1SGYI

Tyr 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b at ph 6.5
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
51
structure length
51
Chain Sequence
VDCSEYPKPACTYEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recruitment of a Buried K+ Ion to Stabilize the Negative Charge of Ionized P1 in the Hydrophobic Pocket: Crystal Structures of Glu18, Gln18, Asp18 and Asn18 Variants of Turkey Ovomucoid Inhibitor Third Domain Complexed with Streptomyces griseus Protease B at Various pH's
rcsb
molecule keywords Streptogrisin B
molecule tags Hydrolase/hydrolase inhibitor
source organism Meleagris gallopavo
total genus 12
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 1999-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1sgyI00
1CE3A 5DAEA 2GKRI 1CHOI 2WCYA 2KMPA 2BUSA 1N13A 1CT4I 2JZMA 2KMRA 1CGJI 1YTPA 4HGUA 4SGBI 3SGQI 1LR8A 1SGPI 2NU3I 1PPFI 1KMAA 2B0UC 4GI3C 1BUSA 2GKVA 3SEKC 2NU4I 3SGBI 3B4VC 1HPTA 2SGQI 2SGDI 1SGQI 1UVFA 1M8CA 1CT0I 2N17A 2JYYA 1R0RI 2KCXA 3HH2C 1TURA 1YU6C 2JXDA 1DS3I 1MT1A 1TBQR 2LEOA 2N71A 1Z7KB 2SGPI 2QQDA 1Y1CA 1DS2I 3TJQA 2M5XA 1H0ZA 1FYBA 2N52A 1IY5A 2GKTI 1CT2I 1SGEI 1AN1I 2V53A 1IY6A 1HJAI 2ERWA 1SGDI 1CSOI 1TBRR 2F3CI 1NUBA 2P6AC 1TGSI 1IW4A 1SGRI 1UUCA 3OVOA 1HDLA 2QQCA 1TIHA 1CGII 2NU2I 1OYVI 2KMQA 1LR7A 1PCEA 2OVOA 2KMOA 1OVOA 1TUSA 1SGYI 1Y1BA 3QTLD 1UVGA 1PJUA 2NU0I 2XRCA 1LR9A 4OVOA 5JHWC 2SGFI 1OMUA 2NU1I 1BMOA 2ARPF 1SGNI 1M8BA 2SGEI 1OMTA
chains in the Genus database with same CATH superfamily
2E73A 1CE3A 5DAEA 2GKRI 4E1RA 2X52A 1CHOI 1FAQA 1PTRA 2PQ8A 2WCYA 2KMPA 1WKXA 2BUSA 3OXLA 3UGLA 3D00A 1P9GA 9WGAA 1N13A 1KBFA 1MJ9A 4L9MA 1ULNA 2GVIA 5HQ8A 1UHAA 1CT4I 3PDNA 1WGTA 2RC4A 2V1CA 2JZMA 2KMRA 1CGJI 1YTPA 4HGUA 2FNFX 4SGBI 1ULMA 3SGQI 3QWPA 3OL0A 5FUXA 1Y8FA 2JA1A 1VDDA 1LR8A 2UZ3A 1SGPI 2L7XA 1MJAA 4JCVE 5CCLA 2NU3I 1PPFI 1WGCA 3MEKA 5EX0A 3TOBA 3TO9A 1KMAA 1XBTA 2B0UC 2W0TA 1V1IA 2WVJA 3R5DA 4GI3C 7WGAA 1BUSA 2GKVA 2DKVA 2CWFA 3R5AA 3UEYA 2CWHA 3OXFA 2E5RA 2YQPA 3RU0A 3SEKC 1X4SA 2QQ0A 2NU4I 3GOXA 3SGBI 3B4VC 2WGCA 1HPTA 2SGQI 2SGDI 2Y0MA 2L8EA 1SGQI 1MJBA 1W3SA 5J8FA 1UVFA 1CT0I 1M8CA 2N17A 3TO6A 2V1CC 3UGIA 3TOAA 1K7TA 1S20A 1R0RI 2JYYA 4UXIA 2KCXA 3HH2C 2OZUA 1TURA 1YU6C 2JXDA 2QQEA 1DS3I 1MT1A 1TBQR 2LEOA 3FSYA 3UOEA 1ULKA 2UVOA 2LB7A 2N71A 4UXJA 1Z7KB 2ENNA 2SGPI 2QQDA 1TBOA 1Y1CA 5EX3A 1Q9BA 3UEJA 4AMLA 1DS2I 3OXGA 4B6DA 3UGDA 3TJQA 2M5XA 1H0ZA 1FYBA 2N52A 1IY5A 2GKTI 1XA6A 1CT2I 4UXHA 1TOTA 1SGEI 3KY9A 3E2IA 1X74A 2RIJA 1AN1I 2V53A 1IY6A 2VRWB 1HJAI 2ERWA 1SGDI 1CSOI 1TBRR 2CJSC 2F3CI 2J9RA 3CXLA 1K7VA 3UFFA 1NUBA 2P6AC 1TGSI 1IW4A 2QPOA 1SGRI 4A24A 2ODDA 1UUCA 2N1AB 2J87A 4DNCA 1W4RA 1WTJA 3OVOA 1HDLA 2QQCA 5HI7A 1TIHA 1CGII 1P9ZA 2YUUA 1Z2IA 2NU2I 1HEVA 2CWGA 2GIVA 5FUVA 1PTQA 1OYVI 5CCMA 2KMQA 1LR7A 1PCEA 5FUWA 4E1PA 3VDUA 3R5BA 5FUYA 1NXUA 2ORWA 2JW6A 1RFHA 1K7UA 2OD1A 2OU2A 3VDPA 2OVOA 5E3PA 2B8TA 1V1HA 2KMOA 5E3QA 1OVOA 1TUSA 1U5KA 1SGYI 1Y1BA 1XX6A 3QTLD 1UVGA 3E59A 4FKDA 3QAHA 5E3RA 3FC3A 1PJUA 2NU0I 2ENZA 2ORVA 2X3TA 2DB6A 2XRCA 1LR9A 4OVOA 5J8CA 2ELIA 2K9HA 3R5CA 2SGFI 1OMUA 1R79A 4WP4A 5JHWC 4MPIA 2DIPA 3TO7A 2NU1I 1BMOA 3BJIA 1KBEA 2ARPF 1SGNI 1TBNA 1M8BA 3VE5A 2ROWA 1FARA 2SGEI 3FSXA 1FY7A 2LUYA 2A20A 1OMTA
chains in the Genus database with same CATH topology
2E73A 1CE3A 5DAEA 2GKRI 4E1RA 1FAQA 1CHOI 1PTRA 2WCYA 3OXLA 2KMPA 2BUSA 3UGLA 3D00A 1N13A 1KBFA 4L9MA 2GVIA 5HQ8A 1CT4I 3PDNA 2V1CA 2JZMA 2KMRA 1CGJI 1YTPA 4HGUA 2FNFX 4SGBI 3SGQI 3QWPA 3OL0A 5FUXA 1Y8FA 2JA1A 1VDDA 1LR8A 2UZ3A 1SGPI 2L7XA 4JCVE 5CCLA 2NU3I 1PPFI 3MEKA 1KMAA 5EX0A 1XBTA 2B0UC 2W0TA 1V1IA 2WVJA 4GI3C 1BUSA 2GKVA 3UEYA 3OXFA 3RU0A 2E5RA 2YQPA 3SEKC 1X4SA 2QQ0A 2NU4I 3GOXA 3SGBI 3B4VC 1HPTA 2SGQI 2SGDI 2L8EA 1SGQI 1W3SA 1UVFA 1M8CA 1CT0I 2N17A 3UGIA 2V1CC 2JYYA 1R0RI 4UXIA 2KCXA 3HH2C 1TURA 1YU6C 2JXDA 2QQEA 1DS3I 1MT1A 1TBQR 2LEOA 2N71A 4UXJA 1Z7KB 2ENNA 2SGPI 2QQDA 1TBOA 1Y1CA 5EX3A 4B6DA 3UEJA 1DS2I 3OXGA 3UGDA 3TJQA 2M5XA 1H0ZA 1FYBA 2N52A 1IY5A 2GKTI 1XA6A 1CT2I 4UXHA 1TOTA 1SGEI 3KY9A 3E2IA 1X74A 1AN1I 2V53A 1IY6A 2VRWB 1HJAI 2ERWA 1SGDI 1CSOI 1TBRR 2CJSC 2F3CI 2J9RA 3CXLA 3UFFA 1NUBA 2P6AC 1TGSI 1IW4A 2QPOA 1SGRI 4A24A 2ODDA 1UUCA 2N1AB 2J87A 1W4RA 3OVOA 1HDLA 2QQCA 5HI7A 1TIHA 1CGII 2YUUA 2NU2I 5FUVA 1PTQA 1OYVI 5CCMA 2KMQA 1LR7A 1PCEA 5FUWA 4E1PA 3VDUA 5FUYA 2ORWA 2JW6A 1RFHA 3VDPA 2OD1A 2OVOA 2B8TA 1V1HA 2KMOA 1OVOA 1TUSA 1U5KA 1SGYI 1Y1BA 1XX6A 3QTLD 1UVGA 3E59A 4FKDA 3FC3A 1PJUA 2NU0I 2ENZA 2ORVA 2DB6A 2XRCA 1LR9A 4OVOA 2ELIA 2K9HA 5JHWC 2SGFI 1OMUA 1R79A 2DIPA 2NU1I 1BMOA 3BJIA 1KBEA 2ARPF 1SGNI 1TBNA 1M8BA 3VE5A 2ROWA 1FARA 2SGEI 2LUYA 2A20A 1OMTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CE3 A;  5DAE A;  2GKR I;  1CHO I;  2WCY A;  2KMP A;  2BUS A;  1N13 A;  1CT4 I;  2JZM A;  2KMR A;  1CGJ I;  1YTP A;  4HGU A;  4SGB I;  3SGQ I;  1LR8 A;  1SGP I;  2NU3 I;  1PPF I;  1KMA A;  2B0U C;  4GI3 C;  1BUS A;  2GKV A;  3SEK C;  2NU4 I;  3SGB I;  3B4V C;  1HPT A;  2SGQ I;  2SGD I;  1SGQ I;  1UVF A;  1M8C A;  1CT0 I;  2N17 A;  2JYY A;  1R0R I;  2KCX A;  3HH2 C;  1TUR A;  1YU6 C;  2JXD A;  1DS3 I;  1MT1 A;  1TBQ R;  2LEO A;  2N71 A;  1Z7K B;  2SGP I;  2QQD A;  1Y1C A;  1DS2 I;  3TJQ A;  2M5X A;  1H0Z A;  1FYB A;  2N52 A;  1IY5 A;  2GKT I;  1CT2 I;  1SGE I;  1AN1 I;  2V53 A;  1IY6 A;  1HJA I;  2ERW A;  1SGD I;  1CSO I;  1TBR R;  2F3C I;  1NUB A;  2P6A C;  1TGS I;  1IW4 A;  1SGR I;  1UUC A;  3OVO A;  1HDL A;  2QQC A;  1TIH A;  1CGI I;  2NU2 I;  1OYV I;  2KMQ A;  1LR7 A;  1PCE A;  2OVO A;  2KMO A;  1OVO A;  1TUS A;  1SGY I;  1Y1B A;  3QTL D;  1UVG A;  1PJU A;  2NU0 I;  2XRC A;  1LR9 A;  4OVO A;  5JHW C;  2SGF I;  1OMU A;  2NU1 I;  1BMO A;  2ARP F;  1SGN I;  1M8B A;  2SGE I;  1OMT A; 
#chains in the Genus database with same CATH topology
 2E73 A;  1CE3 A;  5DAE A;  2GKR I;  4E1R A;  2X52 A;  1CHO I;  1FAQ A;  1PTR A;  2PQ8 A;  2WCY A;  2KMP A;  1WKX A;  2BUS A;  3OXL A;  3UGL A;  3D00 A;  1P9G A;  9WGA A;  1N13 A;  1KBF A;  1MJ9 A;  4L9M A;  1ULN A;  2GVI A;  5HQ8 A;  1UHA A;  1CT4 I;  3PDN A;  1WGT A;  2RC4 A;  2V1C A;  2JZM A;  2KMR A;  1CGJ I;  1YTP A;  4HGU A;  2FNF X;  4SGB I;  1ULM A;  3SGQ I;  3QWP A;  3OL0 A;  5FUX A;  1Y8F A;  2JA1 A;  1VDD A;  1LR8 A;  2UZ3 A;  1SGP I;  2L7X A;  1MJA A;  4JCV E;  5CCL A;  2NU3 I;  1PPF I;  1WGC A;  3MEK A;  5EX0 A;  3TOB A;  3TO9 A;  1KMA A;  1XBT A;  2B0U C;  2W0T A;  1V1I A;  2WVJ A;  3R5D A;  4GI3 C;  7WGA A;  1BUS A;  2GKV A;  2DKV A;  2CWF A;  3R5A A;  3UEY A;  2CWH A;  3OXF A;  2E5R A;  2YQP A;  3RU0 A;  3SEK C;  1X4S A;  2QQ0 A;  2NU4 I;  3GOX A;  3SGB I;  3B4V C;  2WGC A;  1HPT A;  2SGQ I;  2SGD I;  2Y0M A;  2L8E A;  1SGQ I;  1MJB A;  1W3S A;  5J8F A;  1UVF A;  1CT0 I;  1M8C A;  2N17 A;  3TO6 A;  2V1C C;  3UGI A;  3TOA A;  1K7T A;  1S20 A;  1R0R I;  2JYY A;  4UXI A;  2KCX A;  3HH2 C;  2OZU A;  1TUR A;  1YU6 C;  2JXD A;  2QQE A;  1DS3 I;  1MT1 A;  1TBQ R;  2LEO A;  3FSY A;  3UOE A;  1ULK A;  2UVO A;  2LB7 A;  2N71 A;  4UXJ A;  1Z7K B;  2ENN A;  2SGP I;  2QQD A;  1TBO A;  1Y1C A;  5EX3 A;  1Q9B A;  3UEJ A;  4AML A;  1DS2 I;  3OXG A;  4B6D A;  3UGD A;  3TJQ A;  2M5X A;  1H0Z A;  1FYB A;  2N52 A;  1IY5 A;  2GKT I;  1XA6 A;  1CT2 I;  4UXH A;  1TOT A;  1SGE I;  3KY9 A;  3E2I A;  1X74 A;  2RIJ A;  1AN1 I;  2V53 A;  1IY6 A;  2VRW B;  1HJA I;  2ERW A;  1SGD I;  1CSO I;  1TBR R;  2CJS C;  2F3C I;  2J9R A;  3CXL A;  1K7V A;  3UFF A;  1NUB A;  2P6A C;  1TGS I;  1IW4 A;  2QPO A;  1SGR I;  4A24 A;  2ODD A;  1UUC A;  2N1A B;  2J87 A;  4DNC A;  1W4R A;  1WTJ A;  3OVO A;  1HDL A;  2QQC A;  5HI7 A;  1TIH A;  1CGI I;  1P9Z A;  2YUU A;  1Z2I A;  2NU2 I;  1HEV A;  2CWG A;  2GIV A;  5FUV A;  1PTQ A;  1OYV I;  5CCM A;  2KMQ A;  1LR7 A;  1PCE A;  5FUW A;  4E1P A;  3VDU A;  3R5B A;  5FUY A;  1NXU A;  2ORW A;  2JW6 A;  1RFH A;  1K7U A;  2OD1 A;  2OU2 A;  3VDP A;  2OVO A;  5E3P A;  2B8T A;  1V1H A;  2KMO A;  5E3Q A;  1OVO A;  1TUS A;  1U5K A;  1SGY I;  1Y1B A;  1XX6 A;  3QTL D;  1UVG A;  3E59 A;  4FKD A;  3QAH A;  5E3R A;  3FC3 A;  1PJU A;  2NU0 I;  2ENZ A;  2ORV A;  2X3T A;  2DB6 A;  2XRC A;  1LR9 A;  4OVO A;  5J8C A;  2ELI A;  2K9H A;  3R5C A;  2SGF I;  1OMU A;  1R79 A;  4WP4 A;  5JHW C;  4MPI A;  2DIP A;  3TO7 A;  2NU1 I;  1BMO A;  3BJI A;  1KBE A;  2ARP F;  1SGN I;  1TBN A;  1M8B A;  3VE5 A;  2ROW A;  1FAR A;  2SGE I;  3FSX A;  1FY7 A;  2LUY A;  2A20 A;  1OMT A; 
#chains in the Genus database with same CATH homology
 2E73 A;  1CE3 A;  5DAE A;  2GKR I;  4E1R A;  1FAQ A;  1CHO I;  1PTR A;  2WCY A;  3OXL A;  2KMP A;  2BUS A;  3UGL A;  3D00 A;  1N13 A;  1KBF A;  4L9M A;  2GVI A;  5HQ8 A;  1CT4 I;  3PDN A;  2V1C A;  2JZM A;  2KMR A;  1CGJ I;  1YTP A;  4HGU A;  2FNF X;  4SGB I;  3SGQ I;  3QWP A;  3OL0 A;  5FUX A;  1Y8F A;  2JA1 A;  1VDD A;  1LR8 A;  2UZ3 A;  1SGP I;  2L7X A;  4JCV E;  5CCL A;  2NU3 I;  1PPF I;  3MEK A;  1KMA A;  5EX0 A;  1XBT A;  2B0U C;  2W0T A;  1V1I A;  2WVJ A;  4GI3 C;  1BUS A;  2GKV A;  3UEY A;  3OXF A;  3RU0 A;  2E5R A;  2YQP A;  3SEK C;  1X4S A;  2QQ0 A;  2NU4 I;  3GOX A;  3SGB I;  3B4V C;  1HPT A;  2SGQ I;  2SGD I;  2L8E A;  1SGQ I;  1W3S A;  1UVF A;  1M8C A;  1CT0 I;  2N17 A;  3UGI A;  2V1C C;  2JYY A;  1R0R I;  4UXI A;  2KCX A;  3HH2 C;  1TUR A;  1YU6 C;  2JXD A;  2QQE A;  1DS3 I;  1MT1 A;  1TBQ R;  2LEO A;  2N71 A;  4UXJ A;  1Z7K B;  2ENN A;  2SGP I;  2QQD A;  1TBO A;  1Y1C A;  5EX3 A;  4B6D A;  3UEJ A;  1DS2 I;  3OXG A;  3UGD A;  3TJQ A;  2M5X A;  1H0Z A;  1FYB A;  2N52 A;  1IY5 A;  2GKT I;  1XA6 A;  1CT2 I;  4UXH A;  1TOT A;  1SGE I;  3KY9 A;  3E2I A;  1X74 A;  1AN1 I;  2V53 A;  1IY6 A;  2VRW B;  1HJA I;  2ERW A;  1SGD I;  1CSO I;  1TBR R;  2CJS C;  2F3C I;  2J9R A;  3CXL A;  3UFF A;  1NUB A;  2P6A C;  1TGS I;  1IW4 A;  2QPO A;  1SGR I;  4A24 A;  2ODD A;  1UUC A;  2N1A B;  2J87 A;  1W4R A;  3OVO A;  1HDL A;  2QQC A;  5HI7 A;  1TIH A;  1CGI I;  2YUU A;  2NU2 I;  5FUV A;  1PTQ A;  1OYV I;  5CCM A;  2KMQ A;  1LR7 A;  1PCE A;  5FUW A;  4E1P A;  3VDU A;  5FUY A;  2ORW A;  2JW6 A;  1RFH A;  3VDP A;  2OD1 A;  2OVO A;  2B8T A;  1V1H A;  2KMO A;  1OVO A;  1TUS A;  1U5K A;  1SGY I;  1Y1B A;  1XX6 A;  3QTL D;  1UVG A;  3E59 A;  4FKD A;  3FC3 A;  1PJU A;  2NU0 I;  2ENZ A;  2ORV A;  2DB6 A;  2XRC A;  1LR9 A;  4OVO A;  2ELI A;  2K9H A;  5JHW C;  2SGF I;  1OMU A;  1R79 A;  2DIP A;  2NU1 I;  1BMO A;  3BJI A;  1KBE A;  2ARP F;  1SGN I;  1TBN A;  1M8B A;  3VE5 A;  2ROW A;  1FAR A;  2SGE I;  2LUY A;  2A20 A;  1OMT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...