1SGYI

Tyr 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b at ph 6.5
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
51
structure length
51
Chain Sequence
VDCSEYPKPACTYEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptogrisin B
publication title Recruitment of a Buried K+ Ion to Stabilize the Negative Charge of Ionized P1 in the Hydrophobic Pocket: Crystal Structures of Glu18, Gln18, Asp18 and Asn18 Variants of Turkey Ovomucoid Inhibitor Third Domain Complexed with Streptomyces griseus Protease B at Various pH's
rcsb
source organism Meleagris gallopavo
molecule tags Hydrolase/hydrolase inhibitor
total genus 12
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 1999-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1sgyI00
4OVOA 1LR7A 1PJUA 4HGUA 4SGBI 2XRCA 1UUCA 2KMOA 2NU1I 2WCYA 1HJAI 1OYVI 2NU2I 1UVFA 1TURA 2SGDI 3SGBI 2N52A 1CT2I 1CGJI 1PPFI 1LR8A 1CE3A 1YU6C 1HDLA 1OMTA 2JYYA 1SGQI 2BUSA 3OVOA 1IY5A 2NU4I 1N13A 1SGDI 2F3CI 2SGPI 1FYBA 1CHOI 2GKRI 5DAEA 1UVGA 1CT4I 2JXDA 2LEOA 2V53A 1LR9A 1SGYI 2SGFI 1TGSI 1MT1A 1YTPA 1M8BA 1SGRI 1SGNI 3B4VC 1BMOA 3SEKC 2M5XA 1R0RI 2GKTI 4GI3C 1AN1I 3SGQI 2NU0I 2OVOA 3HH2C 1SGEI 1NUBA 1CGII 1IW4A 1HPTA 2KMRA 3TJQA 2ARPF 2KCXA 2NU3I 1SGPI 1OMUA 2ERWA 2QQCA 1Y1CA 3QTLD 2JZMA 2N71A 1H0ZA 2KMPA 1CSOI 2N17A 2B0UC 2QQDA 1M8CA 2KMQA 1DS2I 1Y1BA 2GKVA 1TBQR 2SGQI 5JHWC 1DS3I 1TUSA 2P6AC 1CT0I 1Z7KB 2SGEI 1OVOA 1TIHA 1PCEA 1KMAA 1BUSA 1IY6A 1TBRR
chains in the Genus database with same CATH superfamily
4OVOA 1LR7A 1PJUA 4HGUA 4SGBI 2OZUA 2XRCA 1UUCA 1MJBA 2ORVA 3KY9A 2KMOA 1TOTA 1Q9BA 2NU1I 3QWPA 2ORWA 3FSYA 3R5BA 1MJAA 2WCYA 2J87A 1HJAI 1OYVI 2NU2I 2ENZA 1UVFA 1TURA 1W3SA 2SGDI 4UXIA 2DKVA 2YUUA 5E3PA 3SGBI 3VDPA 2DB6A 2ELIA 4AMLA 2WGCA 2N52A 4B6DA 1CT2I 1CGJI 1PPFI 3FSXA 7WGAA 2E73A 1X74A 2CWFA 2UZ3A 1LR8A 1CE3A 1WGTA 3VE5A 1YU6C 1HDLA 2ENNA 1OMTA 3UOEA 2JYYA 1SGQI 3VDUA 1K7TA 2BUSA 3OVOA 4A24A 3R5CA 1IY5A 2NU4I 1TBOA 1ULKA 1P9GA 1N13A 1SGDI 3OXFA 2X3TA 2F3CI 2VRWB 5FUYA 3UGLA 5E3QA 3UFFA 2SGPI 2X52A 1FYBA 1CHOI 4L9MA 2A20A 2J9RA 3OXGA 2GKRI 2CJSC 5FUVA 3TO7A 3FC3A 1XX6A 1UVGA 1CT4I 1Y8FA 5DAEA 5HI7A 3UGIA 5J8FA 2JXDA 3OL0A 1W4RA 2LEOA 1ULNA 2V53A 1HEVA 1LR9A 2DIPA 2UVOA 2ROWA 1FY7A 3UGDA 4E1PA 3R5AA 1SGYI 2ODDA 2SGFI 1WKXA 2V1CC 4E1RA 1U5KA 1TGSI 1MT1A 3D00A 2L7XA 4JCVE 1YTPA 1M8BA 5HQ8A 5FUXA 1SGRI 1SGNI 1WTJA 1V1IA 3B4VC 1KBFA 1BMOA 2CWHA 2OU2A 3BJIA 3SEKC 2QQEA 2PQ8A 1KBEA 2B8TA 2M5XA 3UEJA 2N1AB 1R0RI 2GKTI 3TOBA 4GI3C 5CCMA 4MPIA 1AN1I 3SGQI 2NU0I 1NXUA 1ULMA 3TOAA 2OVOA 3HH2C 1SGEI 3QAHA 2WVJA 3E2IA 1NUBA 1TBNA 1CGII 3R5DA 3RU0A 2JA1A 2YQPA 1WGCA 1IW4A 1HPTA 2L8EA 2KMRA 9WGAA 1FAQA 1FARA 2K9HA 2W0TA 4WP4A 2RC4A 3TJQA 2ARPF 2OD1A 2KCXA 2NU3I 1PTRA 5E3RA 4FKDA 1SGPI 1K7VA 1OMUA 2LUYA 2GVIA 3PDNA 2ERWA 2QQCA 2QQ0A 1P9ZA 1Y1CA 1V1HA 4UXJA 1UHAA 1XA6A 3CXLA 5EX3A 2Y0MA 1X4SA 3MEKA 3QTLD 5EX0A 1PTQA 2GIVA 2JZMA 2N71A 1H0ZA 2KMPA 1CSOI 1Z2IA 2N17A 2QPOA 2LB7A 3E59A 3TO9A 2B0UC 4UXHA 2QQDA 1M8CA 1VDDA 2KMQA 4DNCA 3TO6A 1R79A 5J8CA 3GOXA 1DS2I 3UEYA 1Y1BA 2GKVA 1TBQR 2FNFX 2JW6A 2SGQI 2V1CA 1DS3I 2CWGA 5JHWC 1S20A 1TUSA 2P6AC 1CT0I 1Z7KB 5CCLA 2SGEI 1OVOA 2E5RA 5FUWA 1RFHA 1XBTA 1TIHA 1MJ9A 1PCEA 2RIJA 1KMAA 1BUSA 3OXLA 1IY6A 1TBRR 1K7UA
chains in the Genus database with same CATH topology
4OVOA 1LR7A 1PJUA 4HGUA 4SGBI 2XRCA 1UUCA 2ORVA 3KY9A 2KMOA 1TOTA 2NU1I 3QWPA 2ORWA 2WCYA 2J87A 1HJAI 1OYVI 2NU2I 2ENZA 1UVFA 1TURA 1W3SA 2SGDI 4UXIA 2YUUA 3SGBI 3VDPA 2DB6A 2ELIA 2N52A 4B6DA 1CT2I 1CGJI 1PPFI 2E73A 1X74A 2UZ3A 1LR8A 1CE3A 3VE5A 1YU6C 1HDLA 2ENNA 1OMTA 2JYYA 1SGQI 3VDUA 2BUSA 3OVOA 4A24A 1IY5A 2NU4I 1TBOA 3OXFA 1N13A 1SGDI 5FUYA 3UGLA 2F3CI 2VRWB 3UFFA 2SGPI 1FYBA 1CHOI 4L9MA 2A20A 2J9RA 3OXGA 2GKRI 2CJSC 5FUVA 3FC3A 1XX6A 1UVGA 1CT4I 1Y8FA 5DAEA 5HI7A 3UGIA 2JXDA 3OL0A 1W4RA 2LEOA 2V53A 1LR9A 2DIPA 2ROWA 3UGDA 4E1PA 1SGYI 2ODDA 2SGFI 2V1CC 4E1RA 1U5KA 1TGSI 1MT1A 3D00A 2L7XA 4JCVE 1YTPA 1M8BA 5HQ8A 5FUXA 1SGRI 1SGNI 3B4VC 1V1IA 1KBFA 1BMOA 3BJIA 3SEKC 2QQEA 1KBEA 2B8TA 2M5XA 3UEJA 2N1AB 1R0RI 2GKTI 4GI3C 5CCMA 1AN1I 3SGQI 2NU0I 2OVOA 3HH2C 1SGEI 2WVJA 3E2IA 1NUBA 1TBNA 1CGII 3RU0A 2JA1A 2YQPA 1IW4A 1HPTA 2L8EA 2KMRA 1FAQA 1FARA 2K9HA 2W0TA 3TJQA 2ARPF 2OD1A 2KCXA 2NU3I 1PTRA 4FKDA 1SGPI 1OMUA 2LUYA 2GVIA 3PDNA 2ERWA 2QQCA 2QQ0A 5EX3A 1Y1CA 1V1HA 4UXJA 3CXLA 1XA6A 1X4SA 3MEKA 3QTLD 5EX0A 1PTQA 2JZMA 2N71A 1H0ZA 2KMPA 1CSOI 2N17A 2QPOA 3E59A 2B0UC 4UXHA 2QQDA 1M8CA 1VDDA 2KMQA 1R79A 3GOXA 1DS2I 3UEYA 1Y1BA 2GKVA 1TBQR 2FNFX 2JW6A 2SGQI 2V1CA 1DS3I 5JHWC 1TUSA 2P6AC 1CT0I 1Z7KB 5CCLA 2SGEI 1OVOA 2E5RA 5FUWA 1RFHA 1XBTA 1TIHA 1PCEA 1KMAA 1BUSA 3OXLA 1IY6A 1TBRR
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OVO A;  1LR7 A;  1PJU A;  4HGU A;  4SGB I;  2XRC A;  1UUC A;  2KMO A;  2NU1 I;  2WCY A;  1HJA I;  1OYV I;  2NU2 I;  1UVF A;  1TUR A;  2SGD I;  3SGB I;  2N52 A;  1CT2 I;  1CGJ I;  1PPF I;  1LR8 A;  1CE3 A;  1YU6 C;  1HDL A;  1OMT A;  2JYY A;  1SGQ I;  2BUS A;  3OVO A;  1IY5 A;  2NU4 I;  1N13 A;  1SGD I;  2F3C I;  2SGP I;  1FYB A;  1CHO I;  2GKR I;  5DAE A;  1UVG A;  1CT4 I;  2JXD A;  2LEO A;  2V53 A;  1LR9 A;  1SGY I;  2SGF I;  1TGS I;  1MT1 A;  1YTP A;  1M8B A;  1SGR I;  1SGN I;  3B4V C;  1BMO A;  3SEK C;  2M5X A;  1R0R I;  2GKT I;  4GI3 C;  1AN1 I;  3SGQ I;  2NU0 I;  2OVO A;  3HH2 C;  1SGE I;  1NUB A;  1CGI I;  1IW4 A;  1HPT A;  2KMR A;  3TJQ A;  2ARP F;  2KCX A;  2NU3 I;  1SGP I;  1OMU A;  2ERW A;  2QQC A;  1Y1C A;  3QTL D;  2JZM A;  2N71 A;  1H0Z A;  2KMP A;  1CSO I;  2N17 A;  2B0U C;  2QQD A;  1M8C A;  2KMQ A;  1DS2 I;  1Y1B A;  2GKV A;  1TBQ R;  2SGQ I;  5JHW C;  1DS3 I;  1TUS A;  2P6A C;  1CT0 I;  1Z7K B;  2SGE I;  1OVO A;  1TIH A;  1PCE A;  1KMA A;  1BUS A;  1IY6 A;  1TBR R; 
#chains in the Genus database with same CATH topology
 4OVO A;  1LR7 A;  1PJU A;  4HGU A;  4SGB I;  2OZU A;  2XRC A;  1UUC A;  1MJB A;  2ORV A;  3KY9 A;  2KMO A;  1TOT A;  1Q9B A;  2NU1 I;  3QWP A;  2ORW A;  3FSY A;  3R5B A;  1MJA A;  2WCY A;  2J87 A;  1HJA I;  1OYV I;  2NU2 I;  2ENZ A;  1UVF A;  1TUR A;  1W3S A;  2SGD I;  4UXI A;  2DKV A;  2YUU A;  5E3P A;  3SGB I;  3VDP A;  2DB6 A;  2ELI A;  4AML A;  2WGC A;  2N52 A;  4B6D A;  1CT2 I;  1CGJ I;  1PPF I;  3FSX A;  7WGA A;  2E73 A;  1X74 A;  2CWF A;  2UZ3 A;  1LR8 A;  1CE3 A;  1WGT A;  3VE5 A;  1YU6 C;  1HDL A;  2ENN A;  1OMT A;  3UOE A;  2JYY A;  1SGQ I;  3VDU A;  1K7T A;  2BUS A;  3OVO A;  4A24 A;  3R5C A;  1IY5 A;  2NU4 I;  1TBO A;  1ULK A;  1P9G A;  1N13 A;  1SGD I;  3OXF A;  2X3T A;  2F3C I;  2VRW B;  5FUY A;  3UGL A;  5E3Q A;  3UFF A;  2SGP I;  2X52 A;  1FYB A;  1CHO I;  4L9M A;  2A20 A;  2J9R A;  3OXG A;  2GKR I;  2CJS C;  5FUV A;  3TO7 A;  3FC3 A;  1XX6 A;  1UVG A;  1CT4 I;  1Y8F A;  5DAE A;  5HI7 A;  3UGI A;  5J8F A;  2JXD A;  3OL0 A;  1W4R A;  2LEO A;  1ULN A;  2V53 A;  1HEV A;  1LR9 A;  2DIP A;  2UVO A;  2ROW A;  1FY7 A;  3UGD A;  4E1P A;  3R5A A;  1SGY I;  2ODD A;  2SGF I;  1WKX A;  2V1C C;  4E1R A;  1U5K A;  1TGS I;  1MT1 A;  3D00 A;  2L7X A;  4JCV E;  1YTP A;  1M8B A;  5HQ8 A;  5FUX A;  1SGR I;  1SGN I;  1WTJ A;  1V1I A;  3B4V C;  1KBF A;  1BMO A;  2CWH A;  2OU2 A;  3BJI A;  3SEK C;  2QQE A;  2PQ8 A;  1KBE A;  2B8T A;  2M5X A;  3UEJ A;  2N1A B;  1R0R I;  2GKT I;  3TOB A;  4GI3 C;  5CCM A;  4MPI A;  1AN1 I;  3SGQ I;  2NU0 I;  1NXU A;  1ULM A;  3TOA A;  2OVO A;  3HH2 C;  1SGE I;  3QAH A;  2WVJ A;  3E2I A;  1NUB A;  1TBN A;  1CGI I;  3R5D A;  3RU0 A;  2JA1 A;  2YQP A;  1WGC A;  1IW4 A;  1HPT A;  2L8E A;  2KMR A;  9WGA A;  1FAQ A;  1FAR A;  2K9H A;  2W0T A;  4WP4 A;  2RC4 A;  3TJQ A;  2ARP F;  2OD1 A;  2KCX A;  2NU3 I;  1PTR A;  5E3R A;  4FKD A;  1SGP I;  1K7V A;  1OMU A;  2LUY A;  2GVI A;  3PDN A;  2ERW A;  2QQC A;  2QQ0 A;  1P9Z A;  1Y1C A;  1V1H A;  4UXJ A;  1UHA A;  1XA6 A;  3CXL A;  5EX3 A;  2Y0M A;  1X4S A;  3MEK A;  3QTL D;  5EX0 A;  1PTQ A;  2GIV A;  2JZM A;  2N71 A;  1H0Z A;  2KMP A;  1CSO I;  1Z2I A;  2N17 A;  2QPO A;  2LB7 A;  3E59 A;  3TO9 A;  2B0U C;  4UXH A;  2QQD A;  1M8C A;  1VDD A;  2KMQ A;  4DNC A;  3TO6 A;  1R79 A;  5J8C A;  3GOX A;  1DS2 I;  3UEY A;  1Y1B A;  2GKV A;  1TBQ R;  2FNF X;  2JW6 A;  2SGQ I;  2V1C A;  1DS3 I;  2CWG A;  5JHW C;  1S20 A;  1TUS A;  2P6A C;  1CT0 I;  1Z7K B;  5CCL A;  2SGE I;  1OVO A;  2E5R A;  5FUW A;  1RFH A;  1XBT A;  1TIH A;  1MJ9 A;  1PCE A;  2RIJ A;  1KMA A;  1BUS A;  3OXL A;  1IY6 A;  1TBR R;  1K7U A; 
#chains in the Genus database with same CATH homology
 4OVO A;  1LR7 A;  1PJU A;  4HGU A;  4SGB I;  2XRC A;  1UUC A;  2ORV A;  3KY9 A;  2KMO A;  1TOT A;  2NU1 I;  3QWP A;  2ORW A;  2WCY A;  2J87 A;  1HJA I;  1OYV I;  2NU2 I;  2ENZ A;  1UVF A;  1TUR A;  1W3S A;  2SGD I;  4UXI A;  2YUU A;  3SGB I;  3VDP A;  2DB6 A;  2ELI A;  2N52 A;  4B6D A;  1CT2 I;  1CGJ I;  1PPF I;  2E73 A;  1X74 A;  2UZ3 A;  1LR8 A;  1CE3 A;  3VE5 A;  1YU6 C;  1HDL A;  2ENN A;  1OMT A;  2JYY A;  1SGQ I;  3VDU A;  2BUS A;  3OVO A;  4A24 A;  1IY5 A;  2NU4 I;  1TBO A;  3OXF A;  1N13 A;  1SGD I;  5FUY A;  3UGL A;  2F3C I;  2VRW B;  3UFF A;  2SGP I;  1FYB A;  1CHO I;  4L9M A;  2A20 A;  2J9R A;  3OXG A;  2GKR I;  2CJS C;  5FUV A;  3FC3 A;  1XX6 A;  1UVG A;  1CT4 I;  1Y8F A;  5DAE A;  5HI7 A;  3UGI A;  2JXD A;  3OL0 A;  1W4R A;  2LEO A;  2V53 A;  1LR9 A;  2DIP A;  2ROW A;  3UGD A;  4E1P A;  1SGY I;  2ODD A;  2SGF I;  2V1C C;  4E1R A;  1U5K A;  1TGS I;  1MT1 A;  3D00 A;  2L7X A;  4JCV E;  1YTP A;  1M8B A;  5HQ8 A;  5FUX A;  1SGR I;  1SGN I;  3B4V C;  1V1I A;  1KBF A;  1BMO A;  3BJI A;  3SEK C;  2QQE A;  1KBE A;  2B8T A;  2M5X A;  3UEJ A;  2N1A B;  1R0R I;  2GKT I;  4GI3 C;  5CCM A;  1AN1 I;  3SGQ I;  2NU0 I;  2OVO A;  3HH2 C;  1SGE I;  2WVJ A;  3E2I A;  1NUB A;  1TBN A;  1CGI I;  3RU0 A;  2JA1 A;  2YQP A;  1IW4 A;  1HPT A;  2L8E A;  2KMR A;  1FAQ A;  1FAR A;  2K9H A;  2W0T A;  3TJQ A;  2ARP F;  2OD1 A;  2KCX A;  2NU3 I;  1PTR A;  4FKD A;  1SGP I;  1OMU A;  2LUY A;  2GVI A;  3PDN A;  2ERW A;  2QQC A;  2QQ0 A;  5EX3 A;  1Y1C A;  1V1H A;  4UXJ A;  3CXL A;  1XA6 A;  1X4S A;  3MEK A;  3QTL D;  5EX0 A;  1PTQ A;  2JZM A;  2N71 A;  1H0Z A;  2KMP A;  1CSO I;  2N17 A;  2QPO A;  3E59 A;  2B0U C;  4UXH A;  2QQD A;  1M8C A;  1VDD A;  2KMQ A;  1R79 A;  3GOX A;  1DS2 I;  3UEY A;  1Y1B A;  2GKV A;  1TBQ R;  2FNF X;  2JW6 A;  2SGQ I;  2V1C A;  1DS3 I;  5JHW C;  1TUS A;  2P6A C;  1CT0 I;  1Z7K B;  5CCL A;  2SGE I;  1OVO A;  2E5R A;  5FUW A;  1RFH A;  1XBT A;  1TIH A;  1PCE A;  1KMA A;  1BUS A;  3OXL A;  1IY6 A;  1TBR R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...