1SGYE

Tyr 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b at ph 6.5
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
185
structure length
185
Chain Sequence
ISGGDAIYSSTGRCSLGFNVRSGSTYYFLTAGHCTDGATTWWANSARTTVLGTTSGSSFPNNDYGIVRYTNTTIPKDGTVGGQDITSAANATVGMAVTRRGSTTGTHSGSVTALNATVNYGGGDVVYGMIRTNVCAEPGDSGGPLYSGTRAIGLTSGGSGNCSSGGTTFFQPVTEALSAYGVSVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptogrisin B
publication title Recruitment of a Buried K+ Ion to Stabilize the Negative Charge of Ionized P1 in the Hydrophobic Pocket: Crystal Structures of Glu18, Gln18, Asp18 and Asn18 Variants of Turkey Ovomucoid Inhibitor Third Domain Complexed with Streptomyces griseus Protease B at Various pH's
rcsb
source organism Meleagris gallopavo
molecule tags Hydrolase/hydrolase inhibitor
total genus 50
structure length 185
sequence length 185
ec nomenclature ec 3.4.21.81: Streptogrisin B.
pdb deposition date 1999-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sgyE02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sgyE01
5HM9A 1N8OC 2VJ1A 4ZUHA 1V2OT 4FUHA 5GIBA 4ISOA 1JIRA 1G2MA 2FYQA 1TB6H 1VGCB 4GUXA 2ZCLP 3MU4A 1TABE 2XBVA 1C2LA 3UFAA 3CS0A 4DCDA 3BTTE 2J2UA 2CXVA 2OC7A 4FUBA 1MU6B 4NSVA 2Z3EA 2WPHS 8ESTE 3A7WA 2FZZA 1E37B 2ODQA 2OC0A 1LO6A 2ZHQH 4D9QA 3G01A 5JBCS 2BD3A 2FTLE 1ORFA 1LHEH 3RXCA 4A92A 1HAIH 2RCEA 3MMGA 1ELGA 3DT0H 2HOBA 4TYDA 4NA7A 1O2GH 4NG9H 3QGJA 3SJIA 1O2NA 4Q80A 1MTSA 3PO1C 1AWHB 1C4Y2 4ISHH 5JBBS 2A4OA 2PWXA 2BM2A 2OTVA 5TJXA 4TY6A 3TK5A 4BTTB 2H5DA 1DY8A 3A7ZA 3U69H 1DWEH 1TNGA 4MNXA 4CRAA 1MTNC 1O2MA 3BTKE 3HPTB 3BN9A 3KGPA 2WPMS 1C2KA 1GVKB 4ZKSU 1O3NA 2J95A 1IOEA 2H2ZA 1F5KU 1A0LA 1ZPBA 2M5TA 1VGCC 2JETB 4YZUA 3E0NB 1BJVA 2XYAA 1FLEE 1KIGH 1KYNA 3SU6A 1YBWA 1FY8E 2Z9IA 3RXDA 1T8OA 3V3MA 1BMLA 1AZ8A 1O2UA 2A0QB 1AE5A 1V2UT 2TGDA 3MNBA 1C2JA 3S9BA 1H9LB 1SLVB 1K21H 3K65B 4LOYH 3I77A 1OWJA 2ZC9H 4K3JA 2G51A 3E91A 1AE8H 3KIDU 6LPRA 5E0JA 4AG2A 3SNDA 3C27B 2HVXA 2CN0H 2O8LA 2THFB 1BTUA 2G55A 1EOJA 4JMYA 1J14A 2HALA 2AEIH 1SI5H 2PKSB 1O2QA 1EAIA 1OP0A 4FUDA 2FYRA 3QTVH 4K8BA 2ZU4A 3RXOA 4MLFB 2F9OA 4UFDH 1DX5M 2PLXA 2PSXA 1C5UA 1NZQH 3DUXH 1SGQE 1LVYA 4PROA 3TIUA 1WQVH 5AVDA 3M37A 3B8JA 1SOZA 2RA0A 3M3SA 3AW1A 4JYUH 1BMMH 1JRSA 1QB9A 1T8NA 1CGIE 1GI2A 5LPEA 2FOFA 1PPGE 3K6ZA 2BQ7B 3QTOH 2BY7X 1KY9A 1WU1A 1E0FD 1OWHA 1B7XB 2JETC 1D4PB 5IDKA 3TGKE 4BANB 4DGJA 1HBTH 4A1VA 1ZTKA 1H8IH 2ASUB 1D3DB 2P3FH 1BCUH 2ZHFH 2ALVA 3V13A 1AQ7A 4D9RA 2I6QA 2BX3A 1A3BH 2CGAA 2GZ7A 2A2XH 2HGTH 2PKAB 1EZUC 1C5NH 4CHAB 1GMHF 1PJPA 3M7TA 1GL0E 1RGQA 4QT8C 3HK3B 1HAOH 1GI9B 3OY5U 1FIWA 1OX1A 2PTNA 1WYKA 2GX4A 3ZZ8A 4E7NA 1KXDA 3UQVA 3MH4A 3RXQA 2VNTA 3ZZBA 1FMGA 1S84A 2YOLA 1JOUB 3MH5A 2PKSC 1ESBA 1LVBA 1BDAA 4KP0A 1VITF 2ZDMA 1SMFE 4Z0KA 1TBQH 2ZGXH 1HFDA 4JK5A 4E7RG 3A85A 1MBQA 1VZQH 1GJ9B 4FUIA 1TNHA 3HATH 3SV9A 2NWNA 1DE7H 1TMUH 3BTEE 4NCYA 2J92A 4R8TB 4NWKA 4D76A 3R0FA 4MPXA 1EZSC 1QJ7B 1IAUA 1KLTA 4OS7A 4IN1A 1OYTH 1AVXA 3NUMA 2ZNKH 2D1JA 1OWKA 5C20A 2B8OH 2NU3E 2FLBH 2TGTA 3BEUA 4K1SA 1KXCA 1O3GA 3W95A 1BJUA 1FDPA 1MQ5A 1TGTA 1EOLA 1RIWB 2G00A 2FOHA 5GXPA 5A2MH 1C4V2 4CH2B 5AHGH 1TGNA 4MNVA 1GDUA 5HGGA 1GI0A 1C2EA 3PMHB 2Y7ZA 3SJ8A 2Y7XA 3LGTA 3SUEA 1V6DA 2AGEX 2SGEE 1HGTH 4UEHH 3NPSA 4NA9H 4O97A 5DGJA 1CO7E 3EDXB 3MH6A 4CHAC 1C5XB 4A1TA 4B75A 1K2I1 3CENA 2FOMB 3A81A 1HIAA 2YNAA 2BOHB 4FVDA 1N6XA 3D62A 1W7XH 3PMJA 1SLXB 4KTUA 2IJOB 2QGRA 4I7YH 1D6WA 2ZEBA 3M5NA 3OYPA 1UTOA 3A83A 5PTPA 3LC3A 7ESTE 1DVAH 1WTGH 4D8NA 4OS2A 4XFQA 1GBHA 1PQ8A 1BMAA 1ZHPA 1QNJA 2A32A 2ZGCA 3ATMA 3EA9A 3SV2H 1ZSJA 1IQFA 2ZFFH 3ZVFA 4OS6A 3RM2H 5JYIA 4YOJA 3Q76A 1P0SH 2QF3A 4IC6A 4MPVA 2VWNA 1ZJDA 2BXUH 1YLCA 1WBGB 2CF9H 2ODYB 4FXGH 1J15A 1AGJA 2P59A 1G37A 2FS8A 1NFXA 1UK2A 3PMBB 1K1MA 1OXGA 1IQGA 1PPEE 4MPUA 3HGNA 1RIWC 4D7GA 1TX6A 1XM1A 5FPYA 1MMJN 2P16A 1O37A 1EP5A 1FZZA 4YO9A 2GCTC 1QR3E 2JKHA 3ZVCA 1GBKA 3PMAB 3R3GB 1GI8B 2ZI2H 4ABFA 2C8YB 2UUFB 5C1XA 1EB2A 3GYLB 1KXBA 4WWYA 1AUJA 1O2KA 2BDGA 1QA0A 4TY7A 5DP7A 3RXPA 4MTBA 1THSH 2AS9A 3LGIA 4KGAA 1Y5AT 4KTCA 1Z6JH 4GPGA 1EAWA 4BXSA 3PV4A 1V2KT 4MG3A 2ZFRH 1BIOA 4B2BA 2GT8A 5EODA 3AAUA 1RTFB 4UFGH 2OQ5A 1SGDE 3E3TA 5A0CA 1IQIA 1LCYA 2FOEA 3RLYH 5K0HA 2G52A 1SGFA 4X1PU 1XVMA 3SUFA 4NSYA 5A8ZA 1INCA 1GHAG 3RXIA 2ZU5A 4UFEH 1TGSZ 4X2WA 2DE9A 3A89A 2ZHWH 4NIXA 5FBEA 1MUEB 2AIQA 1KLIH 1C5RA 4CRFA 2Y6TA 1K28D 1ZPCA 3RC6A 4DOQA 2PGQB 1H4WA 3U9AH 1GL1A 1AHTH 2RA3A 1O5CB 1GCTB 2ZCHP 3TU7H 3PWBA 2XBWA 3RXEA 1ESTA 1W12U 2FOBA 1GJAB 1W0ZU 4X1NU 1OP2A 2PHBA 1AD8H 5C5OA 5A0AE 1WSSH 1HAVB 1S85A 2CMYA 4OS1A 1ACBE 1V2PT 1LQEA 4NFFA 5EPNA 3TGIE 4YM9A 2UUJB 1SQTA 2VB0A 3UOPA 1NESE 1TRNA 1SL3A 3RMLH 1OSSA 2VGCB 1ARBA 1GJ6A 5DP6A 3A87A 1ANEA 1RS0A 1TBRH 1XUGA 2ZTZA 2ULLA 1T7CA 1CHGA 1O30A 1ZTJA 1W11U 1C1TA 4CREA 3KL6A 5DG6A 2ZU1A 3TH4H 2B7DH 1C5YB 1CVWH 2AGGX 4AZ2B 1TALA 2ZWLH 2DE8A 1ELAA 2XWAA 2FTMA 3ZZ4A 2UWLA 4K8YA 1SQOA 3VGCB 4I8LA 4MNYA 4X8TH 4AFSA 2ZGJA 2ZU2A 2GP9B 4NA8A 4IW4E 4DURA 4X6PA 3ELAH 1GI7B 3FP6E 2SNWA 3QUMP 1XX9A 1A5GH 1GCTC 1XXFA 4YTAA 1GHYH 2ZTXA 1V3XA 2H9TH 1O3DA 5L2ZH 1H1BA 4K60A 1G3BA 3OU0A 1NFYA 5A8XA 3LJOA 3EA7A 4AYVB 4JZ1A 2J38A 3T2NA 3A84A 1RTKA 4A1XA 5H4IB 1CA0B 4Y8YA 5HYOA 3ZZ9A 1W13U 1GBCA 1E36B 1HAHH 4NWLA 2SGAA 3LDXH 5F6MA 2VH6A 3ENSB 2OBOA 1FY1A 2VGCC 1CGJE 4LZ1H 5EG4A 5EQSA 3BTGE 3RP2A 2OLGA 5DPAA 5EXLA 3QO6A 4FUFA 1YCPM 1CHOG 2R2MB 5DK1A 1QBVH 1K1NA 2Y5FA 1SPJA 1O2YA 1TYNA 1ZRBA 2Q6DA 1OPHB 1QGFA 2BLQA 1V2NT 3BG8A 4WF8A 6CHAB 3F1SB 4GHQA 3Q3YA 3ESTA 1YPEH 2HNTE 1TFXA 3VGCC 1O3OA 3KN2A 3A80A 1ELDE 3RXLA 1O39A 2BY8X 1NN6A 1ELEE 2O8TA 2IOTA 3OX7U 1GJBB 2ZFTA 1P05A 3A86A 3FZDA 1DLKB 1L4DA 2BLVA 4H6SB 1ZMJA 1X7AC 2PGBB 2Z9LA 4K5ZA 1HJAB 2P94A 2RG3A 4IBLH 2G4TA 2ZQ2A 1YGCH 1Y8TA 4DY7B 3T5FH 3W94A 1AZZA 3N7OA 1QRWA 1LHFH 4BAOB 1QTFA 2B0FA 1EPTB 3M3TA 1PPCE 2ZU3A 2C8WB 4ZKNU 1A2CH 5FHTA 2ALPA 1C2MA 3FAOA 1HCGA 2P3TB 2R0KA 1SGIB 1UK3A 3Q3XA 2AMDA 7KMEH 4AB9A 4YT7H 2Z6BD 4IC5A 5L2YH 1G9IE 3BTQE 1WAYB 1FY3A 4Q7XA 7LPRA 1YPLH 1C5WB 2XC0A 4DVAU 1QY6A 1GMDF 3MTYA 5C1YA 3SQEE 5JBAS 1EAXA 1NM6A 1GJDB 1VCPA 3LOXA 4DT7B 6CHAC 2WYJA 1IQKA 4U2WA 2Q6FA 1TA2A 1TPOA 1W7GH 1GI1A 3T26A 1HDTH 4GCHG 4ABDA 4CRDA 1PPZA 2ZG0H 2OQUA 3E6PH 4ISNA 1TLDA 2STAE 5K7RA 5DP4A 4FU9A 1HJAC 1YPKH 1KXEA 3MU1A 1ELTA 1C5LH 1BHXF 3UOUA 3A7XA 3ATLA 3ZV8A 3U8TH 3SN8A 3ODDA 1TAWA 1GBEA 3PTNA 1EPTC 2Z9KA 3ITIA 2Q6GA 3U8RH 3T28A 4XSKU 4R0IA 2BD8A 2ZIQH 3VXFH 4GAWA 1C5ZB 1SFQB 2GDEH 3IG6B 3TGJE 1O2RA 2P95A 2LNCA 1IQHA 1PYTC 1JBUH 1RTLA 1SGNE 3BG4B 1A1RA 2OBQA 5EPYA 1SGCA 3OY6U 1SHYA 3TPIZ 2AIPA 1QB1A 1DWCH 2SGPE 1OKXA 1EQ9A 3SGQE 3TJVA 3RMMH 2F9NA 3SNAA 1HPGA 3GY5A 1AU8A 2FX6A 1VCWA 4OGXA 4MDSA 1ZR0A 1TMBH 1MCVA 2BDIA 1WUNH 1C5SA 4JK6A 1UVTH 1OYQA 4A7IB 4BAMB 3P70B 2WINI 1TWXB 1G32B 4ZXYH 2XCFA 4FUEA 1G2LA 3TJUA 4NIWA 2XCNA 4X2YA 1HAYB 4ABHA 3SI4H 5A09A 4GLYA 5G4BA 2BHGA 2VU8E 1FPCH 1GBJA 5LPFA 1AWFH 4NFEA 1BTYA 1T32A 3GCTG 1SFIA 1TPSA 1SC8U 2AMPA 4I33A 1FI8A 2BYAX 4ZHLU 2G8TA 5J4QA 3BSQA 2W3IA 1TBZH 2V3HH 2ZA5A 4O3UA 3A8AA 2ZPRA 3HKJB 2WV5A 3H7TA 3UWJH 4DIHH 3BG4C 1WCZA 3GISB 2P8OB 1ZLRA 1S6HA 4J1YA 2Y82A 1C5MD 3SGAE 4B71A 2QY0B 1C1RA 2A5KA 4CR5A 1DICA 1HYLA 4NIVA 5FCKA 1Z1IA 1QBOA 4WH6A 1TPAE 3LH3A 1GJ7B 2QCYA 1DSTA 1IQEA 3NCLA 2WV4A 2D8WA 5C1UA 1C9PA 2XWBI 3UREA 2GDDA 3GYMA 1YYY1 4BAHB 2FI4E 3BTDE 3MWIU 1H9IE 2EI6A 1WV7H 1P06A 4UFFH 1TA6A 3UQOA 1HJ8A 4GSOA 1ANDA 1WTHD 1GG6B 2OP9A 3ZYDA 3GY4A 1C5PA 3L33A 2ODPA 2ZKSA 1Y3YA 1OS8A 4Y71A 3DD2H 5EW1H 3EA8A 4F49A 4GVUA 5I46H 4NZQA 2BVXH 1FY5A 2SGQE 1T8LA 1L1JA 1GHAF 1UJ1A 3SU0A 3A82A 2O8UA 1EZQA 2J94A 1QL9A 1A61H 1ZHMA 1W3CA 1GMDG 2BZ6H 2XRCA 1CGHA 1HB0B 4AFUA 3LC5A 4X2XA 3EQ0H 2QAAA 3MU8A 3SNCA 1THRH 1GBAA 1UVOA 4M7GA 1HAPH 4X6OA 1JIMA 3P6ZB 2W26A 1EUFA 2FX4A 3MOCA 1O2HA 1XUKA 2EEKA 3S7HB 1IQMA 2VVVA 4UE7H 3TJNA 1C1WH 3P8OA 2D2DA 3LGUA 2BDYA 2JH0D 3MFJA 3NZIA 4SGBE 5SGAE 1KDQA 2A7HA 8KME2 1XUFA 1O2LA 3STIA 1GBDA 3RXTA 3QLPH 5L6NH 1GJ8B 1SGEE 1UHBB 1C5OH 4AFQA 4CRGA 1CT0E 1GG6C 1P2JA 2VWLA 3E1XB 4LXBH 1DXWA 4WMDA 1GJCB 4INLA 1GI3A 2GV7A 1UTMA 2AGIX 2A7JA 1TX8A 3O8BA 3D23A 4B2CA 3Q77A 1TGCA 3V12A 3SV8A 4B1TA 2UWPA 3A8CA 4BTIB 1A0HB 4MPWA 1SBWA 1F0UA 3SJOA 1T4UH 2GCHG 4FU7A 1P2QA 4ZHAA 3U8OH 3RC4A 4CR9A 1SGPE 1DANH 4X6NA 1ETSH 3RC5A 1V2QT 2FPZA 1K9OE 2BD7A 1LKBA 1UVPA 5F8TA 4ZKOU 1UVSH 4JZFH 3PM3A 4RSPA 1IQNA 4INHA 2FP7B 2A7CA 2A1DB 1LHDH 2QXGA 3SOSA 5BRRE 2TGAA 1QCPA 1O3EA 2WUCA 3LH1A 4ISLA 3TVJB 1LDTT 3BTME 5JPMH 1GBFA 1SVPA 2HNTC 2PFEA 1O3FA 1O3LA 3MU5A 2VIWA 2B5TB 3LT3A 4ESTE 4KKDA 1ANCA 5ABWA 3M7UA 4Y8ZA 3KEEA 4HGCA 2J34A 4IMQA 1MKWK 3K2UA 5JDUB 1C2GA 1GBTA 1CHOF 5EXNA 1LMWB 2QA9E 1AKSA 1J16A 2IPHA 1GHVH 4Q7YA 2XW9A 2ZTYA 3SU5A 3ZVEA 2XBYA 1AI8H 1FV9A 3ZVBA 1GBBA 4B74A 4FUJA 4XBCA 2SFAA 3TNTA 1BTZA 1EB1H 8LPRA 4X8VH 2Q1JA 2ZO3H 3DA9B 4AG1A 1LPZB 4UD9H 3BEFB 1FQ3A 2UUYA 1O5EH 1C1NA 2A45B 3SW2B 5GCHG 1AIXH 4YOIA 1THPB 4I8GA 1FJSA 4X0WU 2VWOA 3FFGA 1YPHC 2O9QA 1GHXH 2VIDA 3HKIB 4WMEA 4YLUA 1GDNA 2D26C 1O3MA 3RXMA 2DUCA 3ATWA 4ZH8A 3GOVB 4AYYB 1XKBC 1YLDA 2GMTB 4MQAA 4HI3A 1TMTH 3BIUH 3L3TA 1F0RA 1UCYK 4INKA 1O0DH 1V2MT 4X1RU 4H4FA 1P03A 4IMZA 1C2FA 2VIQA 4H42U 1GBMA 1N6YA 3E90B 1YPMH 4X6MA 4WXIA 3NKKA 3ODFA 1YKTA 2ZHDA 2BD4A 1P2OA 5HXFA 3QGNB 8GCHG 3P8FA 5DO4H 1MTVA 2BD5A 3M61U 2B9LA 1EKBB 3KNXA 3P92A 1DDJA 2FOGA 5CE1A 1GWAA 4GCHF 2FODA 1UTLM 3KQDA 2KAIA 1NPMA 1QL7A 1FONA 3ZV9A 1O3HA 3MO3A 4B2AA 1UTKA 2EI8A 1Q3XA 4JZEH 3FVFB 2BQWB 1QQ4A 3PLBA 4WJG2 4KELA 1ARCA 2BVRH 1LPKB 1V2JT 3V0XA 4ZROA 4X2VA 2CF8H 5DP9A 1BBRK 4O3TA 1M9UA 3RXSA 1AB9B 5A8YA 4H6TA 9LPRA 1EASA 2WPKS 1PPHE 1AMHA 1ZHRA 1BMNH 1BUIA 1O2PA 3UNRA 2GTBA 1MQ6A 4I8HA 2AERH 3SHAH 3P17H 4Y6DA 2ZFQH 2GMTC 2XNIA 4BXWA 2FEQH 1G3EA 2OC8A 2FWWA 6ESTA 1TQ0B 1P09A 2C8XB 1J8AA 1E34B 2NU0E 1MTWA 2STBE 3BTHE 1HNEE 1DSUA 2ZDVH 2W5EA 1CT2E 1ZSLA 2R0LA 1A5HA 3SI3H 1G36A 2ZPQA 1DS2E 2SGDE 3I29A 1C1QA 1P9SA 3A7YA 4JYVH 3VB7A 1ZRKA 4Y8XA 1GBIA 1L1NA 4Y7AA 1K1OA 1Z8IB 2PUQH 2Z9JA 2H9HA 5FBIA 2G5NA 4GHTA 3QN7A 1Q2WA 3ZZ7A 2OD3B 1MZAA 5A0BA 2A31A 2VH0A 1Y3UA 3BTFE 1OWDA 5FAHA 5LPRA 3LPRA 1B0EA 4YOGA 2WPLS 2P93A 3AW0A 3PLKA 3E8LA 4XE4A 1O3BA 2ANMH 3SQHE 3GCTF 1QRXA 2BVSH 2Y5GA 2UWOA 1K1IA 2HNTF 1BB0B 1O3IA 1AB9C 2TIOA 3NK8A 3TK6A 2QC2A 5T6DA 1SOTA 1MKWH 1KXFA 1TQ7B 1TPPA 4B73A 2GD4B 3A7TA 2K1QA 1C2DA 2PTCE 1J9CH 1SGYE 2VVCA 1W0YH 1A46H 1KTTB 1NU9A 2V6NA 1AY6H 1O5DH 1MCTA 1UTJA 2XBXA 4Y11E 2FOCA 3MU0A 1A3EH 3ZVAA 1D3TB 1NC6A 4JZIA 3LJJA 3A7VA 1KXAA 2C8ZB 3KQBA 1Z1JA 1VJ9U 4YLQH 2TRMA 3LKWA 3RXRA 3GCOA 1Y5UT 3OSYA 5AF9H 5E0GA 5E2OA 5FX5A 1ZGVA 5CMXH 1O33A 1CA0C 3URCA 4UDWH 3GY2A 1WQSA 2TBSA 2BDHA 1KSNA 2VVUA 3HK6B 1DUEA 2ZDKA 2FDAA 1SSXA 3MNSA 3D49H 4ASHA 1T8MA 1UCYE 1Z71A 2SNVA 4CBOA 4OGYA 1JXPA 1UCYH 3B23B 3RM0H 2UUKB 2NU4E 4A6LA 1NTPA 3SZNA 4IN2A 2W7SA 3FZZA 1SG8B 3KF2A 1TGBA 1CE5A 2PW8H 4J2YB 2Z3DA 1W10U 1YPHE 3EGKH 4FU8A 1NRNH 2C90B 1Z8JB 2VWMA 2A4QA 3GCHB 1Y3XA 5HM2A 3MNCA 4HZHA 5DJ7A 1NU7B 2ZQ1A 4TWWA 4IS5A 1DLEA 1K1LA 4ISIH 2BMGB 2HPQH 2BDCA 1O2TA 3SORA 4AORA 3PROA 2FLRH 3SV7A 1GVZA 3ZZ6A 3O8CA 3UWIA 1ESAA 3ZZDA 1CQQA 1G3DA 5GJ4B 1EJAA 1P12E 1ABIH 1FAXA 1P11E 1NRPH 3SNBA 3A88A 1C5TA 2C93B 3T62A 5C3NA 2FXRA 1MTUA 5E8EH 1XKAC 2GKVE 3PLPA 1GDQA 3M7QA 1W2KH 1BBRE 3ATKA 2HWLB 1BBRH 1H9HE 4X8SH 3GDVA 1TX7A 1PFXC 2R2WU 5EW2H 1BRCE 1GMCF 1PPBH 2BLWA 1OWIA 1NROH 1DOJA 3TK9A 1SQAA 1D6RA 3GY3A 2F9VA 3K6YA 1HXFH 3URDA 1O38A 2QIQA 1ZTLA 1GJ4H 3RXHA 1TONA 1LVMA 3O8RA 2GCHF 3RMOH 1CT4E 1RFNA 1BOQA 4WH8A 1N1LA 3GCHC 1SGTA 1P57B 2O8MA 2PV9B 3LGYA 1TOCB 1SR5C 2BY5X 1QJ6B 1V2LT 1HAZB 2HRVA 1GPZA 4ZKRU 1OWEA 1NRRH 1K1JA 2AYWA 2W7UA 2XC5A 2H1UA 4Y0ZE 5EQRA 5L30H 3GY6A 2OCVB 4BAQB 4XBDA 2Y5HA 3RLWH 4O03A 4YT6H 3T27A 2WPIS 1Z7KA 3S9CA 3EE0B 3RU4E 2FIRH 3U1JB 3GICB 1O35A 2FO9A 3F68H 3ZZ3A 3MO9A 4HTCH 4AGKA 1F92A 1K1PA 4JCNA 2VIOA 1TRYA 1BRBE 1HJ9A 2F83A 1YPJH 1IQJA 2I6SA 3RXBA 1UTQA 1QIXB 1O2OA 2A5AA 4K1EA 2ZDNA 3RXKA 3C1KA 4Y7BA 4B76A 2ZCKP 3LIWA 4BOHA 1DWDH 5ESBA 1G30B 2PUXB 3NXPA 4NIYA 3T29A 1EAUA 5DP3A 3WY8A 1V2RT 4Y10E 3QX5H 3GY7A 2EC9H 9ESTA 2V3OH 3TH2H 2BD9A 2H9EH 2F9BH 3DFLA 2TGPZ 4CRCA 2FOAA 1NRSH 3CP7A 2J4IA 2Z3CA 2IN2A 6GCHG 5FXLA 1W14U 1C1PA 2PKAA 5JBTA 1P2NA 3MI4A 1C2IA 3ZVDA 1C9TA 1DT2A 5GCHF 1VCQA 1P2MA 1O34A 1FUJA 3TITA 4DW2U 3DFJA 3M36A 1DFPA 2ZP0H 3SJKA 1LKAA 3A8DA 4MVNA 4WMFA 1A5IA 2BLOA 3M5OA 1QJ1B 1GHZA 2ILNA 2A5IA 3RDZA 5LGOA 4DJZB 2GT7A 3VEQB 4ZXXH 2OINA 1Z8RA 1Y5BT 2QXJA 1HRTH 2ZGBH 3VFEA 2OC1A 4K1TA 1SB1H 1C5VA 3PB1E 3O8DA 1O2ZA 4RN6A 3QK1A 5GDSH 1O2IA 3UR6A 3GCNA 1O2SA 2P3UB 3SV6A 3FANA 2JH5D 3UIRA 4IGDA 4CRBA 1SGRE 1TNLA 1MKXK 5TCCA 1QHRB 3VB3A 2LPRA 1UHBA 2CHAB 3MYWA 4X1SU 4NGAH 2P8OC 5C5NA 1UVUH 4Y0YE 8GCHF 4CBNA 2ANWA 2QXIA 1P8VC 5CHAB 1LPGB 4U30A 1K22H 2XXLA 3TLOA 1BTHH 1F0SA 1U6QA 1F5RA 3RXVA 4ABIA 1EX3A 4VGCB 2ZFPH 5DP5A 3BF6H 3F9FA 3LGVA 3ZYEA 1ZPZA 4NZLA 3SHCH 2AH4X 3VPKA 4DIIH 4JZDH 1NY22 2QXHA 3ZVGA 2W3KA 1NT1A 1P3EA 1DM4B 1EZXC 5FPTA 1UTPA 5F8XA 1PQ7A 4I8KA 2RDLA 4K69A 1O31A 1FIZA 1O2XA 1EATA 3PTBA 3M5LA 1C1OA 3SU4A 2A4GA 1GMCG 2BX4A 1NO9H 2O8WA 1XUJA 5I25A 1ETTH 4ABEA 1O5BB 2AFQB 1XUHA 2V35A 5JB8S 3SU3A 1BQYA 1O3KA 4ZMAH 3F9GA 1VITH 4Y79A 1IHSH 5DKMA 2JH6D 1GJ5H 3UR9A 4Y76A 3BIVH 4LK4A 1ID5H 2CHAC 1GCDA 3S7KB 3EYDA 1ELVA 1O3PB 2J9NA 1P2KA 1T31A 2VIVA 1T4VH 2NU2E 2EI7A 1FY4A 1HUTH 2WUBA 4DG4A 1TIOA 3ZZ5A 1F7ZA 1GI4A 1F0TA 2GCTB 4O9VA 5BPEA 1HAGE 3IITA 2PSYA 3SU1A 1YCPK 4THNH 5CHAC 1KDQB 1B5GH 5T6FA 1MZDA 3HGPA 3V7TA 4BTUB 1L1GA 1O3CA 1JMOH 1TNJA 4Z6AH 5EU8A 4AN7A 1B0FA 4VGCC 1JRTA 4I8JA 3TH3H 3TNSA 1HLTH 2SGFE 2F9PA 3S9AA 1FN8A 1PQ5A 1HV7A 1O2VA 1GHWH 1KTSB 4D7FA 1A7SA 1BTXA 1MAYA 1D9IA 2BY6X 1V2ST 1V2WT 2R3YA 1LQDB 1EP6A 5AFZH 3JZ2B 1RD3B 3F9EA 1GHBF 1NFUA 3VB6A 1S0RA 1P10A 5GWZA 3ZZAA 1SGFG 3RXJA 3I78A 4KTSA 1MU8B 1CBWB 2FESH 2GV6A 3SJ9A 4RKOB 2EA3A 5DP8A 1SHHB 1O5AB 1P02A 1EJMA 5C2ZA 3GDSA 1S83A 1P2IA 4X8UH 2BXTH 1Y3WA 2FS9A 2GZ8A 2Y80A 1HIAB 2G5VA 3SO3A 3L6PA 1JWTA 1C5QA 1OP8A 4FVBA 4UONA 2ZECA 1Y59T 1RJXB 5ESTE 3OTJE 3KQEA 3VB5A 1P3CA 2FMJA 3RXAA 2BZAA 5B6OA 1VJAU 3QZRA 3H7OA 3RMNH 1E35B 1ABJH 2CJIA 1BHXB 1GGDB 1S0QA 3VB4A 4CH8B 3BTWE 4HFPB 1LHCH 1A4WH 7GCHF 1ZMLA 1HAVA 2YNBA 3UTUH 5AFYH 2G4UA 4AFZA 1AO5A 1YM0A 2XTTB 1C1SA 2HLCA 3KQCA 4OS5A 5GPIB 2F9UA 3IWMA 3S69A 2BQ6B 3JZ1B 5JB9S 1AKSB 1Q31A 4XBBA 1XUIA 3T25A 1TE0A 5EGMA 5F03A 1AFQB 2BDAA 4TPIZ 1S81A 2FI3E 5C67A 3RXUA 1MD7A 1WOFA 1P9UA 4ZHMU 4ABGA 3SU2A 1MKXH 1DITH 1O3JA 1CBWC 1ZMNA 2AMQA 1AUTC 1D3QB 2VINA 5EOKA 5E0HA 2C3SA 1IQLA 2FI5E 4LZ4B 5FPSA 1YPGH 3U1IB 4K2YA 1DXPA 1FN6A 1ELBA 1GMHG 1ETRH 1A0JA 1MBMA 2OUAA 1BT7A 1C1MA 1LHGH 1BRUP 2ZHEH 3ATIA 4E06H 1ELFA 1D3PB 1GVLA 2BOKA 1PPFE 1AVGH 1J17T 1E38B 4AGJA 5FCRA 1VITG 1GGDC 4RKJB 3BEIB 4X1QU 1GI6A 1TNIA 3STJA 5FX6A 1QB6A 2A2QH 4ABJA 2G81E 3ZZCA 1KLJH 1L2EA 3D65E 2QF0A 3RXFA 3KHVA 1O5GH 1O2JA 1EXFA 1OOKB 1QRZA 1O32A 1O2WA 1CU1A 1UMAH 1QQUA 3RU4D 1S82A 2BY9X 1ANBA 3PYHA 4YESB 2QYIA 3F6UH 1DY9A 1AFQC 4XDEA 4WY3A 3S0NA 1FPHH 2PR3A 4XOJA 3QWCH 3RXGA 1BZXE 3E16B 1TRMA 4TWYA 1ZSKA 1S5SA 1AVWA 3M3VA 4ABBA 2KAIB 4FUGA 3MNXA 1O3AA 5F8ZA 1UTNA 2WPJS 1DWBH 2OXSA 2ZZUH 4U01A 4AOQA 2BD2A 4BNRA 1YP9A 1QURH 1YC0A 1Z6EA 1YCPH 3M35A 1IHTH 2ZPSA 4WXVA 1CA8B 1ZYOA 3LGWA 4WVPE 5E2PA 2QN5T 1SLUB 1QA7A 1PQAA 3SBKA 1ZGIA 1QL8A 1S6FA 1O36A 2Z9GA 1FXYA 2F3CE 3RUOA 1C1VH 1GBLA 1MAXA 1EJNA 3P95A 4MNWA 4U32A 1LTOA 2ESTE 3BV9B 2TPIZ 1TNKA 2H6MA 1MD8A 2HPPH 3Q00A 1GHBG 3GDUA 1RRKA 1O5FH 3MH7A 3MHWU 3A8BA 3DHKH 1EPTA 1QBNA 1XXDA 5TCAA 3H5CB 1C4U2 1XMNB 2BDBA 1Y3VA 3NWUA 5T6GA 3TJOA 2Z94A 2C4FH 1YF4A 1TOMH 1UO6A 2VIPA 1NS3A 1L0ZA 3PWCA 1BITA 1ZOMA 4Q2KA 1G3CA 4FUCA 1V2VT 2BB4A 1C2HA 1DPOA 3E0PB 3VXEH 4ABAA 4AB8A 3UUZA 3UNSA 4BAKB 5EQQA 1AFEH 5ETXA 5HMAA 1CSOE 6GCHF 3KCGH 3SNEA 3AVZA 1W8BH 1BTPA 1FNIA 1VR1H 2A4RA 3LONA 2BTCE 4E05H 4AX9H 1HAXB 3MO6A 2V0BA 7GCHG 2FM2A 1GI5A 1N8OB 1UK4A 5IYTA 3SUGA 2NU1E 3P8NA 1F2SE 3EAJA 3QZQA 3AASA 4Q7ZA 3FP8E 4JYTA 2GZ9A 1QFKH 3GY8A 2ANYA 3B9FH 3UY9A 1H8DH 2ZDLA 1AN1E 1FAKH 3CS7A 2WYGA 1ELCA 4ZAEA 4A5TS 1SLWB 3RU4T 2XC4A 3SUDA 1Z8GA 3FP7E 1NFWA 1MH0A 1V2TT 1ZJKA 2ZFSA 4TPYA 4OS4A 1NRQH 1BRAA 1ZZZA 2Y81A 1F5LA 2R3UA 2Z7FE 1BA8B 1RXPA 2R9PA 3M5MA 2QV1A 3UPEA 3PO1B 3SGBE 3UNQA 3U98H 4SGAE 1XVOA 1C1UH 1LVOA 3P8GA 4I32A 2H5CA 5LH8A 1P01A 2GGVB 1DUAA 3F9HA 1HXEH 3LU9B 2CV3A 3AAVA 1L4ZA 5EXMA 2ANKH 1MTNB 2GVFA 4I31A 2ZF0H 3K9XB 4F4OC 2ZDAH 5J4SA 5T3HA 3Q3KA 1P04A 1PYTD 3QDZB 2ZGHA 2F91A 1BTWA
chains in the Genus database with same CATH superfamily
5HM9A 1N8OC 2VJ1A 4ZUHA 1V2OT 4FUHA 5GIBA 4ISOA 4M9FA 1JIRA 1G2MA 2FYQA 1TB6H 1VGCB 4GUXA 2ZCLP 3MU4A 1TABE 2XBVA 1C2LA 3UFAA 3CS0A 4DCDA 3BTTE 2J2UA 2CXVA 2OC7A 4FUBA 1MU6B 4NSVA 2Z3EA 1OHHD 2AHME 2WPHS 8ESTE 3A7WA 1EFRD 2FZZA 3FOAA 1E37B 2ODQA 2OC0A 1LO6A 2ZHQH 4D9QA 3F2GA 3G01A 5JBCS 2BD3A 2FTLE 1NBMD 1ORFA 1LHEH 3RXCA 4A92A 1HAIH 2RCEA 4Q63A 3MMGA 1ELGA 3DT0H 2HOBA 4TYDA 4NA7A 1O2GH 4NG9H 3QGJA 3SJIA 1O2NA 4Q80A 1MTSA 1YLNA 3ZIAD 3PO1C 1AWHB 1C4Y2 4ISHH 5JBBS 2A4OA 2PWXA 2BM2A 2OTVA 5TJXA 4TY6A 3TK5A 4BTTB 2H5DA 4P00A 1DY8A 3A7ZA 3U69H 5B6LA 1DWEH 1TNGA 4MNXA 4CRAA 1MTNC 1O2MA 3BTKE 3HPTB 3BN9A 3KGPA 2WPMS 1C2KA 1GVKB 4ZKSU 1O3NA 2J95A 1IOEA 2H2ZA 1F5KU 1BMFD 1A0LA 1ZPBA 2M5TA 1VGCC 2JETB 4YZUA 3E0NB 4B6EA 1BJVA 2XYAA 1FLEE 1KIGH 1KYNA 3SU6A 1YBWA 1FY8E 2Z9IA 3RXDA 1T8OA 3V3MA 1BMLA 1AZ8A 1O2UA 2A0QB 1AE5A 1V2UT 2TGDA 3MNBA 1C2JA 3S9BA 1H9LB 1SLVB 1K21H 3K65B 4LOYH 3I77A 1OWJA 2ZC9H 4K3JA 2G51A 3E91A 1AE8H 3KIDU 1H8ED 5E0JA 6LPRA 4AG2A 3SNDA 3C27B 2HVXA 2CN0H 2O8LA 2THFB 3FN8A 3FKSD 1BTUA 2QF4A 2G55A 1EOJA 4JMYA 1J14A 2HALA 2AEIH 1SI5H 2PKSB 1O2QA 1EAIA 1OP0A 4FUDA 2FYRA 3QTVH 4K8BA 2ZU4A 3RXOA 4MLFB 2F9OA 4UFDH 1DX5M 2PLXA 2PSXA 1C5UA 1NZQH 2L74A 1SGQE 1LVYA 3DUXH 4PROA 3TIUA 1WQVH 5AVDA 3M37A 3B8JA 1SOZA 2RA0A 3M3SA 3AW1A 4JYUH 1BMMH 1JRSA 1QB9A 1T8NA 1CGIE 1GI2A 5LPEA 2FOFA 5IK2D 1PPGE 3K6ZA 2BQ7B 3QTOH 2BY7X 1KY9A 1WU1A 1E0FD 1OWHA 1B7XB 2JETC 1D4PB 5IDKA 3WW7A 3TGKE 4BANB 4DGJA 1HBTH 4A1VA 1ZTKA 1H8IH 2ASUB 1D3DB 2P3FH 1BCUH 2ZHFH 2ALVA 3V13A 1AQ7A 4D9RA 2I6QA 2BX3A 1A3BH 2CGAA 2GZ7A 2IJD1 2A2XH 2HGTH 2PKAB 1EZUC 1C5NH 4CHAB 1GMHF 1PJPA 3M7TA 1GL0E 1RGQA 4QT8C 3HK3B 1HAOH 1GI9B 3OY5U 1FIWA 1OX1A 2PTNA 2RDEA 1WYKA 2GX4A 3ZZ8A 1W0JD 4E7NA 1KXDA 3UQVA 3MH4A 3RXQA 2VNTA 3ZZBA 1FMGA 1S84A 2YOLA 2LP6A 5CHBA 1JOUB 3MH5A 2PKSC 1ESBA 1LVBA 1BDAA 2WHXA 4KP0A 1VITF 2ZDMA 1SMFE 4Z0KA 1TBQH 2ZGXH 1HFDA 4JK5A 4E7RG 3A85A 1MBQA 1VZQH 1GJ9B 4FUIA 1TNHA 3HATH 3SV9A 2NWNA 1DE7H 1TMUH 3BTEE 4NCYA 2J92A 4R8TB 4NWKA 4D76A 3R0FA 3DSPA 4MPXA 1EZSC 1QJ7B 1IAUA 1KLTA 4OS7A 4IN1A 1OYTH 1AVXA 3NUMA 2ZNKH 2D1JA 1OWKA 5C20A 2B8OH 2NU3E 2FLBH 2TGTA 3BEUA 4K1SA 1KXCA 1O3GA 3W95A 1BJUA 1FDPA 1MQ5A 1TGTA 3UB0A 1EOLA 1RIWB 2G00A 2FOHA 5GXPA 5A2MH 1C4V2 4CH2B 5AHGH 1TGNA 4MNVA 1GDUA 5HGGA 1GI0A 1C2EA 3PMHB 2Y7ZA 3SJ8A 2Y7XA 3LGTA 3SUEA 1V6DA 2XNDD 2AGEX 2SGEE 1HGTH 4UEHH 3NPSA 4NA9H 4O97A 5DGJA 1CO7E 3EDXB 3MH6A 4CHAC 1C5XB 4A1TA 4B75A 1K2I1 3CENA 2FOMB 3A81A 1HIAA 2YNAA 2BOHB 4FVDA 1N6XA 3D62A 1W7XH 3PMJA 1SLXB 2W6ID 4KTUA 2IJOB 2QGRA 4I7YH 1D6WA 2ZEBA 3M5NA 3OYPA 1UTOA 3A83A 5PTPA 3LC3A 7ESTE 1DVAH 1WTGH 4D8NA 4OS2A 4XFQA 1GBHA 1PQ8A 1BMAA 1ZHPA 1QNJA 2A32A 2ZGCA 3ATMA 3EA9A 3SV2H 1ZSJA 1IQFA 2ZFFH 3ZVFA 4OS6A 3RM2H 5JYIA 4YOJA 3Q76A 1P0SH 2QF3A 4IC6A 4MPVA 2VWNA 1ZJDA 2BXUH 1YLCA 1WBGB 2CF9H 2ODYB 4FXGH 1J15A 1AGJA 2P59A 1G37A 2WPDD 2FS8A 1NFXA 1UK2A 3PMBB 1K1MA 1OXGA 1IQGA 1PPEE 4MPUA 3HGNA 1RIWC 4D7GA 1TX6A 1XM1A 5FPYA 1MMJN 2P16A 1O37A 2F43B 1EP5A 1FZZA 4YO9A 2GCTC 1QR3E 2JKHA 3PV5A 3ZVCA 1GBKA 3PMAB 3R3GB 1GI8B 2ZI2H 4ABFA 2C8YB 2UUFB 5C1XA 1EB2A 3GYLB 1KXBA 4WWYA 1AUJA 1O2KA 2BDGA 1QA0A 4TY7A 5DP7A 3RXPA 4MTBA 4YXWD 1THSH 2AS9A 3LGIA 4KGAA 1Y5AT 4KTCA 1Z6JH 4GPGA 1EAWA 4BXSA 3PV4A 1V2KT 4MG3A 2ZFRH 3DSGA 1BIOA 2J97A 4B2BA 2GT8A 5EODA 3AAUA 3EE7A 1RTFB 4UFGH 1UW7A 1SKYE 2OQ5A 1SGDE 3E3TA 5A0CA 1IQIA 1LCYA 2FOEA 3RLYH 5K0HA 2G52A 1SGFA 5FL7D 4X1PU 1XVMA 3SUFA 2KZ4A 4NSYA 5A8ZA 1INCA 1GHAG 3RXIA 2ZU5A 4UFEH 1TGSZ 4X2WA 2DE9A 3A89A 2ZHWH 4NIXA 5FBEA 1MUEB 2AIQA 1KLIH 1C5RA 4CRFA 2Y6TA 1K28D 1ZPCA 3RC6A 4DOQA 2PGQB 1H4WA 3U9AH 1GL1A 1AHTH 2RA3A 1O5CB 1GCTB 2ZCHP 3TU7H 3PWBA 2XBWA 3RXEA 1ESTA 1W12U 2FOBA 1GJAB 1W0ZU 4X1NU 1OP2A 2PHBA 1AD8H 5C5OA 5A0AE 1WSSH 1HAVB 1S85A 2CMYA 3OEHD 4OS1A 1ACBE 1V2PT 3F0PA 1LQEA 4NFFA 5EPNA 3TGIE 4YM9A 2UUJB 1SQTA 2VB0A 3UOPA 3SYJA 1NESE 1TRNA 4ZCNA 1SL3A 2RFKC 3RMLH 1OSSA 2VGCB 1E1RD 4HG6A 1ARBA 1GJ6A 5DP6A 3A87A 1ANEA 1RS0A 1TBRH 1XUGA 2ZTZA 2ULLA 1T7CA 1CHGA 1O30A 1ZTJA 1W11U 3N7DA 1C1TA 4CREA 3KL6A 5DG6A 2ZU1A 3TH4H 2B7DH 1C5YB 1CVWH 2AGGX 4AZ2B 1TALA 2ZWLH 2DE8A 1YWUA 1ELAA 2XWAA 2FTMA 3ZZ4A 2UWLA 4K8YA 1SQOA 3VGCB 4I8LA 2XOKD 4MNYA 4X8TH 4AFSA 2ZGJA 2ZU2A 2GP9B 4NA8A 1VKYA 3CNRA 4IW4E 4DURA 4X6PA 3ELAH 1GI7B 3FP6E 2SNWA 3QUMP 1XX9A 1A5GH 1GCTC 1XXFA 4YTAA 1GHYH 2ZTXA 1V3XA 2H9TH 1O3DA 5L2ZH 1H1BA 4K60A 1G3BA 3OU0A 1NFYA 5A8XA 3LJOA 3EA7A 4AYVB 4JZ1A 2J38A 3T2NA 3A84A 1RTKA 4A1XA 5H4IB 1CA0B 4Y8YA 5HYOA 1QZ8A 3ZZ9A 1W13U 1GBCA 1E36B 1HAHH 4NWLA 2SGAA 3LDXH 1FX0B 5F6MA 2VH6A 3ENSB 2OBOA 1FY1A 2VGCC 1CGJE 4LZ1H 5EG4A 5EQSA 3BTGE 3RP2A 2OLGA 5DPAA 5EXLA 2JJ2D 3QO6A 4FUFA 1YCPM 3N99A 1CHOG 2R2MB 5DK1A 1QBVH 1K1NA 2Y5FA 1SPJA 1O2YA 1TYNA 1ZRBA 2Q6DA 1OPHB 1QGFA 2BLQA 1V2NT 3BG8A 4WF8A 6CHAB 3F1SB 4GHQA 3Q3YA 3ESTA 1YPEH 2HNTE 1TFXA 3VGCC 1O3OA 3KN2A 3A80A 1ELDE 3RXLA 1O39A 2BY8X 1NN6A 1ELEE 2O8TA 2IOTA 3OX7U 1GJBB 2ZFTA 1P05A 3A86A 3FZDA 1DLKB 1L4DA 2BLVA 4H6SB 4ASUD 1ZMJA 3WWFA 1X7AC 2PGBB 2Z9LA 4K5ZA 1HJAB 2P94A 2RG3A 4IBLH 2G4TA 2ZQ2A 1YGCH 1Y8TA 4DY7B 3T5FH 3W94A 1AZZA 3N7OA 1QRWA 1LHFH 4BAOB 1QTFA 2B0FA 1EPTB 3M3TA 1PPCE 2ZU3A 2C8WB 4ZKNU 1A2CH 5FHTA 2ALPA 1C2MA 3FAOA 1HCGA 5KEDA 2P3TB 2R0KA 1SGIB 1UK3A 3Q3XA 2AMDA 7KMEH 4AB9A 4YT7H 2Z6BD 2YMSB 4IC5A 5L2YH 1G9IE 3BTQE 1WAYB 3PRBA 1FY3A 4Q7XA 7LPRA 1YPLH 1C5WB 3KQ5A 2XC0A 4DVAU 1QY6A 1GMDF 3MTYA 5C1YA 3SQEE 5JBAS 1EAXA 1NM6A 1GJDB 1VCPA 3LOXA 4DT7B 6CHAC 2WYJA 1IQKA 4U2WA 2Q6FA 1TA2A 1TPOA 1W7GH 1GI1A 3T26A 1HDTH 4GCHG 4ABDA 4CRDA 1PPZA 2ZG0H 2OQUA 3E6PH 4ISNA 1TLDA 2STAE 3AK5A 5K7RA 5DP4A 2OK5A 4FU9A 1HJAC 1YPKH 1KXEA 3MU1A 1ELTA 1C5LH 1BHXF 3PRDA 5HIYA 3UOUA 3A7XA 3ATLA 3ZV8A 5KGOA 3U8TH 3SN8A 3ODDA 1TAWA 1GBEA 3PTNA 1EPTC 2Z9KA 3ITIA 2Q6GA 4RT0A 3U8RH 3T28A 4XSKU 4R0IA 2BD8A 2ZIQH 3VXFH 4GAWA 1C5ZB 2L6OA 1SFQB 2GDEH 3IG6B 3TGJE 1O2RA 2P95A 2LNCA 1IQHA 1PYTC 1JBUH 1RTLA 1SGNE 2YMSC 3BG4B 1A1RA 2OBQA 5EPYA 1SGCA 3OY6U 1SHYA 3TPIZ 2AIPA 1QB1A 1DWCH 2SGPE 1OKXA 1EQ9A 3SGQE 3TJVA 3OEED 3RMMH 2F9NA 3SNAA 1HPGA 3GY5A 1AU8A 2FX6A 1VCWA 4OGXA 2VBCA 4MDSA 1ZR0A 1TMBH 2K0QA 1MCVA 2BDIA 1WUNH 1C5SA 3OAAD 1UVTH 4JK6A 1OYQA 4A7IB 4BAMB 3P70B 2WINI 1TWXB 1G32B 4ZXYH 2XCFA 4FUEA 1G2LA 3TJUA 4NIWA 2XCNA 4X2YA 1HAYB 4ABHA 3SI4H 5A09A 5DN6D 4GLYA 5G4BA 2BHGA 2VU8E 1FPCH 1GBJA 5LPFA 1AWFH 1WXRA 4NFEA 1BTYA 1T32A 3GCTG 1SFIA 1TPSA 1SC8U 2AMPA 4I33A 1FI8A 2BYAX 2PP6A 4ZHLU 2G8TA 5J4QA 3BSQA 2W3IA 1TBZH 2V3HH 2ZA5A 4O3UA 3A8AA 2ZPRA 3HKJB 2WV5A 3H7TA 3UWJH 4DIHH 3BG4C 1WCZA 3GISB 2P8OB 1ZLRA 1S6HA 4J1YA 2Y82A 1C5MD 3SGAE 4B71A 2CK3D 2QY0B 1C1RA 2A5KA 4CR5A 1DICA 1HYLA 4NIVA 5FCKA 1Z1IA 1QBOA 4WH6A 1TPAE 3LH3A 2QF5A 1GJ7B 2QCYA 1DSTA 1IQEA 3NCLA 2WV4A 2D8WA 5C1UA 1C9PA 2XWBI 3UREA 2GDDA 4F55A 3GYMA 1YYY1 4BAHB 2FI4E 3BTDE 3MWIU 1H9IE 2EI6A 1WV7H 1P06A 4UFFH 1TA6A 1WDIA 3UQOA 1HJ8A 4GSOA 1ANDA 1WTHD 1GG6B 2OP9A 3ZYDA 3GY4A 1C5PA 3L33A 2ODPA 2ZKSA 1Y3YA 1OS8A 4Y71A 3DD2H 5EW1H 3EA8A 4F49A 4GVUA 2KCOA 5I46H 4NZQA 2BVXH 1FY5A 2SGQE 1T8LA 1L1JA 1GHAF 1UJ1A 3SU0A 3A82A 2O8UA 1EZQA 2J94A 1QL9A 1A61H 1ZHMA 1W3CA 1GMDG 2BZ6H 2XRCA 1CGHA 1HB0B 4AFUA 3LC5A 4X2XA 4B6FA 3EQ0H 2QAAA 3MU8A 3SNCA 1THRH 1GBAA 5EJLA 1UVOA 4M7GA 1HAPH 4X6OA 1JIMA 3P6ZB 2W26A 1EUFA 2FX4A 3MOCA 1O2HA 1XUKA 2EEKA 3S7HB 1IQMA 2VVVA 4UE7H 3TJNA 1C1WH 3P8OA 2D2DA 3LGUA 2BDYA 2JH0D 3MFJA 3NZIA 4SGBE 5SGAE 1KDQA 2A7HA 5C17A 8KME2 1XUFA 1O2LA 3STIA 1GBDA 2EQNA 3RXTA 5L6NH 3QLPH 1GJ8B 1SGEE 1UHBB 2KM0A 1C5OH 4AFQA 4CRGA 1CT0E 1GG6C 1P2JA 2VWLA 3E1XB 4LXBH 1DXWA 4WMDA 1GJCB 2V3MA 4INLA 1GI3A 2GV7A 1UTMA 2AGIX 2A7JA 1TX8A 3O8BA 3D23A 4B2CA 1YY3A 3Q77A 1TGCA 3V12A 3SV8A 4B1TA 2UWPA 3A8CA 4BTIB 1A0HB 4MPWA 1SBWA 1F0UA 3SJOA 1T4UH 2GCHG 4FU7A 1P2QA 4ZHAA 5C0TA 3U8OH 2KCYA 3RC4A 4CR9A 3KYFA 1SGPE 1DANH 4X6NA 4FOUC 4TT3D 1ETSH 3RC5A 1V2QT 2FPZA 1K9OE 2BD7A 1LKBA 1UVPA 5F8TA 4ZKOU 1UVSH 4JZFH 3PM3A 4RSPA 1IQNA 4INHA 2FP7B 2A7CA 2A1DB 1LHDH 2QXGA 3SOSA 5BRRE 4ACBA 2TGAA 1QCPA 1O3EA 2WUCA 3LH1A 4ISLA 3TVJB 1LDTT 3BTME 4F48B 5JPMH 1GBFA 1SVPA 2HNTC 2PFEA 1O3FA 1O3LA 3MU5A 2VIWA 2B5TB 3LT3A 4ESTE 4KKDA 1ANCA 4DT4A 5ABWA 3M7UA 4Y8ZA 3KEEA 4HGCA 2J34A 4IMQA 1MKWK 3K2UA 5JDUB 1C2GA 1GBTA 1CHOF 5EXNA 2KX4A 1LMWB 2QA9E 1AKSA 1J16A 2IPHA 1GHVH 4Q7YA 3NRLA 2XW9A 2ZTYA 3SU5A 3ZVEA 2XBYA 1AI8H 1FV9A 3ZVBA 1GBBA 4B74A 4FUJA 4XBCA 2HVYB 2SFAA 3TNTA 1BTZA 5CDFE 1EB1H 8LPRA 4X8VH 2Q1JA 2ZO3H 3DA9B 4AG1A 1LPZB 4UD9H 3BEFB 1FQ3A 2UUYA 1O5EH 1C1NA 2A45B 3SW2B 5GCHG 1AIXH 4YOIA 1THPB 4I8GA 1FJSA 4X0WU 2VWOA 3FFGA 1YPHC 2O9QA 3OTPA 1GHXH 3N7EA 2VIDA 3HKIB 4WMEA 4YLUA 1GDNA 2D26C 1O3MA 3RXMA 2KFWA 2DUCA 3ATWA 4ZH8A 3GOVB 4AYYB 1XKBC 1YLDA 2GMTB 4MQAA 1E1QD 1TMTH 3BIUH 4HI3A 3L3TA 1F0RA 1UCYK 4INKA 1O0DH 5DSFA 1V2MT 4X1RU 4H4FA 1P03A 4IMZA 1C2FA 2VIQA 4H42U 1GBMA 1N6YA 3E90B 1YPMH 4X6MA 4WXIA 2IPQX 3NKKA 3ODFA 1YKTA 2ZHDA 2BD4A 1P2OA 3F2HA 5HXFA 3QGNB 8GCHG 3P8FA 5DO4H 1MTVA 2BD5A 3M61U 2B9LA 1EKBB 3KNXA 3P92A 1DDJA 2FOGA 5CE1A 2J5UA 1GWAA 4GCHF 2FODA 1UTLM 3KQDA 2KAIA 1NPMA 1QL7A 1FONA 3ZV9A 1O3HA 3MO3A 4B2AA 1UTKA 2EI8A 5HIZA 1Q3XA 4JZEH 3FVFB 2BQWB 1QQ4A 3PLBA 4WJG2 4KELA 1ARCA 2BVRH 1LPKB 1V2JT 3V0XA 4ZROA 4X2VA 2CF8H 5DP9A 1BBRK 4O3TA 1M9UA 4FETA 1AB9B 3RXSA 5A8YA 4H6TA 9LPRA 1EASA 2WPKS 1PPHE 1AMHA 1ZHRA 2HLDD 1BMNH 1BUIA 1O2PA 3UNRA 2GTBA 1MQ6A 4I8HA 3U28C 2AERH 3SHAH 3P17H 4Y6DA 2ZFQH 2GMTC 2XNIA 4BXWA 2FEQH 1G3EA 2OC8A 2FWWA 6ESTA 1TQ0B 4AC9A 1P09A 2C8XB 1J8AA 3SZEA 1E34B 2NU0E 1MTWA 2STBE 3BTHE 4ACAA 1HNEE 1DSUA 2ZDVH 2W5EA 1CT2E 1ZSLA 2R0LA 1A5HA 3SI3H 1G36A 2ZPQA 1DS2E 2SGDE 3I29A 1C1QA 1P9SA 3A7YA 4JYVH 3VB7A 1ZRKA 4Y8XA 1GBIA 1L1NA 4Y7AA 1K1OA 1Z8IB 2PUQH 2Z9JA 2H9HA 5FBIA 2G5NA 4GHTA 3GS9A 3QN7A 1Q2WA 3ZZ7A 2OD3B 1MZAA 5A0BA 2A31A 2VH0A 1Y3UA 3BTFE 1OWDA 5FAHA 5LPRA 3LPRA 1B0EA 4YOGA 2WPLS 2P93A 3AW0A 3PLKA 3E8LA 4XE4A 1O3BA 2ANMH 3SQHE 3GCTF 1QRXA 2BVSH 2Y5GA 2UWOA 1K1IA 2HNTF 1BB0B 1O3IA 1AB9C 2TIOA 3NK8A 3TK6A 2QC2A 5T6DA 1SOTA 1MKWH 1KXFA 1TQ7B 1TPPA 4B73A 2GD4B 3A7TA 2K1QA 1KMHB 1C2DA 2PTCE 2J98B 1J9CH 1SGYE 2VVCA 1W0YH 1A46H 1KTTB 1NU9A 2V6NA 1AY6H 1O5DH 2KCAA 1MCTA 1UTJA 2XBXA 4Y11E 2FOCA 3MU0A 1A3EH 3ZVAA 5EJZA 2KR7A 1D3TB 1NC6A 4JZIA 3LJJA 3A7VA 1KXAA 2C8ZB 3KQBA 1Z1JA 1VJ9U 4YLQH 2TRMA 3LKWA 3RXRA 3GCOA 1Y5UT 3OSYA 5AF9H 5E0GA 5E2OA 5FX5A 1ZGVA 5CMXH 1O33A 1CA0C 3URCA 4UDWH 3GY2A 1WQSA 2TBSA 2BDHA 3OFND 5GNDA 1KSNA 2VVUA 3HK6B 1DUEA 2ZDKA 2FDAA 1SSXA 3MNSA 3D49H 4ASHA 1T8MA 1UCYE 1Z71A 2SNVA 4CBOA 2M2AA 4OGYA 1JXPA 1UCYH 3B23B 3RM0H 2UUKB 2NU4E 2KCPA 1NTPA 4A6LA 2EY4C 3SZNA 4IN2A 2W7SA 3FZZA 1SG8B 3KF2A 1TGBA 2WV9A 1CE5A 2PW8H 4J2YB 2Z3DA 1W10U 1YPHE 3EGKH 4FU8A 1NRNH 2C90B 2JDID 1Z8JB 2VWMA 2A4QA 3GCHB 1Y3XA 5HM2A 3MNCA 4HZHA 5DJ7A 1NU7B 2ZQ1A 4TWWA 4IS5A 1DLEA 1K1LA 4ISIH 2BMGB 2HPQH 2BDCA 1O2TA 3SORA 4AORA 3PROA 2FLRH 3SV7A 1GVZA 3ZZ6A 3O8CA 3UWIA 1ESAA 3ZZDA 1CQQA 1G3DA 5GJ4B 1EJAA 1P12E 1ABIH 1FAXA 1P11E 1NRPH 3SNBA 3A88A 1C5TA 2C93B 3T62A 5C3NA 2FXRA 1MTUA 5E8EH 1XKAC 2GKVE 3PLPA 1GDQA 3M7QA 1W2KH 1BBRE 3ATKA 2HWLB 1BBRH 1H9HE 4X8SH 3GDVA 1TX7A 1PFXC 2R2WU 5EW2H 1BRCE 1GMCF 1PPBH 2BLWA 1OWIA 1NROH 1DOJA 3TK9A 1SQAA 1D6RA 2QE7D 3GY3A 2F9VA 3K6YA 1S6LA 1HXFH 3URDA 1O38A 2QIQA 1ZTLA 1GJ4H 3RXHA 1TONA 1LVMA 3O8RA 2GCHF 3F0OA 3RMOH 1CT4E 1RFNA 1BOQA 4WH8A 1N1LA 3GCHC 1SGTA 1P57B 2O8MA 2PV9B 3LGYA 1TOCB 1SR5C 2BY5X 1QJ6B 1V2LT 2LELA 1HAZB 2HRVA 1GPZA 4ZKRU 1OWEA 1NRRH 1K1JA 2AYWA 2W7UA 2XC5A 2H1UA 3DCLA 4Y0ZE 5EQRA 5L30H 3F3BA 3GY6A 2OCVB 4BAQB 4XBDA 2Y5HA 3RLWH 4O03A 4YT6H 3T27A 2WPIS 1Z7KA 3S9CA 3EE0B 3RU4E 2FIRH 3U1JB 3GICB 1O35A 2FO9A 3F68H 3ZZ3A 3MO9A 4HTCH 4AGKA 1F92A 1K1PA 4JCNA 2VIOA 1TRYA 1BRBE 1HJ9A 2F83A 1YPJH 1IQJA 2I6SA 3RXBA 1UTQA 1QIXB 1O2OA 2A5AA 4K1EA 2ZDNA 3RXKA 3C1KA 4Y7BA 4B76A 2ZCKP 3LIWA 4BOHA 1DWDH 5ESBA 1G30B 2PUXB 3NXPA 4NIYA 3T29A 1EAUA 5DP3A 3WY8A 1V2RT 4Y10E 3QX5H 3GY7A 2EC9H 9ESTA 1SQRA 2V3OH 3TH2H 2BD9A 2H9EH 2F9BH 3DFLA 2TGPZ 4CRCA 2FOAA 1NRSH 3CP7A 2J4IA 2Z3CA 2IN2A 6GCHG 5FXLA 1W14U 1C1PA 2PKAA 2K8IA 5JBTA 1P2NA 3MI4A 1C2IA 3ZVDA 1C9TA 1DT2A 5GCHF 1VCQA 1P2MA 1O34A 1FUJA 3TITA 4DW2U 3DFJA 3M36A 1DFPA 2ZP0H 3SJKA 1LKAA 3A8DA 4MVNA 4WMFA 1A5IA 2BLOA 3M5OA 1QJ1B 1GHZA 2ILNA 2A5IA 3RDZA 5LGOA 4DJZB 2GT7A 3VEQB 4ZXXH 3OE7D 2OINA 1Z8RA 1Y5BT 4XD7D 2QXJA 1HRTH 2ZGBH 3VFEA 5C94A 2OC1A 4K1TA 1SB1H 1C5VA 3PB1E 3O8DA 1O2ZA 4RN6A 3QK1A 4Z1MD 5GDSH 1K0HA 1O2IA 3UR6A 5C0UA 3GCNA 3UAIC 1O2SA 3KYGA 2P3UB 3SV6A 3FANA 3W1EA 2JH5D 3UIRA 4IGDA 4CRBA 1SGRE 1TNLA 1MKXK 5TCCA 1QHRB 3VB3A 2LPRA 1UHBA 2CHAB 3MYWA 4X1SU 4NGAH 2P8OC 5C5NA 1UVUH 4Y0YE 8GCHF 4CBNA 2ANWA 2QXIA 1P8VC 5CHAB 1LPGB 4U30A 1K22H 2XXLA 3TLOA 1BTHH 1F0SA 1U6QA 1F5RA 3RXVA 4ABIA 1EX3A 4VGCB 2ZFPH 5DP5A 3BF6H 3F9FA 3LGVA 3ZYEA 1ZPZA 4NZLA 3SHCH 2AH4X 3VPKA 4DIIH 4JZDH 1NY22 2QXHA 3ZVGA 2W3KA 1NT1A 1P3EA 1DM4B 1EZXC 4TSFD 1UTPA 5FPTA 5F8XA 1PQ7A 4I8KA 2RDLA 4K69A 1O31A 1FIZA 3MQKC 1O2XA 1EATA 3PTBA 3M5LA 1C1OA 3SU4A 2A4GA 1GMCG 2BX4A 1NO9H 2O8WA 1XUJA 5I25A 1ETTH 4ABEA 1O5BB 2AFQB 1XUHA 2V35A 5JB8S 3SU3A 1BQYA 1O3KA 4ZMAH 3F9GA 1VITH 4Y79A 1IHSH 5DKMA 2JH6D 1GJ5H 3UR9A 4Y76A 3BIVH 2W6JD 4LK4A 1ID5H 2CHAC 1GCDA 3S7KB 3EYDA 1ELVA 1O3PB 2J9NA 1P2KA 1T31A 2VIVA 1T4VH 2NU2E 2EI7A 1FY4A 1HUTH 2WUBA 4RI0A 4DG4A 1TIOA 3ZZ5A 1F7ZA 1GI4A 1F0TA 2GCTB 4O9VA 5BPEA 1HAGE 3IITA 2PSYA 3SU1A 1YCPK 4THNH 5CHAC 1KDQB 1B5GH 5T6FA 1MZDA 3HGPA 3V7TA 4BTUB 1L1GA 1O3CA 1JMOH 1TNJA 4Z6AH 5EU8A 4AN7A 1B0FA 4VGCC 1JRTA 4I8JA 3TH3H 3TNSA 1HLTH 2SGFE 2F9PA 3S9AA 1FN8A 1PQ5A 1HV7A 1O2VA 1GHWH 1KTSB 4D7FA 1A7SA 1BTXA 1MAYA 1D9IA 2BY6X 1V2ST 1V2WT 2R3YA 1LQDB 1EP6A 5AFZH 3JZ2B 1RD3B 3F9EA 1GHBF 1NFUA 3VB6A 1S0RA 1P10A 5GWZA 1NBME 3ZZAA 1SGFG 3RXJA 3I78A 4KTSA 1MU8B 1CBWB 2FESH 2GV6A 3SJ9A 4RKOB 2EA3A 5DP8A 1SHHB 1O5AB 1P02A 1EJMA 5C2ZA 3GDSA 1S83A 1P2IA 4X8UH 2BXTH 1Y3WA 2FS9A 2GZ8A 2Y80A 1HIAB 2G5VA 3SO3A 3L6PA 1JWTA 1C5QA 1OP8A 4FVBA 4UONA 2ZECA 1Y59T 1RJXB 2JIZD 5ESTE 3OTJE 3KQEA 3VB5A 1P3CA 2FMJA 3RXAA 2BZAA 5B6OA 1VJAU 3QZRA 3H7OA 3RMNH 1E35B 1ABJH 2CJIA 1BHXB 1GGDB 1S0QA 2WZQA 3VB4A 4CH8B 3BTWE 4HFPB 1LHCH 1A4WH 7GCHF 1ZMLA 1HAVA 2YNBA 3UTUH 5AFYH 2G4UA 4AFZA 1AO5A 1YM0A 2XTTB 1C1SA 2HLCA 3KQCA 4OS5A 5GPIB 3FO8D 2F9UA 3IWMA 3S69A 2BQ6B 3JZ1B 5JB9S 1AKSB 1Q31A 4XBBA 1XUIA 3T25A 1TE0A 5EGMA 5F03A 1AFQB 2BDAA 4TPIZ 1S81A 2FI3E 5C67A 3RXUA 1MD7A 1WOFA 1P9UA 2JJ1D 4ZHMU 4ABGA 3SU2A 1MKXH 1DITH 1O3JA 1CBWC 1ZMNA 2AMQA 1AUTC 1D3QB 2VINA 5EOKA 5E0HA 2C3SA 1IQLA 2FI5E 4LZ4B 5FPSA 1YPGH 1E79D 3U1IB 4K2YA 1DXPA 1FN6A 1ELBA 4I86A 1GMHG 1ETRH 1A0JA 1MBMA 2OUAA 1BT7A 1C1MA 1LHGH 1BRUP 2ZHEH 3ATIA 4E06H 1ELFA 5EJ1A 1D3PB 1GVLA 2BOKA 1PPFE 1AVGH 1J17T 1E38B 4AGJA 5FCRA 1VITG 1GGDC 4RKJB 3BEIB 4X1QU 1GI6A 1TNIA 3STJA 5FX6A 1QB6A 2A2QH 4ABJA 2G81E 3ZZCA 1KLJH 1L2EA 3D65E 2QF0A 3RXFA 3KHVA 1O5GH 1O2JA 1EXFA 1OOKB 1QRZA 1O32A 1O2WA 1CU1A 1UMAH 1QQUA 3RU4D 1S82A 2BY9X 1ANBA 3PYHA 4YESB 2QYIA 1W0KD 3F6UH 1DY9A 1AFQC 4XDEA 4WY3A 3S0NA 1FPHH 2PR3A 4XOJA 3QWCH 3RXGA 1BZXE 4P02A 2F4LA 3E16B 3H09A 2WSSD 1TRMA 4TWYA 1ZSKA 1S5SA 1AVWA 3M3VA 4ABBA 2KAIB 4FUGA 1COWD 3MNXA 1O3AA 5F8ZA 1UTNA 2WPJS 1DWBH 2OXSA 2ZZUH 4U01A 4AOQA 2BD2A 4BNRA 1YP9A 1QURH 1YC0A 1Z6EA 1MABB 1YCPH 3M35A 1IHTH 2ZPSA 2J98A 4WXVA 1CA8B 1ZYOA 3LGWA 4WVPE 5E2PA 2QN5T 3F2FA 1SLUB 1QA7A 1PQAA 3SBKA 1ZGIA 1QL8A 1S6FA 1O36A 2Z9GA 1FXYA 2F3CE 3RUOA 1C1VH 1GBLA 1MAXA 1EJNA 3P95A 4MNWA 4U32A 4RT1A 1LTOA 2ESTE 2V7QD 2TPIZ 3BV9B 1TNKA 2H6MA 1MD8A 2HPPH 3Q00A 1GHBG 3GDUA 1RRKA 1O5FH 3MH7A 3DSOA 3MHWU 3A8BA 3DHKH 1EPTA 1QBNA 4Q4LA 1XXDA 5TCAA 3H5CB 1C4U2 1XMNB 2BDBA 1Y3VA 3NWUA 5T6GA 3TJOA 2Z94A 2C4FH 1YF4A 3VG8A 5HKKD 1TOMH 1UO6A 2VIPA 1NS3A 1L0ZA 3PWCA 1BITA 1ZOMA 4Q2KA 1G3CA 4FUCA 1V2VT 2BB4A 1C2HA 1DPOA 5T1VA 3E0PB 3VXEH 5EIYA 4ABAA 4AB8A 3UUZA 3UNSA 4BAKB 5EQQA 1AFEH 5ETXA 5HMAA 1CSOE 6GCHF 3KCGH 3SNEA 3AVZA 1W8BH 1BTPA 1FNIA 1VR1H 2A4RA 3LONA 2BTCE 4E05H 4AX9H 2GJGA 1HAXB 3MO6A 4XRNA 2V0BA 7GCHG 5KECA 2FM2A 5F53A 3PV2A 1GI5A 1N8OB 1UK4A 5IYTA 3SUGA 2NU1E 3P8NA 1F2SE 3EAJA 3QZQA 3AASA 4Q7ZA 3FP8E 4JYTA 2GZ9A 1QFKH 3GY8A 2ANYA 3B9FH 3UY9A 1H8DH 2ZDLA 1AN1E 1FAKH 3WWBA 3CS7A 2WYGA 1ELCA 4ZAEA 4A5TS 1SLWB 3RU4T 2XC4A 3SUDA 1Z8GA 3FP7E 1NFWA 1MH0A 1V2TT 1ZJKA 2ZFSA 4TPYA 4OS4A 1NRQH 1BRAA 1ZZZA 2Y81A 1F5LA 2R3UA 2Z7FE 1BA8B 1RXPA 2R9PA 3M5MA 2QV1A 3UPEA 3PO1B 1H8HD 3SGBE 3UNQA 3U98H 4SGAE 1XVOA 1C1UH 1LVOA 3P8GA 4I32A 2H5CA 5LH8A 1P01A 2GGVB 1DUAA 3F9HA 1HXEH 3LU9B 2CV3A 3AAVA 1L4ZA 4OM9A 5EXMA 2ANKH 1MTNB 2GVFA 4I31A 2ZF0H 3K9XB 4F4OC 2ZDAH 5J4SA 5T3HA 3Q3KA 1P04A 1PYTD 3QDZB 2YMSD 2ZGHA 2F91A 1BTWA
chains in the Genus database with same CATH topology
5HM9A 1N8OC 2VJ1A 4ZUHA 1V2OT 4FUHA 5GIBA 4ISOA 1JIRA 1G2MA 2FYQA 1TB6H 1VGCB 4GUXA 2ZCLP 3MU4A 1TABE 2XBVA 1C2LA 3UFAA 3CS0A 4DCDA 3BTTE 2J2UA 2CXVA 2OC7A 4FUBA 1MU6B 4NSVA 2Z3EA 2WPHS 8ESTE 3A7WA 2FZZA 1E37B 2ODQA 2OC0A 1LO6A 2ZHQH 4D9QA 3G01A 5JBCS 2BD3A 2FTLE 1ORFA 1LHEH 3RXCA 4A92A 1HAIH 2RCEA 3MMGA 1ELGA 3DT0H 2HOBA 4TYDA 4NA7A 1O2GH 4NG9H 3QGJA 3SJIA 1O2NA 4Q80A 1MTSA 3PO1C 1AWHB 1C4Y2 4ISHH 5JBBS 2A4OA 2PWXA 2BM2A 2OTVA 5TJXA 4TY6A 3TK5A 4BTTB 2H5DA 1DY8A 3A7ZA 3U69H 1DWEH 1TNGA 4MNXA 4CRAA 1MTNC 1O2MA 3BTKE 3HPTB 3BN9A 3KGPA 2WPMS 1C2KA 1GVKB 4ZKSU 1O3NA 2J95A 1IOEA 2H2ZA 1F5KU 1A0LA 1ZPBA 2M5TA 1VGCC 2JETB 4YZUA 3E0NB 1BJVA 2XYAA 1FLEE 1KIGH 1KYNA 3SU6A 1YBWA 1FY8E 2Z9IA 3RXDA 1T8OA 3V3MA 1BMLA 1AZ8A 1O2UA 2A0QB 1AE5A 1V2UT 2TGDA 3MNBA 1C2JA 3S9BA 1H9LB 1SLVB 1K21H 3K65B 4LOYH 3I77A 1OWJA 2ZC9H 4K3JA 2G51A 3E91A 1AE8H 3KIDU 6LPRA 5E0JA 4AG2A 3SNDA 3C27B 2HVXA 2CN0H 2O8LA 2THFB 1BTUA 2G55A 1EOJA 4JMYA 1J14A 2HALA 2AEIH 1SI5H 2PKSB 1O2QA 1EAIA 1OP0A 4FUDA 2FYRA 3QTVH 4K8BA 2ZU4A 3RXOA 4MLFB 2F9OA 4UFDH 1DX5M 2PLXA 2PSXA 1C5UA 1NZQH 3DUXH 1SGQE 1LVYA 4PROA 3TIUA 1WQVH 5AVDA 3M37A 3B8JA 1SOZA 2RA0A 3M3SA 3AW1A 4JYUH 1BMMH 1JRSA 1QB9A 1T8NA 1CGIE 1GI2A 5LPEA 2FOFA 1PPGE 3K6ZA 2BQ7B 3QTOH 2BY7X 1KY9A 1WU1A 1E0FD 1OWHA 1B7XB 2JETC 1D4PB 5IDKA 3TGKE 4BANB 4DGJA 1HBTH 4A1VA 1ZTKA 1H8IH 2ASUB 1D3DB 2P3FH 1BCUH 2ZHFH 2ALVA 3V13A 1AQ7A 4D9RA 2I6QA 2BX3A 1A3BH 2CGAA 2GZ7A 2A2XH 2HGTH 2PKAB 1EZUC 1C5NH 4CHAB 1GMHF 1PJPA 3M7TA 1GL0E 1RGQA 4QT8C 3HK3B 1HAOH 1GI9B 3OY5U 1FIWA 1OX1A 2PTNA 1WYKA 2GX4A 3ZZ8A 4E7NA 1KXDA 3UQVA 3MH4A 3RXQA 2VNTA 3ZZBA 1FMGA 1S84A 2YOLA 1JOUB 3MH5A 2PKSC 1ESBA 1LVBA 1BDAA 4KP0A 1VITF 2ZDMA 1SMFE 4Z0KA 1TBQH 2ZGXH 1HFDA 4JK5A 4E7RG 3A85A 1MBQA 1VZQH 1GJ9B 4FUIA 1TNHA 3HATH 3SV9A 2NWNA 1DE7H 1TMUH 3BTEE 4NCYA 2J92A 4R8TB 4NWKA 4D76A 3R0FA 4MPXA 1EZSC 1QJ7B 1IAUA 1KLTA 4OS7A 4IN1A 1OYTH 1AVXA 3NUMA 2ZNKH 2D1JA 1OWKA 5C20A 2B8OH 2NU3E 2FLBH 2TGTA 3BEUA 4K1SA 1KXCA 1O3GA 3W95A 1BJUA 1FDPA 1MQ5A 1TGTA 1EOLA 1RIWB 2G00A 2FOHA 5GXPA 5A2MH 1C4V2 4CH2B 5AHGH 1TGNA 4MNVA 1GDUA 5HGGA 1GI0A 1C2EA 3PMHB 2Y7ZA 3SJ8A 2Y7XA 3LGTA 3SUEA 1V6DA 2AGEX 2SGEE 1HGTH 4UEHH 3NPSA 4NA9H 4O97A 5DGJA 1CO7E 3EDXB 3MH6A 4CHAC 1C5XB 4A1TA 4B75A 1K2I1 3CENA 2FOMB 3A81A 1HIAA 2YNAA 2BOHB 4FVDA 1N6XA 3D62A 1W7XH 3PMJA 1SLXB 4KTUA 2IJOB 2QGRA 4I7YH 1D6WA 2ZEBA 3M5NA 3OYPA 1UTOA 3A83A 5PTPA 3LC3A 7ESTE 1DVAH 1WTGH 4D8NA 4OS2A 4XFQA 1GBHA 1PQ8A 1BMAA 1ZHPA 1QNJA 2A32A 2ZGCA 3ATMA 3EA9A 3SV2H 1ZSJA 1IQFA 2ZFFH 3ZVFA 4OS6A 3RM2H 5JYIA 4YOJA 3Q76A 1P0SH 2QF3A 4IC6A 4MPVA 2VWNA 1ZJDA 2BXUH 1YLCA 1WBGB 2CF9H 2ODYB 4FXGH 1J15A 1AGJA 2P59A 1G37A 2FS8A 1NFXA 1UK2A 3PMBB 1K1MA 1OXGA 1IQGA 1PPEE 4MPUA 3HGNA 1RIWC 4D7GA 1TX6A 1XM1A 5FPYA 1MMJN 2P16A 1O37A 1EP5A 1FZZA 4YO9A 2GCTC 1QR3E 2JKHA 3ZVCA 1GBKA 3PMAB 3R3GB 1GI8B 2ZI2H 4ABFA 2C8YB 2UUFB 5C1XA 1EB2A 3GYLB 1KXBA 4WWYA 1AUJA 1O2KA 2BDGA 1QA0A 4TY7A 5DP7A 3RXPA 4MTBA 1THSH 2AS9A 3LGIA 4KGAA 1Y5AT 4KTCA 1Z6JH 4GPGA 1EAWA 4BXSA 3PV4A 1V2KT 4MG3A 2ZFRH 1BIOA 4B2BA 2GT8A 5EODA 3AAUA 1RTFB 4UFGH 2OQ5A 1SGDE 3E3TA 5A0CA 1IQIA 1LCYA 2FOEA 3RLYH 5K0HA 2G52A 1SGFA 4X1PU 1XVMA 3SUFA 4NSYA 5A8ZA 1INCA 1GHAG 3RXIA 2ZU5A 4UFEH 1TGSZ 4X2WA 2DE9A 3A89A 2ZHWH 4NIXA 5FBEA 1MUEB 2AIQA 1KLIH 1C5RA 4CRFA 2Y6TA 1K28D 1ZPCA 3RC6A 4DOQA 2PGQB 1H4WA 3U9AH 1GL1A 1AHTH 2RA3A 1O5CB 1GCTB 2ZCHP 3TU7H 3PWBA 2XBWA 3RXEA 1ESTA 1W12U 2FOBA 1GJAB 1W0ZU 4X1NU 1OP2A 2PHBA 1AD8H 5C5OA 5A0AE 1WSSH 1HAVB 1S85A 2CMYA 4OS1A 1ACBE 1V2PT 1LQEA 4NFFA 5EPNA 3TGIE 4YM9A 2UUJB 1SQTA 2VB0A 3UOPA 1NESE 1TRNA 1SL3A 3RMLH 1OSSA 2VGCB 1ARBA 1GJ6A 5DP6A 3A87A 1ANEA 1RS0A 1TBRH 1XUGA 2ZTZA 2ULLA 1T7CA 1CHGA 1O30A 1ZTJA 1W11U 1C1TA 4CREA 3KL6A 5DG6A 2ZU1A 3TH4H 2B7DH 1C5YB 1CVWH 2AGGX 4AZ2B 1TALA 2ZWLH 2DE8A 1ELAA 2XWAA 2FTMA 3ZZ4A 2UWLA 4K8YA 1SQOA 3VGCB 4I8LA 4MNYA 4X8TH 4AFSA 2ZGJA 2ZU2A 2GP9B 4NA8A 4IW4E 4DURA 4X6PA 3ELAH 1GI7B 3FP6E 2SNWA 3QUMP 1XX9A 1A5GH 1GCTC 1XXFA 4YTAA 1GHYH 2ZTXA 1V3XA 2H9TH 1O3DA 5L2ZH 1H1BA 4K60A 1G3BA 3OU0A 1NFYA 5A8XA 3LJOA 3EA7A 4AYVB 4JZ1A 2J38A 3T2NA 3A84A 1RTKA 4A1XA 5H4IB 1CA0B 4Y8YA 5HYOA 3ZZ9A 1W13U 1GBCA 1E36B 1HAHH 4NWLA 2SGAA 3LDXH 5F6MA 2VH6A 3ENSB 2OBOA 1FY1A 2VGCC 1CGJE 4LZ1H 5EG4A 5EQSA 3BTGE 3RP2A 2OLGA 5DPAA 5EXLA 3QO6A 4FUFA 1YCPM 1CHOG 2R2MB 5DK1A 1QBVH 1K1NA 2Y5FA 1SPJA 1O2YA 1TYNA 1ZRBA 2Q6DA 1OPHB 1QGFA 2BLQA 1V2NT 3BG8A 4WF8A 6CHAB 3F1SB 4GHQA 3Q3YA 3ESTA 1YPEH 2HNTE 1TFXA 3VGCC 1O3OA 3KN2A 3A80A 1ELDE 3RXLA 1O39A 2BY8X 1NN6A 1ELEE 2O8TA 2IOTA 3OX7U 1GJBB 2ZFTA 1P05A 3A86A 3FZDA 1DLKB 1L4DA 2BLVA 4H6SB 1ZMJA 1X7AC 2PGBB 2Z9LA 4K5ZA 1HJAB 2P94A 2RG3A 4IBLH 2G4TA 2ZQ2A 1YGCH 1Y8TA 4DY7B 3T5FH 3W94A 1AZZA 3N7OA 1QRWA 1LHFH 4BAOB 1QTFA 2B0FA 1EPTB 3M3TA 1PPCE 2ZU3A 2C8WB 4ZKNU 1A2CH 5FHTA 2ALPA 1C2MA 3FAOA 1HCGA 2P3TB 2R0KA 1SGIB 1UK3A 3Q3XA 2AMDA 7KMEH 4AB9A 4YT7H 2Z6BD 4IC5A 5L2YH 1G9IE 3BTQE 1WAYB 1FY3A 4Q7XA 7LPRA 1YPLH 1C5WB 2XC0A 4DVAU 1QY6A 1GMDF 3MTYA 5C1YA 3SQEE 5JBAS 1EAXA 1NM6A 1GJDB 1VCPA 3LOXA 4DT7B 6CHAC 2WYJA 1IQKA 4U2WA 2Q6FA 1TA2A 1TPOA 1W7GH 1GI1A 3T26A 1HDTH 4GCHG 4ABDA 4CRDA 1PPZA 2ZG0H 2OQUA 3E6PH 4ISNA 1TLDA 2STAE 5K7RA 5DP4A 4FU9A 1HJAC 1YPKH 1KXEA 3MU1A 1ELTA 1C5LH 1BHXF 3UOUA 3A7XA 3ATLA 3ZV8A 3U8TH 3SN8A 3ODDA 1TAWA 1GBEA 3PTNA 1EPTC 2Z9KA 3ITIA 2Q6GA 3U8RH 3T28A 4XSKU 4R0IA 2BD8A 2ZIQH 3VXFH 4GAWA 1C5ZB 1SFQB 2GDEH 3IG6B 3TGJE 1O2RA 2P95A 2LNCA 1IQHA 1PYTC 1JBUH 1RTLA 1SGNE 3BG4B 1A1RA 2OBQA 5EPYA 1SGCA 3OY6U 1SHYA 3TPIZ 2AIPA 1QB1A 1DWCH 2SGPE 1OKXA 1EQ9A 3SGQE 3TJVA 3RMMH 2F9NA 3SNAA 1HPGA 3GY5A 1AU8A 2FX6A 1VCWA 4OGXA 4MDSA 1ZR0A 1TMBH 1MCVA 2BDIA 1WUNH 1C5SA 4JK6A 1UVTH 1OYQA 4A7IB 4BAMB 3P70B 2WINI 1TWXB 1G32B 4ZXYH 2XCFA 4FUEA 1G2LA 3TJUA 4NIWA 2XCNA 4X2YA 1HAYB 4ABHA 3SI4H 5A09A 4GLYA 5G4BA 2BHGA 2VU8E 1FPCH 1GBJA 5LPFA 1AWFH 4NFEA 1BTYA 1T32A 3GCTG 1SFIA 1TPSA 1SC8U 2AMPA 4I33A 1FI8A 2BYAX 4ZHLU 2G8TA 5J4QA 3BSQA 2W3IA 1TBZH 2V3HH 2ZA5A 4O3UA 3A8AA 2ZPRA 3HKJB 2WV5A 3H7TA 3UWJH 4DIHH 3BG4C 1WCZA 3GISB 2P8OB 1ZLRA 1S6HA 4J1YA 2Y82A 1C5MD 3SGAE 4B71A 2QY0B 1C1RA 2A5KA 4CR5A 1DICA 1HYLA 4NIVA 5FCKA 1Z1IA 1QBOA 4WH6A 1TPAE 3LH3A 1GJ7B 2QCYA 1DSTA 1IQEA 3NCLA 2WV4A 2D8WA 5C1UA 1C9PA 2XWBI 3UREA 2GDDA 3GYMA 1YYY1 4BAHB 2FI4E 3BTDE 3MWIU 1H9IE 2EI6A 1WV7H 1P06A 4UFFH 1TA6A 3UQOA 1HJ8A 4GSOA 1ANDA 1WTHD 1GG6B 2OP9A 3ZYDA 3GY4A 1C5PA 3L33A 2ODPA 2ZKSA 1Y3YA 1OS8A 4Y71A 3DD2H 5EW1H 3EA8A 4F49A 4GVUA 5I46H 4NZQA 2BVXH 1FY5A 2SGQE 1T8LA 1L1JA 1GHAF 1UJ1A 3SU0A 3A82A 2O8UA 1EZQA 2J94A 1QL9A 1A61H 1ZHMA 1W3CA 1GMDG 2BZ6H 2XRCA 1CGHA 1HB0B 4AFUA 3LC5A 4X2XA 3EQ0H 2QAAA 3MU8A 3SNCA 1THRH 1GBAA 1UVOA 4M7GA 1HAPH 4X6OA 1JIMA 3P6ZB 2W26A 1EUFA 2FX4A 3MOCA 1O2HA 1XUKA 2EEKA 3S7HB 1IQMA 2VVVA 4UE7H 3TJNA 1C1WH 3P8OA 2D2DA 3LGUA 2BDYA 2JH0D 3MFJA 3NZIA 4SGBE 5SGAE 1KDQA 2A7HA 8KME2 1XUFA 1O2LA 3STIA 1GBDA 3RXTA 3QLPH 5L6NH 1GJ8B 1SGEE 1UHBB 1C5OH 4AFQA 4CRGA 1CT0E 1GG6C 1P2JA 2VWLA 3E1XB 4LXBH 1DXWA 4WMDA 1GJCB 4INLA 1GI3A 2GV7A 1UTMA 2AGIX 2A7JA 1TX8A 3O8BA 3D23A 4B2CA 3Q77A 1TGCA 3V12A 3SV8A 4B1TA 2UWPA 3A8CA 4BTIB 1A0HB 4MPWA 1SBWA 1F0UA 3SJOA 1T4UH 2GCHG 4FU7A 1P2QA 4ZHAA 3U8OH 3RC4A 4CR9A 1SGPE 1DANH 4X6NA 1ETSH 3RC5A 1V2QT 2FPZA 1K9OE 2BD7A 1LKBA 1UVPA 5F8TA 4ZKOU 1UVSH 4JZFH 3PM3A 4RSPA 1IQNA 4INHA 2FP7B 2A7CA 2A1DB 1LHDH 2QXGA 3SOSA 5BRRE 2TGAA 1QCPA 1O3EA 2WUCA 3LH1A 4ISLA 3TVJB 1LDTT 3BTME 5JPMH 1GBFA 1SVPA 2HNTC 2PFEA 1O3FA 1O3LA 3MU5A 2VIWA 2B5TB 3LT3A 4ESTE 4KKDA 1ANCA 5ABWA 3M7UA 4Y8ZA 3KEEA 4HGCA 2J34A 4IMQA 1MKWK 3K2UA 5JDUB 1C2GA 1GBTA 1CHOF 5EXNA 1LMWB 2QA9E 1AKSA 1J16A 2IPHA 1GHVH 4Q7YA 2XW9A 2ZTYA 3SU5A 3ZVEA 2XBYA 1AI8H 1FV9A 3ZVBA 1GBBA 4B74A 4FUJA 4XBCA 2SFAA 3TNTA 1BTZA 1EB1H 8LPRA 4X8VH 2Q1JA 2ZO3H 3DA9B 4AG1A 1LPZB 4UD9H 3BEFB 1FQ3A 2UUYA 1O5EH 1C1NA 2A45B 3SW2B 5GCHG 1AIXH 4YOIA 1THPB 4I8GA 1FJSA <