1SGYI

Tyr 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b at ph 6.5
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
51
structure length
51
Chain Sequence
b'VDCSEYPKPACTYEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recruitment of a Buried K+ Ion to Stabilize the Negative Charge of Ionized P1 in the Hydrophobic Pocket: Crystal Structures of Glu18, Gln18, Asp18 and Asn18 Variants of Turkey Ovomucoid Inhibitor Third Domain Complexed with Streptomyces griseus Protease B at Various pH's
rcsb
molecule keywords Streptogrisin B
source organism Meleagris gallopavo
molecule tags Hydrolase/hydrolase inhibitor
total genus 12
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 1999-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1sgyI00
2B0UC 1DS3I 2JZMA 3SGQI 5JHWC 1OVOA 2BUSA 2JYYA 2OVOA 2KMQA 1CT4I 2QQDA 1TURA 1SGNI 1IW4A 2WCYA 1HPTA 1SGQI 2NU4I 2JXDA 1OMTA 1TIHA 1CHOI 2GKRI 2SGEI 4SGBI 1LR9A 1NUBA 1IY6A 1KMAA 1AN1I 1SGEI 4HGUA 1CGJI 1PPFI 1CSOI 1CE3A 3SGBI 1LR8A 2SGPI 2KMRA 1DS2I 2ARPF 2KCXA 1SGPI 2GKTI 2LEOA 1Z7KB 1UVFA 3OVOA 1YU6C 4GI3C 1SGYI 1CGII 2SGFI 5DAEA 2N71A 1CT2I 1HJAI 2SGDI 2P6AC 1IY5A 1TBRR 3QTLD 1Y1CA 4OVOA 2F3CI 1SGDI 1H0ZA 1MT1A 1PJUA 1OMUA 2NU3I 2NU1I 1SGRI 2M5XA 1CT0I 3HH2C 1Y1BA 2N52A 3B4VC 1HDLA 3TJQA 1TUSA 2KMOA 1TGSI 2KMPA 1M8BA 1UUCA 1BMOA 2NU0I 2SGQI 1BUSA 2ERWA 2GKVA 1M8CA 1N13A 2N17A 1YTPA 1TBQR 2QQCA 2NU2I 1R0RI 3SEKC 1UVGA 1LR7A 1FYBA 2V53A 2XRCA 1OYVI 1PCEA
chains in the Genus database with same CATH superfamily
2B0UC 5J8CA 1DS3I 2OD1A 2WGCA 2JZMA 3UFFA 3SGQI 5JHWC 1OVOA 2BUSA 2JYYA 3VDPA 1KBEA 1WTJA 1XBTA 3UOEA 4B6DA 2OVOA 3PDNA 5CCLA 3OXLA 2KMQA 1CT4I 2WVJA 2QQDA 1TURA 1V1HA 3RU0A 1SGNI 1IW4A 1Q9BA 2WCYA 3TO9A 3R5DA 4E1RA 9WGAA 4L9MA 3UGLA 1HPTA 2CWFA 2QQ0A 4UXJA 2YQPA 1SGQI 2NU4I 2X52A 3MEKA 1FAQA 2N1AB 5FUYA 3UGDA 1P9ZA 1Y8FA 1OMTA 2JXDA 1TIHA 1CHOI 2GKRI 2GVIA 2UZ3A 2LB7A 2SGEI 3E59A 4SGBI 1LR9A 1NUBA 1IY6A 1KMAA 2V1CC 1AN1I 2W0TA 1VDDA 2ORVA 1U5KA 1SGEI 4HGUA 1TOTA 1CGJI 1PPFI 1CSOI 1CE3A 3SGBI 2QQEA 3BJIA 1MJAA 1TBNA 1LR8A 2DB6A 2ORWA 3UGIA 3FC3A 1XA6A 2ELIA 1XX6A 2SGPI 2KMRA 1X74A 4E1PA 1DS2I 1P9GA 1X4SA 2ARPF 2V1CA 2KCXA 1SGPI 2GKTI 2LEOA 3TO7A 2X3TA 2K9HA 1MJBA 1Z7KB 1S20A 5EX0A 1UVFA 3OVOA 1YU6C 4GI3C 1WKXA 4JCVE 1SGYI 1WGTA 1K7TA 1CGII 2DIPA 2E73A 2J9RA 5CCMA 3VDUA 1ULNA 2SGFI 5DAEA 2N71A 1ULMA 3R5CA 3FSXA 1KBFA 3CXLA 5HI7A 4UXHA 1CT2I 1HJAI 2SGDI 2OZUA 2P6AC 2RIJA 1K7UA 1UHAA 4WP4A 5E3PA 1IY5A 4FKDA 5FUVA 1TBRR 3QTLD 1Y1CA 4OVOA 2F3CI 2PQ8A 2ENNA 2ENZA 3R5BA 1PTRA 1SGDI 3E2IA 1H0ZA 4AMLA 2A20A 1MT1A 2B8TA 3KY9A 1PJUA 1OMUA 2OU2A 2NU3I 4A24A 2NU1I 1SGRI 1MJ9A 5HQ8A 2JW6A 2J87A 1CT0I 2M5XA 3HH2C 1Y1BA 1HEVA 2N52A 3QAHA 2VRWB 3B4VC 3FSYA 3OL0A 1HDLA 3TJQA 3OXGA 1TUSA 1FY7A 2KMOA 4UXIA 2JA1A 3TOBA 2YUUA 3TO6A 3VE5A 1NXUA 1V1IA 2E5RA 2L7XA 1ULKA 3TOAA 1TGSI 2KMPA 2ROWA 1M8BA 1R79A 2GIVA 1UUCA 2LUYA 5FUXA 1BMOA 2NU0I 2SGQI 4DNCA 2RC4A 1BUSA 3UEYA 1W4RA 2Y0MA 2ERWA 2L8EA 2GKVA 1FARA 1W3SA 2QPOA 2FNFX 1K7VA 3D00A 3R5AA 2DKVA 1PTQA 2CJSC 1M8CA 1N13A 2N17A 1YTPA 1TBQR 1RFHA 2QQCA 2CWGA 5E3RA 1TBOA 5FUWA 5J8FA 1WGCA 2CWHA 2NU2I 3OXFA 1R0RI 3GOXA 3SEKC 7WGAA 1UVGA 3UEJA 1LR7A 1FYBA 1Z2IA 2UVOA 2ODDA 2V53A 2XRCA 4MPIA 5E3QA 1OYVI 5EX3A 1PCEA 3QWPA
chains in the Genus database with same CATH topology
2B0UC 1DS3I 2OD1A 2JZMA 3UFFA 3SGQI 5JHWC 1OVOA 2BUSA 2JYYA 3VDPA 1KBEA 1XBTA 4B6DA 2OVOA 3PDNA 5CCLA 3OXLA 2KMQA 1CT4I 2WVJA 2QQDA 1TURA 1V1HA 3RU0A 1SGNI 1IW4A 2WCYA 4E1RA 4L9MA 3UGLA 1HPTA 2QQ0A 4UXJA 2YQPA 1SGQI 2NU4I 3MEKA 1FAQA 2N1AB 5FUYA 3UGDA 1Y8FA 1OMTA 2JXDA 1TIHA 1CHOI 2GKRI 2GVIA 2UZ3A 3E59A 2SGEI 4SGBI 1LR9A 1NUBA 1IY6A 1KMAA 2V1CC 1AN1I 2W0TA 1VDDA 2ORVA 1U5KA 1SGEI 4HGUA 1TOTA 1CGJI 1PPFI 1CSOI 1CE3A 3SGBI 2QQEA 3BJIA 1TBNA 2DB6A 1LR8A 2ORWA 3UGIA 3FC3A 1XA6A 2ELIA 1XX6A 2SGPI 2KMRA 1X74A 4E1PA 1DS2I 1X4SA 2ARPF 2V1CA 2KCXA 1SGPI 2GKTI 2LEOA 2K9HA 1Z7KB 5EX0A 1UVFA 3OVOA 1YU6C 4GI3C 4JCVE 1SGYI 1CGII 2DIPA 2E73A 2J9RA 3VDUA 2SGFI 5DAEA 2N71A 1KBFA 3CXLA 5HI7A 4UXHA 1CT2I 1HJAI 2SGDI 2P6AC 1IY5A 4FKDA 5FUVA 1TBRR 3QTLD 1Y1CA 4OVOA 2F3CI 2ENNA 2ENZA 1PTRA 1SGDI 3E2IA 1H0ZA 2A20A 1MT1A 2B8TA 3KY9A 1PJUA 1OMUA 4A24A 2NU3I 2NU1I 1SGRI 5HQ8A 2JW6A 2J87A 1CT0I 2M5XA 3HH2C 1Y1BA 2N52A 2VRWB 3B4VC 3OL0A 1HDLA 3TJQA 3OXGA 1TUSA 2KMOA 4UXIA 2JA1A 2YUUA 3VE5A 5CCMA 2E5RA 1V1IA 2L7XA 1TGSI 2KMPA 2ROWA 1M8BA 1R79A 1UUCA 2LUYA 5FUXA 1BMOA 2NU0I 2SGQI 1BUSA 3UEYA 1W4RA 2ERWA 2L8EA 2GKVA 1FARA 1W3SA 2QPOA 2FNFX 3D00A 1PTQA 2CJSC 1M8CA 1N13A 2N17A 1YTPA 1TBQR 1RFHA 2QQCA 5FUWA 1TBOA 2NU2I 3OXFA 3GOXA 1R0RI 3SEKC 1UVGA 3UEJA 1LR7A 1FYBA 2V53A 2ODDA 2XRCA 1OYVI 5EX3A 1PCEA 3QWPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B0U C;  1DS3 I;  2JZM A;  3SGQ I;  5JHW C;  1OVO A;  2BUS A;  2JYY A;  2OVO A;  2KMQ A;  1CT4 I;  2QQD A;  1TUR A;  1SGN I;  1IW4 A;  2WCY A;  1HPT A;  1SGQ I;  2NU4 I;  2JXD A;  1OMT A;  1TIH A;  1CHO I;  2GKR I;  2SGE I;  4SGB I;  1LR9 A;  1NUB A;  1IY6 A;  1KMA A;  1AN1 I;  1SGE I;  4HGU A;  1CGJ I;  1PPF I;  1CSO I;  1CE3 A;  3SGB I;  1LR8 A;  2SGP I;  2KMR A;  1DS2 I;  2ARP F;  2KCX A;  1SGP I;  2GKT I;  2LEO A;  1Z7K B;  1UVF A;  3OVO A;  1YU6 C;  4GI3 C;  1SGY I;  1CGI I;  2SGF I;  5DAE A;  2N71 A;  1CT2 I;  1HJA I;  2SGD I;  2P6A C;  1IY5 A;  1TBR R;  3QTL D;  1Y1C A;  4OVO A;  2F3C I;  1SGD I;  1H0Z A;  1MT1 A;  1PJU A;  1OMU A;  2NU3 I;  2NU1 I;  1SGR I;  2M5X A;  1CT0 I;  3HH2 C;  1Y1B A;  2N52 A;  3B4V C;  1HDL A;  3TJQ A;  1TUS A;  2KMO A;  1TGS I;  2KMP A;  1M8B A;  1UUC A;  1BMO A;  2NU0 I;  2SGQ I;  1BUS A;  2ERW A;  2GKV A;  1M8C A;  1N13 A;  2N17 A;  1YTP A;  1TBQ R;  2QQC A;  2NU2 I;  1R0R I;  3SEK C;  1UVG A;  1LR7 A;  1FYB A;  2V53 A;  2XRC A;  1OYV I;  1PCE A; 
#chains in the Genus database with same CATH topology
 2B0U C;  5J8C A;  1DS3 I;  2OD1 A;  2WGC A;  2JZM A;  3UFF A;  3SGQ I;  5JHW C;  1OVO A;  2BUS A;  2JYY A;  3VDP A;  1KBE A;  1WTJ A;  1XBT A;  3UOE A;  4B6D A;  2OVO A;  3PDN A;  5CCL A;  3OXL A;  2KMQ A;  1CT4 I;  2WVJ A;  2QQD A;  1TUR A;  1V1H A;  3RU0 A;  1SGN I;  1IW4 A;  1Q9B A;  2WCY A;  3TO9 A;  3R5D A;  4E1R A;  9WGA A;  4L9M A;  3UGL A;  1HPT A;  2CWF A;  2QQ0 A;  4UXJ A;  2YQP A;  1SGQ I;  2NU4 I;  2X52 A;  3MEK A;  1FAQ A;  2N1A B;  5FUY A;  3UGD A;  1P9Z A;  1Y8F A;  1OMT A;  2JXD A;  1TIH A;  1CHO I;  2GKR I;  2GVI A;  2UZ3 A;  2LB7 A;  2SGE I;  3E59 A;  4SGB I;  1LR9 A;  1NUB A;  1IY6 A;  1KMA A;  2V1C C;  1AN1 I;  2W0T A;  1VDD A;  2ORV A;  1U5K A;  1SGE I;  4HGU A;  1TOT A;  1CGJ I;  1PPF I;  1CSO I;  1CE3 A;  3SGB I;  2QQE A;  3BJI A;  1MJA A;  1TBN A;  1LR8 A;  2DB6 A;  2ORW A;  3UGI A;  3FC3 A;  1XA6 A;  2ELI A;  1XX6 A;  2SGP I;  2KMR A;  1X74 A;  4E1P A;  1DS2 I;  1P9G A;  1X4S A;  2ARP F;  2V1C A;  2KCX A;  1SGP I;  2GKT I;  2LEO A;  3TO7 A;  2X3T A;  2K9H A;  1MJB A;  1Z7K B;  1S20 A;  5EX0 A;  1UVF A;  3OVO A;  1YU6 C;  4GI3 C;  1WKX A;  4JCV E;  1SGY I;  1WGT A;  1K7T A;  1CGI I;  2DIP A;  2E73 A;  2J9R A;  5CCM A;  3VDU A;  1ULN A;  2SGF I;  5DAE A;  2N71 A;  1ULM A;  3R5C A;  3FSX A;  1KBF A;  3CXL A;  5HI7 A;  4UXH A;  1CT2 I;  1HJA I;  2SGD I;  2OZU A;  2P6A C;  2RIJ A;  1K7U A;  1UHA A;  4WP4 A;  5E3P A;  1IY5 A;  4FKD A;  5FUV A;  1TBR R;  3QTL D;  1Y1C A;  4OVO A;  2F3C I;  2PQ8 A;  2ENN A;  2ENZ A;  3R5B A;  1PTR A;  1SGD I;  3E2I A;  1H0Z A;  4AML A;  2A20 A;  1MT1 A;  2B8T A;  3KY9 A;  1PJU A;  1OMU A;  2OU2 A;  2NU3 I;  4A24 A;  2NU1 I;  1SGR I;  1MJ9 A;  5HQ8 A;  2JW6 A;  2J87 A;  1CT0 I;  2M5X A;  3HH2 C;  1Y1B A;  1HEV A;  2N52 A;  3QAH A;  2VRW B;  3B4V C;  3FSY A;  3OL0 A;  1HDL A;  3TJQ A;  3OXG A;  1TUS A;  1FY7 A;  2KMO A;  4UXI A;  2JA1 A;  3TOB A;  2YUU A;  3TO6 A;  3VE5 A;  1NXU A;  1V1I A;  2E5R A;  2L7X A;  1ULK A;  3TOA A;  1TGS I;  2KMP A;  2ROW A;  1M8B A;  1R79 A;  2GIV A;  1UUC A;  2LUY A;  5FUX A;  1BMO A;  2NU0 I;  2SGQ I;  4DNC A;  2RC4 A;  1BUS A;  3UEY A;  1W4R A;  2Y0M A;  2ERW A;  2L8E A;  2GKV A;  1FAR A;  1W3S A;  2QPO A;  2FNF X;  1K7V A;  3D00 A;  3R5A A;  2DKV A;  1PTQ A;  2CJS C;  1M8C A;  1N13 A;  2N17 A;  1YTP A;  1TBQ R;  1RFH A;  2QQC A;  2CWG A;  5E3R A;  1TBO A;  5FUW A;  5J8F A;  1WGC A;  2CWH A;  2NU2 I;  3OXF A;  1R0R I;  3GOX A;  3SEK C;  7WGA A;  1UVG A;  3UEJ A;  1LR7 A;  1FYB A;  1Z2I A;  2UVO A;  2ODD A;  2V53 A;  2XRC A;  4MPI A;  5E3Q A;  1OYV I;  5EX3 A;  1PCE A;  3QWP A; 
#chains in the Genus database with same CATH homology
 2B0U C;  1DS3 I;  2OD1 A;  2JZM A;  3UFF A;  3SGQ I;  5JHW C;  1OVO A;  2BUS A;  2JYY A;  3VDP A;  1KBE A;  1XBT A;  4B6D A;  2OVO A;  3PDN A;  5CCL A;  3OXL A;  2KMQ A;  1CT4 I;  2WVJ A;  2QQD A;  1TUR A;  1V1H A;  3RU0 A;  1SGN I;  1IW4 A;  2WCY A;  4E1R A;  4L9M A;  3UGL A;  1HPT A;  2QQ0 A;  4UXJ A;  2YQP A;  1SGQ I;  2NU4 I;  3MEK A;  1FAQ A;  2N1A B;  5FUY A;  3UGD A;  1Y8F A;  1OMT A;  2JXD A;  1TIH A;  1CHO I;  2GKR I;  2GVI A;  2UZ3 A;  3E59 A;  2SGE I;  4SGB I;  1LR9 A;  1NUB A;  1IY6 A;  1KMA A;  2V1C C;  1AN1 I;  2W0T A;  1VDD A;  2ORV A;  1U5K A;  1SGE I;  4HGU A;  1TOT A;  1CGJ I;  1PPF I;  1CSO I;  1CE3 A;  3SGB I;  2QQE A;  3BJI A;  1TBN A;  2DB6 A;  1LR8 A;  2ORW A;  3UGI A;  3FC3 A;  1XA6 A;  2ELI A;  1XX6 A;  2SGP I;  2KMR A;  1X74 A;  4E1P A;  1DS2 I;  1X4S A;  2ARP F;  2V1C A;  2KCX A;  1SGP I;  2GKT I;  2LEO A;  2K9H A;  1Z7K B;  5EX0 A;  1UVF A;  3OVO A;  1YU6 C;  4GI3 C;  4JCV E;  1SGY I;  1CGI I;  2DIP A;  2E73 A;  2J9R A;  3VDU A;  2SGF I;  5DAE A;  2N71 A;  1KBF A;  3CXL A;  5HI7 A;  4UXH A;  1CT2 I;  1HJA I;  2SGD I;  2P6A C;  1IY5 A;  4FKD A;  5FUV A;  1TBR R;  3QTL D;  1Y1C A;  4OVO A;  2F3C I;  2ENN A;  2ENZ A;  1PTR A;  1SGD I;  3E2I A;  1H0Z A;  2A20 A;  1MT1 A;  2B8T A;  3KY9 A;  1PJU A;  1OMU A;  4A24 A;  2NU3 I;  2NU1 I;  1SGR I;  5HQ8 A;  2JW6 A;  2J87 A;  1CT0 I;  2M5X A;  3HH2 C;  1Y1B A;  2N52 A;  2VRW B;  3B4V C;  3OL0 A;  1HDL A;  3TJQ A;  3OXG A;  1TUS A;  2KMO A;  4UXI A;  2JA1 A;  2YUU A;  3VE5 A;  5CCM A;  2E5R A;  1V1I A;  2L7X A;  1TGS I;  2KMP A;  2ROW A;  1M8B A;  1R79 A;  1UUC A;  2LUY A;  5FUX A;  1BMO A;  2NU0 I;  2SGQ I;  1BUS A;  3UEY A;  1W4R A;  2ERW A;  2L8E A;  2GKV A;  1FAR A;  1W3S A;  2QPO A;  2FNF X;  3D00 A;  1PTQ A;  2CJS C;  1M8C A;  1N13 A;  2N17 A;  1YTP A;  1TBQ R;  1RFH A;  2QQC A;  5FUW A;  1TBO A;  2NU2 I;  3OXF A;  3GOX A;  1R0R I;  3SEK C;  1UVG A;  3UEJ A;  1LR7 A;  1FYB A;  2V53 A;  2ODD A;  2XRC A;  1OYV I;  5EX3 A;  1PCE A;  3QWP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...