTA 4KMOA 4ZYVA 3IQDB 2D7EA 1SXIA 2ZWAA 4FOLA 4OG2A 2ZSFA 4RV4A 1PTJC 5BVHA 1Q44A 4QRDA 3RVDA 2Q8NA 4WH0A 4OAOA 1OX4B 3FTPA 3LP6A 2C94A 1R3DA 4LVCA 4F4JA 2B5WA 2XVZA 3NHZA 2DGDA 2ZSEA 3QKSA 1ELOA 2ZVPX 5IHPA 3FMOB 1LLCA 2HBRA 3EBPA 3P9QA 5B4TA 3L0BA 3WGYA 4CG1A 1I1NA 4GKKM 3GLGE 5GMOA 4KQIA 1BJTA 3ICEA 4JZYA 2J3HA 3KUKA 2IZ6A 2Z08A 3GT4A 3I5MA 1K75A 1SRRA 1BS1A 2EZ4A 3DW1X 2H2AA 1QIKA 5LP6C 4TZ6A 2AD5A 1YR3A 4OHPA 1QC5B 3TUJC 2AFIA 1YAHA 3HZOA 4D42A 1KOFA 3DMTC 1NVWQ 1U28A 1WMEA 4LXHA 3I4CA 1U90A 4M88A 4PS1A 4X94A 4X20B 4C2UA 4ZHQF 5LOVA 1XPOA 2ZUTA 3L8EA 2FUCA 2OL4A 3FPCA 3GH3A 5CJ2A 5DHQA 1AKTA 1H1TA 1PT7A 1TMKA 1K2WA 2G76A 3AGPA 2IHJA 1N2ZA 3L41A 4C07A 5A4JA 1VLQA 2PT5A 2FRXA 3DMPA 4Q18A 5HIAA 2HM7A 2RFLA 1DBRA 4B9EA 2E48A 1E2KA 3KQVA 3LDAA 3OECA 4PW0A 1SVNA 2RHRA 3DKKA 4Q4JB 1IY8A 2MHCA 1C7IA 3ZCQA 4RXMA 4KN5A 2ZKIA 1U8UA 2OAQ1 2GZ2A 4BUZA 1GTSA 5DKFA 3OZWA 2CJWA 3HQ4O 3N0VA 1E6WA 1D4AA 1NWHA 3WLEA 1WUTA 3IXQA 1OLXA 1C0EA 4YHHM 3K09C 4JHLA 4MXDA 4ZXPA 3USZA 4GDMA 3SYLA 5EJEA 3AT1A 4WHMA 2XXAB 3NH9A 1EINA 4L07A 4LXIA 4HQ6A 5JNVA 5C1BA 4IXWA 5LKRA 2PLAA 5AWFC 3R7LA 1RM3A 1IHUA 5CFZA 2XD4A 4BMCA 1QGDA 1NVAA 2FPLA 4RYDA 2C5HA 1EQ2A 2EJWA 4OOEA 1UK7A 3TUIC 2V7EA 4RQUA 2JJ2D 4PLCA 3TLBA 5CFOA 4Y2VA 1GEEA 2J3QA 2JB9A 1N34M 1TUIA 2GCIA 5FOWA 1SO8A 5G4LA 3R9KA 3RS7A 3THWB 2XQVA 2W42A 4X8HA 3B6MA 5BWOA 2L6OA 4GL2A 3G02A 5LA6B 2Y66A 1A04A 1KMHB 2FZLA 1VYUA 2D7GA 4NESA 4BRSA 1Y1TA 3W3AD 3EGVA 3W5VA 4AO6A 5JWOA 2OG2A 2GB4A 5KPZA 5B3KA 3MUFA 2CWDA 4RCYA 1EE2A 1X70A 2YS7A 2IHZA 4LKRA 1D4FA 4OUDA 3CWQA 4PLYA 4TL8A 1JPNA 1RZUA 2GM5A 2X42A 4RJJA 1BVYF 1VYTA 1Z8DA 1T8YA 3I9OA 1TYBE 1N5OX 3HNOA 3S2GA 4ML3A 5F21A 2LH0A 4GLBA 4RSGA 3U37A 2NV0A 2XH9A 3AOEC 1J5EM 2OCYC 2VHZA 4I36A 5DVZA 1AK9A 3S5JA 1T0HB 1JLRA 4M0EA 3VDXA 1FUKA 4IR7A 4OU4A 1H3NA 4Q24A 4IHJB 5EMKA 621PA 1Z6QA 4KPYA 3RJ5A 5LMCA 3FW1A 5IFKA 2VQFB 2G1KA 4C43A 5AD1A 1CTQA 2EHJA 3IELA 3WGVA 4QJIA 5F9FA 1EBFA 2WDZA 5D3KA 1G8MA 5C1OA 1HR0B 3CT6A 2A1TS 1UKBA 3SOZA 3SG0A 2D1RA 1PFKA 4PSDA 4W6QA 3KOUA 3LWBA 4OGKA 4RLSA 2IH2A 1L4UA 4AJIA 2KLBA 1ISPA 4Q4LA 1MAAA 2VP9A 4UUAA 2IOQA 4MCJA 2C59A 1R6AA 1JGTA 2CDAA 2BE7A 3ANYB 2ETVA 4KWEA 3D7NA 4W7IA 5DULA 3QA9A 2D5CA 3I6ZA 2WUFA 3WISA 1N2HA 3EOZA 1OYOA 1OFUX 1S4QA 4E0BA 2X8JB 1AKWA 1LDYA 1OU4A 2JBWA 1E4YA 1JTVA 2MR6A 3CY6A 1OH7A 3RFTA 4BVFA 1ZC3A 1WUYA 3HXKA 3QVMA 4KAAA 5BN4A 3TTVA 3EDYA 1EFPA 1QHIA 4CW7A 4AX8A 4UTVA 4Z4FA 3VDMA 4XGRA 4W99A 4RTNA 1OAOA 3EDCA 3W5CA 5K8TA 4HZIA 1CJKC 3CN9A 2HHCA 4DRXA 1CERA 1CX9B 3D4BA 4BB6A 3CRVA 3CKKA 4FMCB 3ORRA 5AHXA 3X44A 2HXGA 1CF2O 4IIGA 2J4FA 4TRNA 3KQLA 2QRHA 1OI4A 4G4JA 2R00A 1XZCA 3W05A 3OY7A 3QENA 5IYZA 1ADJA 5K8JB 5K4HA 1CVLA 4EGSA 2W82A 2B1GA 3L6EA 2ENUA 3T41A 5AM3A 1X1TA 3CMCO 3DA8A 2HPAA 3P5SA 4I4IA 4NH0A 4EMUA 3MQ2A 2RAVA 3G0GA 1AUXA 3TSCA 4MWCA 3JD4A 3ABRB 1BRMA 5FL7D 1ZBDA 1JQBA 4X41A 3SJ7A 1E77A 1T36A 2CL6X 4QPPA 4BQQA 3G1WA 3WQBA 3ZX4A 3U6OA 1COZA 2NTJA 3DE2X 3QVOA 4FHEA 3LLSA 1CZKA 5KAMA 4HXGA 4D57A 5A5GA 3HP4A 5HF5A 2VDQB 3GHHA 3LT4A 4M0KA 1EDZA 5F98A 3H1AA 1Z5OA 1QH1B 3QKRB 4HX2A 4MUKA 3OT5A 3IR6A 1QIFA 1UDRA 4NK5A 4PG6A 4EH1A 4F5EA 3HEBA 5FFFA 5IH3A 2VQEM 3G6KA 5EZYF 4UBIA 2ZRGA 3ETDA 3N75A 5DISB 5BUZA 3EISA 2LDXA 2YVAA 1AQJA 3FRIA 3WWEA 3AF5A 2JGFA 2GSWA 1DC5A 2GBLC 1ZM9A 3B7NA 2VF4X 2BSAA 2QTCA 5DHSA 2P7IA 2DHRA 2RHDA 3RE8A 1X1RA 1LPPA 3ZDXB 2HTEA 3LQKA 1QE0A 4MQLA 3KOZE 5BUCA 4RPHA 1TVKB 1IH8A 1PT9A 2VSNA 2XRFA 4YXFA 3OHPA 5KNBD 4OFXA 1ULBA 1JAXA 3DUWA 4QOZC 3L18A 2I6QA 3RGSA 4R2XA 4HVTA 5FBWB 4ILKA 2CHGA 1ZISA 3IVAA 3LTEA 2CV1A 1FYXA 4Q4JA 4LFCB 4DXDA 1N1MA 4LXQA 4OHWA 2BGGA 1PJ2A 4J0IA 5JZ9A 4V0OA 3NAQA 4OGFA 2R6R1 3K15A 4EG8A 3G2MA 2JVIA 2DFTA 2BW0A 1YJXA 3U6QA 3UYLA 4HQKA 4F1JA 4YUYA 3KJNA 1ATIA 2FCAA 3NCHA 4G0QA 1BA3A 4HDSB 4IUDS 4IICA 4BBJA 3PNQA 2F64A 1OBHA 2O7NA 3F1LA 1QUFA 3PDIA 2JD1A 3JARA 3AY6A 3L7OA 3O4RA 1FP4B 4RD1A 3TCNA 1W59A 3QA3E 4NEGA 4S24A 2NADA 3EIHA 2SKCA 1BWQA 3R44A 4M38A 1JQAA 5ITYA 4DB2A 3MFQA 4QBFA 4PR0A 4UM7A 3VYSB 5DLDA 2AMFA 2O2XA 3C4JA 1M3SA 2ZJOA 1PL0A 4OKNA 4ZOQI 1WE2A 1F0YA 3CLKA 3EDQA 1U1IA 1ONNA 1UK6A 5E38A 4IL5A 4Q3KA 2I4NA 4IG4A 3VBCA 3WYNA 1Q11A 1VLVA 5IARA 1U80A 5CLFA 5HSGA 1PG0A 2JARA 2EJCA 4S0ZA 1OZFA 2RJNA 5A3QA 1IVSA 3H16A 2CKMA 2Z83A 5J5AA 2JFWA 2VOJA 2OHOA 5C34B 4RVSA 2D7DA 3ZV3A 2Z2ZA 4O5AA 1DV2A 2Y27A 2ZUDA 1DWUA 3OZGA 1C3VA 2AQHA 3K0EA 1GLNA 4C4RA 3ZXXA 1A9XB 1CLUA 2N3ZA 4Y9UA 1U4OA 4XB1A 5JDIC 4JENA 1F3OA 1LSOA 2CNWD 3O3OB 3BH6A 2AL7A 1K6JA 5JMOA 2PIDA 1G21B 5TS2A 2CZGA 3B78A 1V3TA 2HMVA 3DC7A 2GFHA 3B8HA 1OU0A 3FYUA 3QQ5A 1CY0A 2HJ9A 1T1IA 2PDAA 1SBHA 3OT1A 3NASA 5ESXA 1MG5A 1C14A 2OPBA 2BH9A 1N6HA 1I9CA 3ETNA 3LC0A 1GYRA 3UC5A 3WI7A 1UMKA 1QGED 3Q8LA 3DEHA 2WQ7A 3PEFA 4YN3A 2FG6C 5LLSA 3WMXA 3GW8A 4ENWA 5CLJA 5IKEA 2WIKA 3AEQA 3M6VA 1VRCA 4OF4A 4RLHA 4FYPA 3OIWA 4XWWA 1N3BA 1Z22A 4EF4A 1Y4UA 4AJPA 2ADOA 4FZ3A 4P84A 5FTWA 1Y4ZA 3AY7A 3PFKA 5IKOA 2G5TA 3DCYA 5TMEA 5REQB 5HX7A 5DNCA 3QEBZ 4B40A 2OBLA 3TQQA 4M55A 1KZHA 4PBTA 4PHCA 1X2BA 4JBWA 1QMGA 3C5VA 3QIAA 4TMTA 3WYAA 1SUAA 1UM9B 4M7RA 1P3DA 2BUBA 4LZPA 3B1YA 1FXUA 1YQWA 4GKAA 3WK5A 3K1TA 3IKJA 4L51A 3DO5A 5A9SA 4U8HA 3LGXA 2CJYA 3GGJA 4TYPA 1ES9A 5GP1A 1P72A 1BDIA 3E03A 4XEUA 2WPNA 4RJIA 1SBYA 1KVQA 1VLHA 1Q21A 3L4SO 4P32A 1NBMA 1MBZA 3GI1A 4MITA 4Q7LA 3K09A 3MNFA 4X84A 3P9ZA 4PAGA 1I4TD 4ECEA 1WJ7A 5DP1A 1AGXA 1P75A 1ZXXA 4G5YA 2NUTB 4OY3A 2AI2A 2EP7A 4G37A 3BRQA 3CZ4A 3KR1A 2EFDB 2PH3A 2NZVG 3HLYA 4PC7A 4CODB 1QZ3A 2POCA 1JLLB 2GRAA 2P40A 4MUYA 1X42A 3S6JA 4XXHA 2RHLA 1E98A 1LFDB 2IKSA 2OXFA 4AG6A 2VDMB 3BF8A 5A6VA 3W67A 3DLPX 4LF6B 1V1RA 1T2VA 1QPBA 5CTAA 3ZDFA 4M1KA 5EIEA 3ZDEA 2EO2A 1U5BB 1ZQ9A 2UZ1B 2VA8A 3ZWOA 4DC0A 1ODFA 3FPJA 3KOWE 4IGEA 3BMQA 2NX2A 5IVKA 3K1YA 2AR7A 1AUVA 2J5QA 3PGMA 4NFHA 1Q1BA 3SHQA 4UTRA 3U39A 1QXSA 2C5EA 1X74A 2C2KA 1T25A 2XB8A 3B60A 3OKCA 1HDZA 4CUKA 3MYYA 4JA2A 4QJ5A 2QB5A 4ZEVA 1DMRA 3CX7A 1VI5A 3AETB 2ODAA 4GP9A 2VTEA 4RKQA 1BJRE 1YZVA 1J07A 2ZRHA 2K4MA 3FPHA 1ODJA 1J20A 2ECKA 4OLHA 4BJ5A 1OQAA 3CH5A 5EKXA 4YRMA 4HNTA 2QTZA 2XGNA 2X5JO 3IAEA 4GMXA 4L72A 2NVOA 1B74A 1R74A 1L5SA 2GPNA 3PZRA 4J9VA 4YC7A 1NVXQ 3R9IA 2XTZA 2DZLA 1RAFA 4N12A 2YN2A 3CNQS 1GG8A 3HN2A 4RABA 4UUOA 2YJ4A 1B15A 2KBEA 5HS6A 3ADBA 4HC4A 4O0LA 1Z73A 2Z56A 3C3AA 4CM8A 1Z2CA 5IRCD 5C8YA 1BWPA 3KEMA 4DMMA 3CCCA 1NXWA 1D4OA 1H2YA 1K3TA 3OE7D 2FZ5A 2I76A 3CUYA 4F46A 3TOZA 1OB5A 4R8RA 4X24A 2R1TA 2PX6A 4DCNA 5BYKA 5ECGC 4Y1GA 2H2GA 4A5OA 2HADA 2J3IA 1XZNA 1SXJB 1OAIA 2HRZA 3J81S 1PYOA 1Z34A 4OLBA 1HDIA 1Z88A 3H9QA 3QBJA 5SYMA 4WN9B 3RANA 5LOVF 1EVZA 1MJNA 1BMQA 4EJ2A 2H18A 1Z2OX 3C3KA 1NSYA 4X61A 1G21A 1T0JB 4GI1A 2GCOA 4IIBA 5F5LA 1UOQA 1RWMA 4J7UA 1KORA 2IY7A 1DBVO 4HMPA 5FO1A 2C4UA 1XCBA 3L6RA 4DBZA 4BUJA 5ABPA 4PLWA 5JECA 4HMOA 2YN4A 4MRAA 1RKBA 2ORWA 2G4VA 1OAOC 2WHPB 1FUIA 1PS9A 1V3UA 1Y7TA 5AJVB 7REQB 5EIBD 4BNWA 2E4VA 3UCXA 4ZAFA 4J0KA 1YZ3A 2V9CA 2XIJA 1P7YA 2GJSA 3RUDA 3SMQA 2NZYA 1OWMA 1RQ7A 2CE7A 2H0AA 1G6Q1 3CB4A 4L22A 1EJBA 4BTEA 2OFWA 2C9CA 4LY9A 3KALA 2DR2A 2ZAGA 2M60A 1BQ4A 1BAPA 2PAAA 3FZEA 2EOAA 1ECJA 3AV0B 1AURA 1EWVA 3AHCA 1J7JA 3LFHA 5J2TA 1M75A 3VKUA 2IPXA 2VL7A 4HAIA 2OCGA 2CUNA 3STTA 4HMQA 1WD5A 1JYEA 1CG6A 2QY6A 3KQQA 1G19A 3LW8A 3QVLA 4DV4B 4XPIA 2L19A 4H3SA 1ESNA 4UVGA 1CY4A 3FHLA 4UAUA 1OLXB 1II0A 3QVSA 1UXIA 5CVTA 2JGMA 1SCUA 3PNSA 4O1HA 2J3EA 3MK6A 4RTMA 2VJAA 3RVNA 2QHOB 2VJQA 3E8XA 2EP8A 4HL4A 5AJUA 5J3JA 2BMJA 4HYYA 3QYEA 1WV0A 1MJGA 4P3PA 3L93A 4BNYA 1OVMA 1SUWA 2MSLA 2H2HA 4PQFA 4A73A 4BLQA 1M8JA 3IP1A 1NVMA 2WSLA 5AVJA 1NHGA 4C87A 1XD2B 5JROA 1J2UA 2O3TA 2C2GA 3KC2A 5IREB 4IWYA 4RGYA 3T7RA 1TA4A 4BQIA 2XH8A 3WIVA 3I9FA 2PSEA 4DV5M 3VYUB 2IQIA 3F8TA 5JXGA 2HJHA 2VG8A 2G28A 3DKIA 3TZ6A 4UUBA 5C7YA 4JJEA 4DR3B 3I53A 4Q66C 4ESHA 2UVDA 1CP2A 1UUFA 3LNCA 3R24A 4LJKA 3KZOA 4K1XA 4RMJA 1I5OA 2FLWA 3C14C 2DNAA 3P0FA 3GLHB 3EZYA 1N7JA 2VF8A 1QYIA 3SY8A 1ZCBA 1UJ2A 2I2BA 1PDWA 2OFXA 2YY5A 1JAIA 2J8ZA 3KZMA 5TV2A 3FF4A 3RYHA 4UM9B 2ZR8A 2QCUA 4FKBA 2REQA 1VL1A 1YKSA 2B99A 4DUZM 3BH0A 3A6ZA 4W5QA 5ED4A 3QWHA 1H4SA 3ASYA 3QFRA 3PKIA 1YUBA 4F5DA 1H9CA 1JFRA 3ML1A 1RYDA 3IP3A 1EP1B 1ZINA 4LHYA 1FRZA 1L7AA 4NCKA 4AS3A 5LJLA 2XUFA 2XCLA 1FQOA 4BE7B 1U2GC 4TLBA 3AKCA 4HADA 1KI7A 5G0UA 2O2YA 3I01A 3L07A 4LRUA 4PE5B 4QO7A 3VR5A 1HT2E 2QNJA 2HF8A 4GG1A 5EPUA 2Y1XA 1FQKA 3U6DA 1OJ7A 3L6UA 2JASA 3D8HA 2C77A 3MJHA 5FOSA 1EXDA 3G5UA 4UE2A 4ZVUA 2ZGVA 5D01A 2B7LA 1HMYA 5CW2A 5FOTA 1W36B 1KJJA 5AXBA 4JOSA 2HTFA 5EJMA 3SKVA 1ZD1A 2FK7A 1T5LA 1ORTA 4M8KA 2B5VA 4BX9A 1YVEI 2I1LA 3DMGA 2MWMA 3DR3A 5HF8A 4MH0E 4BRZA 1KTVA 4ND7A 3P4YA 4MWBA 3TTTA 1QHXA 1GR1A 1GSIA 2YMLA 2P5TB 3E9SA 5HP4A 4MQ6A 4UD6A 3GA5A 2P30A 3FNRA 3P0HA 1OIVA 3OPYB 2RAFA 2P75A 1K89A 1QMPA 3RPEA 2Z5FA 4BGUA 1F12A 2FA9A 3VX3A 1SKMA 5CG1A 1UP6A 3TGWA 3CNOA 5DNUA 3UHOA 2H00A 2F17A 5EFZA 3BMCB 1C7ZA 4Y0AA 4M2LA 4RZ2A 3T12A 2FWNA 3JAKA 4DQUA 3H2BA 1AS0A 5LQUA 4HX5A 1XZBA 2CXRA 4Y6QA 5HTKA 3HJRA 3TLMA 1WABA 3JYNA 1PFWA 3KQOA 4TOIA 3WL5A 3HMQA 3C8DA 2NUPA 3WIEA 3HXOA 2O5CA 5CEEA 1THTA 3F97A 2QPOA 4W9MC 1OV4A 1L4LA 1DJLA 2FF5A 4IBBA 4J1TA 4OQEA 4EUEA 3GAMA 2B1QA 2PSDA 1KNXA 2CYAA 2DH6A 2WMYA 3ZVKA 1LD3A 3SHTA 1FVXA 2UVPB 4H7KA 2CMKA 4KK4A 2GI4A 1WZNA 2WYUA 3IUPA 3B7ZA 1M8FA 5KJ6A 3EXFA 4MVJD 4X3CA 5DEOA 1KJZA 2V6BA 1I32A 2W4IA 4XFDA 2JEYA 3AU9A 1JWAB 4ZT5A 1CULC 1E3MA 4BKRA 1L5MA 2EFGA 1E5TA 1QCZA 3EXHB 4EJFA 5HZHA 2XRZA 3D0KA 5HM6A 5BNZA 1OI7A 2I5PO 2O23A 4Y7CA 1P4JA 3A9SA 5A4IS 2XCSB 2ZR0A 1KMNA 4MTCA 3RSGA 3KJXA 4RD0A 2ODNA 4NRDA 1FRQA 1DZIA 3DV9A 5BRAA 3KP1E 1ZOLA 3HUTA 3G2LA 4RZHA 4WLFA 1QLWA 1VE6A 5HIMA 3B48A 2SBTA 5FBVB 4JELA 1WG8A 2YNMA 2JFZA 4QBHA 2O8NA 1JWBB 5E9QA 2ZREA 1UH5A 1NG9A 4RTKA 2C5GA 2ILVA 3TSYA 2C2MA 2OQIA 4XR9A 2R25B 4D8VA 3QRWA 5G4KB 1KDVA 3CKLA 3DV0B 2BGLA 4CF3A 4GRDA 1GRVA 3DDWA 3RNLA 1PEYA 2MYTA 4WKGA 1GGJA 3JVIA 2EATA 3EY9A 2YDYA 1HYGA 4LOJA 1GTMA 3AI7A 4OHFA 4DILA 4KXVA 4EENA 3ZXYA 3TGLA 4P22A 4BFWA 1A4XA 1THZA 1RJWA 2V1XA 3RQSA 4CN9A 4PGHA 3RVPA 4Z7OB 3CUKA 5DSXA 2J0VA 2G8LA 3AZPA 3C43A 1QZXA 3HK2A 2HNAA 4EYGA 3H9EO 3IG8A 4IQFA 4L6CA 4HPWA 2OXTA 5F9MA 3N7TA 3WSWA 1KY3A 5JAMA 1QDTA 1N0UA 2QZPA 3IEIA 4DLWA 4INPA 2M9MA 1JTEA 1XQ6A 3GJYA 1ZHFA 2RBEA 2TMGA 3L3BA 3QELA 4CRWB 5JNUA 4A8JC 5J23A 4EHDA 4KR2A 3QXJA 1RQRA 2DF8A 3AHJA 5H3HA 3UCEA 3KKEA 2MU1A 2AJBA 1VJ0A 3QBEA 2A5FA 2E5LM 3D2LA 3ZW7A 1KQFA 2KPOA 4KRYA 1GZ5A 2OQ2A 1V47A 3RRBA 4C3UA 1C7QA 3PPWA 4P16A 1PDOA 2QT1A 1V6CA 3QSYA 3UWMA 5E3JA 4YP1A 3NHYA 1Z5BA 4AWBA 2BKLA 1K8XB 4UM9D 1QFJA 2P9GA 1AQ6A 1IC6A 4JWTA 3DA1A 4FW9A 1FX0B 3VU9A 1FDVA 4TKUA 2CWBA 3WQRA 2CV2A 2VJMA 3R4VA 4EZBA 1I94B 3HCPA 2CZQA 1L4GA 4KTVE 4UHJA 3D3WA 4CU5A 1I0ZA 1UBOS 3O94A 4L1KA 4TLMB 3A4VA 2VHEA 1DX6A 1M6HA 3MTIA 4MV8A 4UFPA 3BKWA 4ZU3A 2K6GA 2FEMA 2R7KA 1PZEA 4C08A 5ANRB 4DYHA 4JKYA 1CUYA 1GZUA 2OD7A 5BR1A 3N8GA 2XOEA 2Q6TA 4RQBA 2C54A 4HZGA 5B1EA 1A9TA 3RS9A 1A9PA 1M5TA 1K7YA 2VT7A 1ZU4A 2X40A 3F9RA 2JFGA 2PHZA 3W9YA 4ZGGA 4F3YA 4G6ZA 2L09A 1X7DA 2FX3A 1GLVA 1FSGA 4FGKA 3JCZA 3MVEA 1Y9JA 1NXPA 2O0MA 2X3UA 4EITA 5B7QA 2XYPA 5EEHA 1WIVA 1YAJA 3C7CB 4HX9A 2IE8A 1GSHA 3AVQA 3DTVB 4TM8A 4JI5B 3ZW8A 3G88A 5HRAA 5BNFA 2PXCA 4C2TA 1ZUNB 4HR7A 2PJDA 2TMKA 4A26A 2H48A 1RAEA 4GWKA 3DHWC 4HDMA 4YCDA 3UHFA 2AWNA 3SQOA 1X13A 3UZUA 3WK6A 2J7KA 2CC2A 3D0QA 5CMLA 3H6HA 1W73A 3L0CA 5AUNB 3GEMA 5KSPA 4G09A 5J5CA 2BJVA 1RDFA 1NT4A 2VIIA 3K94A 3MIZA 1VG8A 5F76A 3VPSA 3VPDA 3ZGVA 2YHBA 1A97A 4I5EA 1LGYA 1X9IA 4O4IA 1UWVA 2IELA 4KR7A 4DV7B 4AB1A 3SC2B 1PUJA 2Y99A 3KSZO 3P27A 4I2NA 5CT9A 3E27A 2WWGA 4Z1MA 1M6NA 2XT0A 4ECAA 3LM8A 1NNJA 2GZSA 4D5EA 3BXPA 4ZVQA 1JHQA 4DVGA 2DR3A 3VDPA 1SC9A 4NATA 5D8DA 3KQSA 2P9BA 2C5AA 1XL1A 2YY6A 2ZQZA 1B6TA 3HG7A 4OB7A 2BHNA 4LRYA 4FSHA 2OAGA 3IIIA 3K6JA 3RRFA 2O8CB 1EFHA 1ZD2P 1D09A 1C4WA 3RARA 3WE7A 5KYNA 4TQAA 3GLGA 1PG2A 4CEHA 4GEWA 1DGFA 2PSFA 4RD4A 5ELXA 1DO2A 4XQCA 3RVKA 3ZNNA 1BDMA 1JIIA 3SXUB 1WY7A 4JJIA 1JPUA 1Q1GA 3TAHA 1SXJD 1BD3A 1NBEA 2A78A 1ZGAA 5CB0A 3BMNA 5G40A 1WLSA 4IVQA 4B3XA 4H27A 2XF2A 1C30A 3CLUC 1BWRA 4JAVC 4R54A 4BQRA 4AF6A 5HYVA 4DMGA 1G8HA 4L50A 1L7VC 4ND1A 5AW3A 1SU8A 4QLBA 3R0JA 3DYBA 4WNCA 4YCBA 3B6EA 1GZ4A 2QSZA 2QVBA 2C9MA 1U1GA 2HBQA 2R60A 1YZKA 2OCXA 2V6IA 3CZCA 4ZCQA 3LRPA 5HJ2A 3ESAA 2JBHA 3OZDA 4RWEA 5DT2A 3RHTA 2ET6A 4LNUA 2BFEA 2EVWX 4KBGA 1RM0A 2P78A 4EY6A 1SKUA 3OUUA 3COYA 3DWFA 2VK2A 3K1AB 4HNAA 4IJKA 4L3VA 4TXNA 3FVWA 3TS1A 2B8NA 1ZAEA 2EKLA 4DDHA 5LP6B 2C00A 3P19A 2ZT7A 3TOVA 3SDBA 3QPCA 4CE6A 2CLKB 3U3OA 1G3RA 2ZBUA 1QVVA 3MG9A 3DXFA 3ZK8A 1E5XA 4RHUA 3PFFA 1SEPA 4JFAA 3PKZA 1FU8A 4BP3A 5KNDD 4FYKA 3NCTA 2B2XA 2WJHA 3QOWA 1PFGA 4MGHA 1MQ9A 4WY2A 1GQFA 3B82A 4ZN6A 1EXNA 3EQ6A 1OI3A 4UHHA 3RADC 1DQNA 5LQSA 1BHQ1 3GJZA 1G4UR 1NPYA 1YVUA 4TKUB 5IXSA 2VYVA 4MIEA 4A0GA 2ETXA 4BLOA 4O4HB 2J4CA 2P5UA 1YMUA 2Q3JA 1UK9A 3NT5A 2W6NA 1E94E 2O3SA 3C5WP 4L9RA 1L5ZA 4MA4A 4X6YA 3V5NA 1KDOA 3WKCA 2AOVA 1PNTA 4OUKX 3HO8A 1KS2A 4DCPA 3L82B 3THSA 4DLNA 4TKLA 2L7HA 2XMBA 1U3DA 5T41A 3ROKA 4XGNA 4GYWA 1AC5A 1Z8FA 4PG5A 1F2VA 3NFYA 3O91A 1KI2A 2XNDA 1IXSA 3B85A 4CNBA 5HQTA 2R18A 3H2SA 1XMVA 1MT0A 4AMGA 2P68A 1JT2A 1OFUA 2ZR9A 1J90A 4IXDA 5G53C 1KMIY 2XCIA 3SQNA 2Y4NA 2QL5A 1NIPA 3QELB 5HCIA 4MQ4A 2G7MC 3DEZA 2I4OA 4NICA 4TX1A 2B34A 2IUUA 2YVLA 4MB7A 2GERA 2WK1A 1EWYA 1KSGA 2O2HA 3DZ8A 4OA8A 4EMTA 1A50B 4B6EA 4GOOD 4HRAA 2QN6A 2VXYA 2FWAA 4H4CA 2X0JA 3RYIA 2VPWA 2Z5VA 3ZDZB 4JUAA 2WJ6A 4LS3A 2I7VA 4U6NA 5EL0A 3W77A 3U80A 4BMPB 4FMDF 1AO0A 4RV5A 3UGJA 4UBNA 4NOOB 2QTLA 3CU5A 1KDYA 2QMUA 2CUZA 3FH0A 3GFRA 4LYGA 5FHRA 1FXSA 3O84A 1TVMA 4OBXA 2CLHB 3NRCA 2ODEA 1QZEA 2XZTA 3D6AA 3GCGA 4NXNM 2JNHA 1OXXK 3D3EA 3IT2A 2JI6A 4NLLA 4ZEWA 1U98A 5K0JA 3K0CA 2W2NA 2O07A 4E13A 5DI3B 2AA3A 5DN6A 1O5TA 1IEQA 3WKAA 1NHWC 1XMOM 1G6OA 1NSFA 3E4CA 1TNDA 1C3JA 1YNSA 1GR0A 1DJOA 3PFNA 1ECBA 4XPZA 5GV7A 3AFOA 3IP5A 2F8TA 1KJIA 1Z4IA 3OTOB 3ROFA 3S44A 1WUIS 4EFNA 4ZJYA 3RRXA 1Z6PA 5KQDA 3F6CA 1XXHB 3A6FA 3PFCA 3R5FA 4GZ5A 4O63O 5D5HA 5AK6A 3RS0A 1JKIA 3DFMA 5HGXA 1YCFA 2Q5CA 3F6EX 4EKIA 1G66A 2AT1A 1QPGA 2PPLA 2PGNA 3FTQA 1EK2A 3UBTA 2EJSA 1Y6ZA 2BGJA 4PS0A 2D0IA 2FN4A 4E32A 2Y0BA 1M0WA 4K6HA 3KT6A 4RW0A 3KQHA 1DCKA 4GGOA 5DGDA 4AY5A 1T3TA 2R7NA 4J29A 1K9VF 3EEIA 5SZHB 3AEUA 1JR2A 1KEEB 4PG8A 4KJXA 3NJRA 4IGFA 4QEZA 2YBDA 5JC1A 3QUCA 1HDEA 2A0XA 2DFPA 4B85A 4DN6A 1PS8A 4G2TA 2RHHA 2GCOB 1XJQA 2IPLA 2XZFA 1M8KA 2QXUA 2R6DA 5FLKA 4JVLA 4CLXA 1BDHA 3GRVA 3KQNA 1P4SA 2QZ9A 4XB2A 3B3FA 2H1IA 2LXNA 3DUFA 1UJ6A 3ZLJA 4MCAA 3DBVO 3O8DA 5ENVA 4ZV7A 3U7EB 4B6QA 4L0DA 5LN1A 4KQFA 4FYIA 1EK0A 3W0LB 2GCPA 2OPHA 3SCZA 3H19A 3L29A 1DG9A 3KQPA 2AQIA 4HLUA 5U4QA 2GQ0A 3V2IA 2HA3A 3EVEA 2RG1A 4WZBB 1VCHA 4Y2HA 1KA9H 1RYNA 2P0AA 4QVGA 4J03A 1TF0B 1U8FO 1FLDA 3I5UA 1NY5A 3CTPA 1LBQA 4ZD6A 3Q11A 3OTOM 1FTQA 2J6HA 2LV8A 3FDZA 3OD5A 4MW1A 3LX4A 4P4TA 4QQ8A 1UZLA 3QBDA 5BOSB 4RZXA 3PEUA 4M4SA 1YE8A 1DS6A 1T2NA 2EKBA 4WXHA 4OB8A 5FKJA 3TRIA 4BC0A 1L8XA 1JSRA 2FOIA 4L85A 3TNYA 1FLNA 4PLPA 1HFWA 4V1CI 2CT8A 1QH1A 1WXDA 4IDAA 3R5HA 2HBZA 4QDZA 5CA1F 5DNVA 1QO9A 4YCCA 2FVXA 1KRXA 4ZAXA 3VSDA 3M5DA 3S5UA 1W4LA 1FJ2A 2QKYA 3GMSA 3SR4A 3OCYA 4EB0A 3SK0A 4BNJA 3L7JA 4U7PB 2QUHA 2R1ZA 1K8RA 2OTCA 1H05A 3GLFE 2A92A 4FBGA 3ZHUA 3K2QA 3ME5A 4D9BA 1CWUA 1RABA 4BO7A 8LDHA 4I55F 1WZCA 2WF6A 3KS4A 4JOCA 1JR3D 2B21A 1VPLA 4O4LF 4DA0A 3HKBA 3E9DA 4OQLA 3WGLA 4DLBA 2XYHA 3JWPA 5D85A 1DTWA 3ETCA 4J2HA 3C3EA 5IXYA 4KOEC 3TQIA 3PE3A 5JAPA 4F8YA 1NDUA 3ZZNA 1JAYA 1T3LA 2ACWA 721PA 2OP1A 2NO6A 5J40A 1YT5A 3S2UA 4KITB 2R7LA 3K5HA 2XIQA 4TWJA 4ZVNA 2YXBA 3CYFA 3T06B 4BIIA 1R3UA 3IEMA 3GJ7A 4MUBA 1C7RA 5ITQA 1NDQA 1U7PA 2ZYRA 3F5FA 3HXPA 2B6NA 3M2PA 4WBNB 2CXTA 4HDNA 2GK7A 2PGIA 2QRVA 1KOGA 5KDLA 1WOMA 4G9BA 1Y81A 4M1MA 4B3JA 2ORYA 3S68A 2GM4A 4CM3A 5A4AA 2BFWA 1TRKA 3MAAC 4DXHA 2PRKA 1AF7A 2RGCA 1A1SA 4RHTA 3TPCA 2RMKA 1T29A 2W6CX 3MK31 4Y2JA 2IH5A 1AKQA 2AQ8A 5IAJA 1XDSA 3I9LA 4JUFA 1I6LA 3CQ9A 3OQIB 1MABA 5D3ZA 3GLFB 3DTTA 4U5QA 3ZOKA 2DG2A 3JZAA 3MZ0A 5IMBA 2AZXA 3SYNA 5K3AA 1ZJJA 3OLCX 4U7JA 4Z9XA 1BCSB 4RAOA 4FB5A 4K8OA 5C0OE 1ZDMA 3OE5A 4PAMA 4F71A 3DE0X 3ZXUB 1DRJA 3K6RA 1OJLA 3TOSA 1YZFA 3MMXA 2DSNA 3NHLA 2QUKA 4KREA 2V58A 4IYRA 4OW0A 1ZOSA 5DTRA 2AXQA 1E8MA 2I8LA 1Q3CA 3DZDA 1QHNA 4BNVA 5K6TA 4B09A 2QTMA 1WTAA 1IQRA 1QKJA 3ENQA 4X1KB 3TXXA 2BRUA 4ZHQA 1Q0SA 5HUQA 2OZLB 2XRYA 1FUEA 2WE7A 3GT3A 3OPYA 2JBAB 2FPRA 2XMZA 4PTYA 1HE3A 5GVRA 4BUCA 1YIOA 3ZJTA 2EG9A 5HFJA 2ID4A 2H2FA 3HY6A 4FX2A 1XA4A 4TKMA 1XTQA 3FPKA 2GUWA 2P2SA 3MWLA 2OO9A 1XHEA 1C5KA 1QH8B 2P8SA 4FGZA 4F9TA 4QBGB 2FEWB 1CFJA 1NJ8A 4KE8A 3QPDA 4O2BA 3WSVA 4DIBA 3MUEA 2G1PA 3NBFA 2BCGY 3QEMA 1Z06A 4W5HA 3ZUPA 4EB8A 2BGMA 3ILVA 4MGKE 1ONBA 3AR8A 2HHHB 3HDYA 2I91A 1O97D 4D3DA 4YUWA 4ZQGA 4MV6A 5T3YA 4EG5A 2CLCX 1HC7A 3PHBE 4KQ6A 4RF3A 2JFQA 2FR8C 4QGFA 4ZHSA 4FFPA 4PPQA 3GBPA 4M0UA 4C7OA 2WF8A 3PFIA 1RRMA 3E84A 1JVNA 4L4SA 4O4JB 4ZKDA 3W2IA 3OJCA 4GX0A 1QRRA 1NN0A 1PSDA 2HIAA 1GNPA 2EFJA 1P6XA 1U04A 4KIJA 2FDCA 1ZHHA 1I2ZA 3GGCA 5BSFA 1NW8A 4G5FA 1H2EA 2ZTDA 1BE8A 1W96A 3OKPA 1T8WA 3A6HA 4GE0A 4RO0A 4TZ0A 2AOWA 1M1ZA 3LT2A 4EKYA 3EX7C 1TD9A 1ACLA 1KP2A 3JTEA 2EX4A 2VTBA 3GFTA 3D8BA 3GL9A 2VNKA 3L8ZA 3RYHB 3GN2A 2CVQA 1R0SA 4A2PA 5ITZA 1L8LA 1JG6A 3L5KA 1AO3A 4NBLA 5LUBA 2W0SA 4BYGA 1ZWLA 3ND6A 3U9SA 2W00A 5ALHA 1FUUA 2G9NA 1PLLA 1R18A 3TQSA 4LWOA 4Q6BA 4BP1A 2DWQA 1Q3BA 3W04A 4NPHA 1NLYA