1SGPI

Ala 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
51
structure length
51
Chain Sequence
VDCSEYPKPACTAEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STREPTOMYCES GRISEUS PROTEINASE B
publication title Water molecules participate in proteinase-inhibitor interactions: crystal structures of Leu18, Ala18, and Gly18 variants of turkey ovomucoid inhibitor third domain complexed with Streptomyces griseus proteinase B.
pubmed rcsb
source organism Streptomyces griseus
molecule tags Complex (serine protease/inhibitor)
total genus 12
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 1995-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1sgpI00
1CGII 2KMOA 2NU1I 1TIHA 2M5XA 1OVOA 2WCYA 2N17A 3SEKC 2SGFI 1FYBA 1Y1CA 2OVOA 4GI3C 2V53A 1LR8A 1H0ZA 1DS2I 1CGJI 1M8BA 2N71A 2ARPF 1NUBA 3OVOA 2BUSA 1SGYI 1BUSA 1TUSA 4HGUA 1UVFA 1R0RI 1IW4A 3QTLD 1CSOI 1HJAI 3TJQA 1UVGA 3B4VC 1MT1A 1LR9A 1SGDI 1OMUA 1KMAA 1SGRI 1LR7A 1SGQI 1YU6C 2JXDA 1OMTA 1CHOI 2ERWA 1HPTA 1CT4I 1CT2I 2KMPA 2NU3I 1HDLA 2JZMA 1Z7KB 5DAEA 1CE3A 4OVOA 2SGPI 1PJUA 1PCEA 2B0UC 2QQCA 2KMQA 2F3CI 1Y1BA 1SGEI 2KMRA 2SGEI 1AN1I 1TBRR 1TURA 2NU2I 5JHWC 1M8CA 2GKRI 1UUCA 2KCXA 2NU4I 3HH2C 1IY6A 1PPFI 2SGQI 2GKVA 1CT0I 1TGSI 1N13A 2JYYA 3SGQI 4SGBI 2LEOA 2XRCA 1SGNI 2N52A 2QQDA 1BMOA 1OYVI 3SGBI 2SGDI 1IY5A 1TBQR 2P6AC 2NU0I 1SGPI 2GKTI 1YTPA 1DS3I
chains in the Genus database with same CATH superfamily
1CGII 4DNCA 2KMOA 1XBTA 2NU1I 1TIHA 2M5XA 1OVOA 2OZUA 2YUUA 2WCYA 1WGCA 1Y8FA 2N17A 2ODDA 2SGFI 3SEKC 1FYBA 1Y1CA 2OVOA 4GI3C 2V53A 1LR8A 2E5RA 1H0ZA 2CJSC 1DS2I 5J8CA 5HQ8A 5FUVA 1CGJI 1K7UA 4E1PA 2B8TA 3PDNA 1M8BA 2E73A 3BJIA 1PTQA 2N71A 2ARPF 1NUBA 3OVOA 2CWHA 2V1CC 2BUSA 4FKDA 1KBFA 1SGYI 3TOBA 1BUSA 1TUSA 4HGUA 1WGTA 2GIVA 5HI7A 1MJBA 4B6DA 1VDDA 1TBNA 1UVFA 1R0RI 1IW4A 3QTLD 3KY9A 3TO6A 1CSOI 3UEYA 1V1HA 1FY7A 1HJAI 1PTRA 3TJQA 3TO7A 2N1AB 3OXLA 1UVGA 1R79A 2DKVA 3B4VC 3FSYA 2QQ0A 3CXLA 4MPIA 3VDUA 1HEVA 1MT1A 3E59A 3VE5A 2ELIA 1LR9A 1SGDI 4UXJA 3RU0A 2J87A 1OMUA 1Q9BA 2QQEA 1W3SA 5CCLA 1KMAA 1XA6A 2LB7A 2X52A 3TOAA 5E3QA 1SGRI 1LR7A 1SGQI 1YU6C 2JXDA 1OMTA 1CHOI 4E1RA 2ERWA 2ORWA 3D00A 4AMLA 1HPTA 2A20A 1CT4I 2ENZA 2ORVA 1CT2I 3GOXA 3QWPA 1WTJA 2KMPA 4UXHA 2NU3I 2ROWA 1HDLA 9WGAA 3OL0A 1K7TA 2JZMA 3R5BA 5FUYA 1Z7KB 5DAEA 1CE3A 3FSXA 5EX3A 4OVOA 3OXFA 2DB6A 2SGPI 2QPOA 1PJUA 1PCEA 2Y0MA 5FUWA 2X3TA 2B0UC 2YQPA 2K9HA 2QQCA 3UGLA 5CCMA 4L9MA 2JA1A 1MJAA 1S20A 2OU2A 3E2IA 2KMQA 2F3CI 1Y1BA 2LUYA 3R5AA 1SGEI 2FNFX 2KMRA 2SGEI 1WKXA 2JW6A 1AN1I 2J9RA 3R5DA 2CWFA 1TBRR 1ULNA 2OD1A 2RIJA 2UZ3A 5E3PA 1TURA 4UXIA 3UGIA 4A24A 1TOTA 2NU2I 5JHWC 1ULKA 2PQ8A 2L8EA 2CWGA 1M8CA 2GKRI 1UUCA 1Z2IA 2KCXA 1TBOA 2NU4I 5E3RA 3HH2C 5FUXA 1PPFI 1IY6A 1P9GA 3R5CA 2UVOA 4WP4A 1MJ9A 1ULMA 2SGQI 2GKVA 3MEKA 1CT0I 1TGSI 1N13A 1UHAA 1U5KA 1FAQA 2JYYA 2VRWB 4JCVE 3SGQI 3UOEA 1V1IA 2W0TA 2GVIA 1FARA 4SGBI 3TO9A 1RFHA 2WGCA 3VDPA 3FC3A 1W4RA 2LEOA 2V1CA 2ENNA 2XRCA 1SGNI 3OXGA 2N52A 2QQDA 3QAHA 1BMOA 1OYVI 1X74A 1XX6A 2DIPA 2WVJA 3SGBI 7WGAA 2SGDI 3UEJA 5J8FA 5EX0A 1KBEA 1TBQR 1X4SA 2L7XA 1IY5A 2P6AC 2RC4A 2NU0I 1SGPI 1K7VA 1P9ZA 1YTPA 2GKTI 3UGDA 1DS3I 3UFFA 1NXUA
chains in the Genus database with same CATH topology
1CGII 2KMOA 1XBTA 2NU1I 1TIHA 2M5XA 1OVOA 2YUUA 2WCYA 1Y8FA 2N17A 2ODDA 3SEKC 2SGFI 1FYBA 1Y1CA 2OVOA 4GI3C 2V53A 1LR8A 2E5RA 1H0ZA 2CJSC 1DS2I 5HQ8A 5FUVA 1CGJI 4E1PA 2B8TA 3PDNA 1M8BA 2E73A 3BJIA 1PTQA 2N71A 2ARPF 1NUBA 3OVOA 2V1CC 2BUSA 4FKDA 1KBFA 1SGYI 1BUSA 1TUSA 4HGUA 5HI7A 4B6DA 1VDDA 1TBNA 1UVFA 1R0RI 1IW4A 3QTLD 3KY9A 1CSOI 3UEYA 1V1HA 1HJAI 1PTRA 3TJQA 2N1AB 3OXLA 1UVGA 1R79A 3B4VC 2QQ0A 3CXLA 3VDUA 1MT1A 3E59A 3VE5A 2ELIA 1LR9A 1SGDI 4UXJA 3RU0A 2J87A 1OMUA 2QQEA 1W3SA 5CCLA 1KMAA 1XA6A 1SGRI 1LR7A 1SGQI 1YU6C 2JXDA 1OMTA 1CHOI 4E1RA 2ERWA 2ORWA 3D00A 1HPTA 2A20A 1CT4I 2ENZA 2ORVA 1CT2I 3GOXA 3QWPA 2KMPA 4UXHA 2NU3I 2ROWA 1HDLA 3OL0A 2JZMA 5FUYA 1Z7KB 5DAEA 1CE3A 5EX3A 4OVOA 3OXFA 2DB6A 2SGPI 2QPOA 1PJUA 1PCEA 5FUWA 2B0UC 2YQPA 2K9HA 2QQCA 3UGLA 5CCMA 4L9MA 2JA1A 3E2IA 2KMQA 2F3CI 1Y1BA 2LUYA 1SGEI 2FNFX 2KMRA 2SGEI 2JW6A 1AN1I 2J9RA 1TBRR 2OD1A 2UZ3A 1TURA 4UXIA 3UGIA 4A24A 1TOTA 2NU2I 5JHWC 2L8EA 1M8CA 2GKRI 1UUCA 2KCXA 1TBOA 2NU4I 3HH2C 5FUXA 1PPFI 1IY6A 2SGQI 2GKVA 3MEKA 1CT0I 1TGSI 1N13A 1U5KA 1FAQA 2JYYA 2VRWB 4JCVE 3SGQI 1V1IA 2W0TA 2GVIA 1FARA 4SGBI 1RFHA 3VDPA 3FC3A 1W4RA 2LEOA 2V1CA 2ENNA 2XRCA 1SGNI 3OXGA 2N52A 2QQDA 1BMOA 1OYVI 1X74A 1XX6A 2DIPA 2WVJA 3SGBI 2SGDI 3UEJA 1IY5A 5EX0A 1KBEA 1TBQR 1X4SA 2L7XA 2P6AC 2NU0I 1SGPI 2GKTI 3UGDA 1YTPA 1DS3I 3UFFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CGI I;  2KMO A;  2NU1 I;  1TIH A;  2M5X A;  1OVO A;  2WCY A;  2N17 A;  3SEK C;  2SGF I;  1FYB A;  1Y1C A;  2OVO A;  4GI3 C;  2V53 A;  1LR8 A;  1H0Z A;  1DS2 I;  1CGJ I;  1M8B A;  2N71 A;  2ARP F;  1NUB A;  3OVO A;  2BUS A;  1SGY I;  1BUS A;  1TUS A;  4HGU A;  1UVF A;  1R0R I;  1IW4 A;  3QTL D;  1CSO I;  1HJA I;  3TJQ A;  1UVG A;  3B4V C;  1MT1 A;  1LR9 A;  1SGD I;  1OMU A;  1KMA A;  1SGR I;  1LR7 A;  1SGQ I;  1YU6 C;  2JXD A;  1OMT A;  1CHO I;  2ERW A;  1HPT A;  1CT4 I;  1CT2 I;  2KMP A;  2NU3 I;  1HDL A;  2JZM A;  1Z7K B;  5DAE A;  1CE3 A;  4OVO A;  2SGP I;  1PJU A;  1PCE A;  2B0U C;  2QQC A;  2KMQ A;  2F3C I;  1Y1B A;  1SGE I;  2KMR A;  2SGE I;  1AN1 I;  1TBR R;  1TUR A;  2NU2 I;  5JHW C;  1M8C A;  2GKR I;  1UUC A;  2KCX A;  2NU4 I;  3HH2 C;  1IY6 A;  1PPF I;  2SGQ I;  2GKV A;  1CT0 I;  1TGS I;  1N13 A;  2JYY A;  3SGQ I;  4SGB I;  2LEO A;  2XRC A;  1SGN I;  2N52 A;  2QQD A;  1BMO A;  1OYV I;  3SGB I;  2SGD I;  1IY5 A;  1TBQ R;  2P6A C;  2NU0 I;  1SGP I;  2GKT I;  1YTP A;  1DS3 I; 
#chains in the Genus database with same CATH topology
 1CGI I;  4DNC A;  2KMO A;  1XBT A;  2NU1 I;  1TIH A;  2M5X A;  1OVO A;  2OZU A;  2YUU A;  2WCY A;  1WGC A;  1Y8F A;  2N17 A;  2ODD A;  2SGF I;  3SEK C;  1FYB A;  1Y1C A;  2OVO A;  4GI3 C;  2V53 A;  1LR8 A;  2E5R A;  1H0Z A;  2CJS C;  1DS2 I;  5J8C A;  5HQ8 A;  5FUV A;  1CGJ I;  1K7U A;  4E1P A;  2B8T A;  3PDN A;  1M8B A;  2E73 A;  3BJI A;  1PTQ A;  2N71 A;  2ARP F;  1NUB A;  3OVO A;  2CWH A;  2V1C C;  2BUS A;  4FKD A;  1KBF A;  1SGY I;  3TOB A;  1BUS A;  1TUS A;  4HGU A;  1WGT A;  2GIV A;  5HI7 A;  1MJB A;  4B6D A;  1VDD A;  1TBN A;  1UVF A;  1R0R I;  1IW4 A;  3QTL D;  3KY9 A;  3TO6 A;  1CSO I;  3UEY A;  1V1H A;  1FY7 A;  1HJA I;  1PTR A;  3TJQ A;  3TO7 A;  2N1A B;  3OXL A;  1UVG A;  1R79 A;  2DKV A;  3B4V C;  3FSY A;  2QQ0 A;  3CXL A;  4MPI A;  3VDU A;  1HEV A;  1MT1 A;  3E59 A;  3VE5 A;  2ELI A;  1LR9 A;  1SGD I;  4UXJ A;  3RU0 A;  2J87 A;  1OMU A;  1Q9B A;  2QQE A;  1W3S A;  5CCL A;  1KMA A;  1XA6 A;  2LB7 A;  2X52 A;  3TOA A;  5E3Q A;  1SGR I;  1LR7 A;  1SGQ I;  1YU6 C;  2JXD A;  1OMT A;  1CHO I;  4E1R A;  2ERW A;  2ORW A;  3D00 A;  4AML A;  1HPT A;  2A20 A;  1CT4 I;  2ENZ A;  2ORV A;  1CT2 I;  3GOX A;  3QWP A;  1WTJ A;  2KMP A;  4UXH A;  2NU3 I;  2ROW A;  1HDL A;  9WGA A;  3OL0 A;  1K7T A;  2JZM A;  3R5B A;  5FUY A;  1Z7K B;  5DAE A;  1CE3 A;  3FSX A;  5EX3 A;  4OVO A;  3OXF A;  2DB6 A;  2SGP I;  2QPO A;  1PJU A;  1PCE A;  2Y0M A;  5FUW A;  2X3T A;  2B0U C;  2YQP A;  2K9H A;  2QQC A;  3UGL A;  5CCM A;  4L9M A;  2JA1 A;  1MJA A;  1S20 A;  2OU2 A;  3E2I A;  2KMQ A;  2F3C I;  1Y1B A;  2LUY A;  3R5A A;  1SGE I;  2FNF X;  2KMR A;  2SGE I;  1WKX A;  2JW6 A;  1AN1 I;  2J9R A;  3R5D A;  2CWF A;  1TBR R;  1ULN A;  2OD1 A;  2RIJ A;  2UZ3 A;  5E3P A;  1TUR A;  4UXI A;  3UGI A;  4A24 A;  1TOT A;  2NU2 I;  5JHW C;  1ULK A;  2PQ8 A;  2L8E A;  2CWG A;  1M8C A;  2GKR I;  1UUC A;  1Z2I A;  2KCX A;  1TBO A;  2NU4 I;  5E3R A;  3HH2 C;  5FUX A;  1PPF I;  1IY6 A;  1P9G A;  3R5C A;  2UVO A;  4WP4 A;  1MJ9 A;  1ULM A;  2SGQ I;  2GKV A;  3MEK A;  1CT0 I;  1TGS I;  1N13 A;  1UHA A;  1U5K A;  1FAQ A;  2JYY A;  2VRW B;  4JCV E;  3SGQ I;  3UOE A;  1V1I A;  2W0T A;  2GVI A;  1FAR A;  4SGB I;  3TO9 A;  1RFH A;  2WGC A;  3VDP A;  3FC3 A;  1W4R A;  2LEO A;  2V1C A;  2ENN A;  2XRC A;  1SGN I;  3OXG A;  2N52 A;  2QQD A;  3QAH A;  1BMO A;  1OYV I;  1X74 A;  1XX6 A;  2DIP A;  2WVJ A;  3SGB I;  7WGA A;  2SGD I;  3UEJ A;  5J8F A;  5EX0 A;  1KBE A;  1TBQ R;  1X4S A;  2L7X A;  1IY5 A;  2P6A C;  2RC4 A;  2NU0 I;  1SGP I;  1K7V A;  1P9Z A;  1YTP A;  2GKT I;  3UGD A;  1DS3 I;  3UFF A;  1NXU A; 
#chains in the Genus database with same CATH homology
 1CGI I;  2KMO A;  1XBT A;  2NU1 I;  1TIH A;  2M5X A;  1OVO A;  2YUU A;  2WCY A;  1Y8F A;  2N17 A;  2ODD A;  3SEK C;  2SGF I;  1FYB A;  1Y1C A;  2OVO A;  4GI3 C;  2V53 A;  1LR8 A;  2E5R A;  1H0Z A;  2CJS C;  1DS2 I;  5HQ8 A;  5FUV A;  1CGJ I;  4E1P A;  2B8T A;  3PDN A;  1M8B A;  2E73 A;  3BJI A;  1PTQ A;  2N71 A;  2ARP F;  1NUB A;  3OVO A;  2V1C C;  2BUS A;  4FKD A;  1KBF A;  1SGY I;  1BUS A;  1TUS A;  4HGU A;  5HI7 A;  4B6D A;  1VDD A;  1TBN A;  1UVF A;  1R0R I;  1IW4 A;  3QTL D;  3KY9 A;  1CSO I;  3UEY A;  1V1H A;  1HJA I;  1PTR A;  3TJQ A;  2N1A B;  3OXL A;  1UVG A;  1R79 A;  3B4V C;  2QQ0 A;  3CXL A;  3VDU A;  1MT1 A;  3E59 A;  3VE5 A;  2ELI A;  1LR9 A;  1SGD I;  4UXJ A;  3RU0 A;  2J87 A;  1OMU A;  2QQE A;  1W3S A;  5CCL A;  1KMA A;  1XA6 A;  1SGR I;  1LR7 A;  1SGQ I;  1YU6 C;  2JXD A;  1OMT A;  1CHO I;  4E1R A;  2ERW A;  2ORW A;  3D00 A;  1HPT A;  2A20 A;  1CT4 I;  2ENZ A;  2ORV A;  1CT2 I;  3GOX A;  3QWP A;  2KMP A;  4UXH A;  2NU3 I;  2ROW A;  1HDL A;  3OL0 A;  2JZM A;  5FUY A;  1Z7K B;  5DAE A;  1CE3 A;  5EX3 A;  4OVO A;  3OXF A;  2DB6 A;  2SGP I;  2QPO A;  1PJU A;  1PCE A;  5FUW A;  2B0U C;  2YQP A;  2K9H A;  2QQC A;  3UGL A;  5CCM A;  4L9M A;  2JA1 A;  3E2I A;  2KMQ A;  2F3C I;  1Y1B A;  2LUY A;  1SGE I;  2FNF X;  2KMR A;  2SGE I;  2JW6 A;  1AN1 I;  2J9R A;  1TBR R;  2OD1 A;  2UZ3 A;  1TUR A;  4UXI A;  3UGI A;  4A24 A;  1TOT A;  2NU2 I;  5JHW C;  2L8E A;  1M8C A;  2GKR I;  1UUC A;  2KCX A;  1TBO A;  2NU4 I;  3HH2 C;  5FUX A;  1PPF I;  1IY6 A;  2SGQ I;  2GKV A;  3MEK A;  1CT0 I;  1TGS I;  1N13 A;  1U5K A;  1FAQ A;  2JYY A;  2VRW B;  4JCV E;  3SGQ I;  1V1I A;  2W0T A;  2GVI A;  1FAR A;  4SGB I;  1RFH A;  3VDP A;  3FC3 A;  1W4R A;  2LEO A;  2V1C A;  2ENN A;  2XRC A;  1SGN I;  3OXG A;  2N52 A;  2QQD A;  1BMO A;  1OYV I;  1X74 A;  1XX6 A;  2DIP A;  2WVJ A;  3SGB I;  2SGD I;  3UEJ A;  1IY5 A;  5EX0 A;  1KBE A;  1TBQ R;  1X4S A;  2L7X A;  2P6A C;  2NU0 I;  1SGP I;  2GKT I;  3UGD A;  1YTP A;  1DS3 I;  3UFF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...