1SGYI

Tyr 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b at ph 6.5
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
51
structure length
51
Chain Sequence
b'VDCSEYPKPACTYEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptogrisin B
publication title Recruitment of a Buried K+ Ion to Stabilize the Negative Charge of Ionized P1 in the Hydrophobic Pocket: Crystal Structures of Glu18, Gln18, Asp18 and Asn18 Variants of Turkey Ovomucoid Inhibitor Third Domain Complexed with Streptomyces griseus Protease B at Various pH's
rcsb
source organism Meleagris gallopavo
molecule tags Hydrolase/hydrolase inhibitor
total genus 12
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 1999-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1sgyI00
2ARPF 1YU6C 1CGII 5JHWC 1PJUA 1TURA 1TUSA 2QQCA 1DS2I 2GKTI 1CE3A 1LR7A 2NU0I 1OYVI 2ERWA 2GKVA 5DAEA 1CGJI 2SGDI 2QQDA 2V53A 1BUSA 2NU1I 1R0RI 1SGYI 1SGDI 1IW4A 1Y1CA 3SGBI 4OVOA 1Z7KB 1MT1A 1BMOA 2SGEI 1DS3I 2KMOA 4HGUA 1SGQI 2P6AC 3B4VC 1H0ZA 1CHOI 3SGQI 1IY6A 1SGEI 2N52A 2SGQI 1UUCA 1LR9A 2NU3I 1PPFI 1YTPA 2B0UC 1SGNI 3QTLD 1SGPI 1HPTA 2KCXA 2JYYA 1TBRR 4SGBI 2BUSA 1FYBA 1PCEA 1M8BA 1TBQR 3HH2C 2M5XA 2WCYA 2SGFI 1UVFA 2KMQA 1N13A 1KMAA 2NU4I 1UVGA 1CSOI 3OVOA 2GKRI 2LEOA 1OMTA 1SGRI 3TJQA 2SGPI 1OVOA 2N71A 2N17A 1TIHA 4GI3C 1HJAI 1TGSI 1M8CA 1AN1I 1Y1BA 1IY5A 2KMPA 1HDLA 1CT0I 2NU2I 3SEKC 2KMRA 1NUBA 1CT2I 1OMUA 2JZMA 1LR8A 1CT4I 2OVOA 2F3CI 2XRCA 2JXDA
chains in the Genus database with same CATH superfamily
1TOTA 9WGAA 2WGCA 2ARPF 1FY7A 1YU6C 3VDUA 1CGII 5FUWA 1MJ9A 1NXUA 2WVJA 1K7VA 1W3SA 5E3QA 1WKXA 1W4RA 5JHWC 3FSXA 2J9RA 1VDDA 5CCMA 1PJUA 1TURA 4L9MA 3TOAA 3VE5A 2YUUA 2X3TA 1TUSA 1X4SA 2RC4A 2V1CA 4DNCA 2QQCA 1MJBA 1DS2I 4UXHA 2GKTI 2OZUA 4AMLA 1CE3A 1LR7A 2OD1A 2UZ3A 1UHAA 1Q9BA 2NU0I 1OYVI 2ERWA 2B8TA 4FKDA 3UEYA 2QQEA 1WGTA 2GKVA 5DAEA 1K7TA 3FC3A 1U5KA 1CGJI 1XX6A 2SGDI 2LB7A 2QQDA 2V53A 2L7XA 1BUSA 2NU1I 2Y0MA 1R0RI 2FNFX 1SGYI 1SGDI 2ELIA 2ROWA 2V1CC 4JCVE 1Y1CA 3UGLA 1RFHA 1FARA 3E2IA 4OVOA 3SGBI 1Z7KB 2JW6A 2ODDA 4E1RA 1MT1A 1BMOA 1FAQA 2SGEI 1V1IA 3UGDA 3PDNA 1X74A 2CJSC 1DS3I 2KMOA 2GVIA 4HGUA 1KBEA 2OU2A 1SGQI 2K9HA 3KY9A 3MEKA 2P6AC 3B4VC 1H0ZA 1CHOI 2ORWA 5E3PA 3SGQI 2CWHA 1SGEI 1IY6A 2ENNA 2N52A 2SGQI 7WGAA 2DKVA 1UUCA 1LR9A 2NU3I 1PPFI 1PTQA 1YTPA 3E59A 3TO9A 1Z2IA 3OXFA 3TOBA 2B0UC 1ULMA 3R5DA 1SGNI 5EX0A 3QTLD 4MPIA 1IW4A 1SGPI 5J8FA 5E3RA 1HPTA 5FUXA 2KCXA 2LUYA 2YQPA 3TO7A 3UEJA 2JYYA 3UGIA 1P9ZA 2DIPA 2GIVA 2UVOA 1TBRR 2E73A 1KBFA 2PQ8A 3R5BA 4SGBI 2BUSA 1FYBA 1WGCA 1PCEA 2DB6A 1XA6A 1M8BA 2N1AB 5J8CA 3OXGA 2A20A 5FUYA 1TBQR 1S20A 3HH2C 4A24A 2M5XA 2WCYA 2SGFI 2E5RA 1TBOA 2RIJA 3OL0A 3GOXA 1UVFA 2X52A 2KMQA 1N13A 1KMAA 1ULKA 2NU4I 1UVGA 1V1HA 1P9GA 1CSOI 3OVOA 2GKRI 2LEOA 2QPOA 1OMTA 1SGRI 3R5AA 3TJQA 2SGPI 5EX3A 1OVOA 2N71A 2N17A 3QAHA 2VRWB 5CCLA 4WP4A 1TIHA 2W0TA 3BJIA 1HJAI 4GI3C 3TO6A 3D00A 1TGSI 1M8CA 2CWFA 1AN1I 2QQ0A 5HQ8A 1ULNA 1Y1BA 2ORVA 3QWPA 1XBTA 2KMPA 2L8EA 5HI7A 1IY5A 3FSYA 1HDLA 1CT0I 2NU2I 3SEKC 1MJAA 2JA1A 4UXJA 2KMRA 1R79A 2ENZA 3RU0A 3UFFA 3UOEA 1NUBA 3VDPA 1PTRA 1WTJA 1CT2I 1OMUA 3CXLA 4B6DA 2J87A 3R5CA 4E1PA 1K7UA 2CWGA 2JZMA 3OXLA 1LR8A 1CT4I 2OVOA 2F3CI 1HEVA 1Y8FA 4UXIA 2XRCA 5FUVA 1TBNA 2JXDA
chains in the Genus database with same CATH topology
1TOTA 2ARPF 1YU6C 3VDUA 1CGII 5FUWA 2WVJA 1W3SA 1W4RA 5JHWC 2J9RA 1VDDA 5CCMA 1PJUA 1TURA 4L9MA 3VE5A 2YUUA 1TUSA 1X4SA 2V1CA 2QQCA 1DS2I 4UXHA 2GKTI 1CE3A 1LR7A 2OD1A 2UZ3A 2NU0I 1OYVI 2ERWA 2B8TA 4FKDA 3UEYA 2QQEA 2GKVA 5DAEA 3FC3A 1U5KA 1CGJI 1XX6A 2SGDI 2QQDA 2V53A 2L7XA 1BUSA 2NU1I 1R0RI 2FNFX 1SGYI 1SGDI 2ELIA 2ROWA 2V1CC 4JCVE 1Y1CA 3UGLA 1RFHA 1FARA 3E2IA 4OVOA 3SGBI 1Z7KB 2JW6A 2ODDA 4E1RA 1MT1A 1BMOA 1FAQA 2SGEI 1V1IA 3UGDA 3PDNA 1X74A 2CJSC 1DS3I 2KMOA 2GVIA 4HGUA 1KBEA 1SGQI 2K9HA 3KY9A 3MEKA 2P6AC 3B4VC 1H0ZA 1CHOI 2ORWA 3SGQI 1IY6A 1SGEI 2ENNA 2N52A 2SGQI 1UUCA 1LR9A 2NU3I 1PPFI 1PTQA 1YTPA 3E59A 3OXFA 2B0UC 1SGNI 5EX0A 3QTLD 1IW4A 1SGPI 1HPTA 5FUXA 2KCXA 2LUYA 2YQPA 3UEJA 2JYYA 3UGIA 2DIPA 1KBFA 1TBRR 2E73A 4SGBI 2BUSA 1FYBA 1PCEA 2DB6A 1XA6A 1M8BA 2N1AB 3OXGA 2A20A 5FUYA 1TBQR 3HH2C 4A24A 2M5XA 2WCYA 2SGFI 2E5RA 1TBOA 3OL0A 3GOXA 1UVFA 2KMQA 1N13A 1KMAA 2NU4I 1UVGA 1V1HA 1CSOI 3OVOA 2GKRI 2LEOA 2QPOA 1OMTA 1SGRI 3TJQA 2SGPI 5EX3A 1OVOA 2N71A 2N17A 2VRWB 5CCLA 1TIHA 2W0TA 3BJIA 1HJAI 4GI3C 3D00A 1TGSI 1M8CA 2QQ0A 1AN1I 5HQ8A 1Y1BA 2ORVA 3QWPA 1XBTA 2KMPA 2L8EA 5HI7A 1IY5A 1HDLA 1CT0I 2NU2I 3SEKC 4UXJA 2JA1A 2KMRA 1R79A 2ENZA 3RU0A 3UFFA 3VDPA 1NUBA 1PTRA 1CT2I 1OMUA 3CXLA 4B6DA 2J87A 4E1PA 2JZMA 3OXLA 1LR8A 1CT4I 2OVOA 2F3CI 1Y8FA 4UXIA 2XRCA 5FUVA 1TBNA 2JXDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ARP F;  1YU6 C;  1CGI I;  5JHW C;  1PJU A;  1TUR A;  1TUS A;  2QQC A;  1DS2 I;  2GKT I;  1CE3 A;  1LR7 A;  2NU0 I;  1OYV I;  2ERW A;  2GKV A;  5DAE A;  1CGJ I;  2SGD I;  2QQD A;  2V53 A;  1BUS A;  2NU1 I;  1R0R I;  1SGY I;  1SGD I;  1IW4 A;  1Y1C A;  3SGB I;  4OVO A;  1Z7K B;  1MT1 A;  1BMO A;  2SGE I;  1DS3 I;  2KMO A;  4HGU A;  1SGQ I;  2P6A C;  3B4V C;  1H0Z A;  1CHO I;  3SGQ I;  1IY6 A;  1SGE I;  2N52 A;  2SGQ I;  1UUC A;  1LR9 A;  2NU3 I;  1PPF I;  1YTP A;  2B0U C;  1SGN I;  3QTL D;  1SGP I;  1HPT A;  2KCX A;  2JYY A;  1TBR R;  4SGB I;  2BUS A;  1FYB A;  1PCE A;  1M8B A;  1TBQ R;  3HH2 C;  2M5X A;  2WCY A;  2SGF I;  1UVF A;  2KMQ A;  1N13 A;  1KMA A;  2NU4 I;  1UVG A;  1CSO I;  3OVO A;  2GKR I;  2LEO A;  1OMT A;  1SGR I;  3TJQ A;  2SGP I;  1OVO A;  2N71 A;  2N17 A;  1TIH A;  4GI3 C;  1HJA I;  1TGS I;  1M8C A;  1AN1 I;  1Y1B A;  1IY5 A;  2KMP A;  1HDL A;  1CT0 I;  2NU2 I;  3SEK C;  2KMR A;  1NUB A;  1CT2 I;  1OMU A;  2JZM A;  1LR8 A;  1CT4 I;  2OVO A;  2F3C I;  2XRC A;  2JXD A; 
#chains in the Genus database with same CATH topology
 1TOT A;  9WGA A;  2WGC A;  2ARP F;  1FY7 A;  1YU6 C;  3VDU A;  1CGI I;  5FUW A;  1MJ9 A;  1NXU A;  2WVJ A;  1K7V A;  1W3S A;  5E3Q A;  1WKX A;  1W4R A;  5JHW C;  3FSX A;  2J9R A;  1VDD A;  5CCM A;  1PJU A;  1TUR A;  4L9M A;  3TOA A;  3VE5 A;  2YUU A;  2X3T A;  1TUS A;  1X4S A;  2RC4 A;  2V1C A;  4DNC A;  2QQC A;  1MJB A;  1DS2 I;  4UXH A;  2GKT I;  2OZU A;  4AML A;  1CE3 A;  1LR7 A;  2OD1 A;  2UZ3 A;  1UHA A;  1Q9B A;  2NU0 I;  1OYV I;  2ERW A;  2B8T A;  4FKD A;  3UEY A;  2QQE A;  1WGT A;  2GKV A;  5DAE A;  1K7T A;  3FC3 A;  1U5K A;  1CGJ I;  1XX6 A;  2SGD I;  2LB7 A;  2QQD A;  2V53 A;  2L7X A;  1BUS A;  2NU1 I;  2Y0M A;  1R0R I;  2FNF X;  1SGY I;  1SGD I;  2ELI A;  2ROW A;  2V1C C;  4JCV E;  1Y1C A;  3UGL A;  1RFH A;  1FAR A;  3E2I A;  4OVO A;  3SGB I;  1Z7K B;  2JW6 A;  2ODD A;  4E1R A;  1MT1 A;  1BMO A;  1FAQ A;  2SGE I;  1V1I A;  3UGD A;  3PDN A;  1X74 A;  2CJS C;  1DS3 I;  2KMO A;  2GVI A;  4HGU A;  1KBE A;  2OU2 A;  1SGQ I;  2K9H A;  3KY9 A;  3MEK A;  2P6A C;  3B4V C;  1H0Z A;  1CHO I;  2ORW A;  5E3P A;  3SGQ I;  2CWH A;  1SGE I;  1IY6 A;  2ENN A;  2N52 A;  2SGQ I;  7WGA A;  2DKV A;  1UUC A;  1LR9 A;  2NU3 I;  1PPF I;  1PTQ A;  1YTP A;  3E59 A;  3TO9 A;  1Z2I A;  3OXF A;  3TOB A;  2B0U C;  1ULM A;  3R5D A;  1SGN I;  5EX0 A;  3QTL D;  4MPI A;  1IW4 A;  1SGP I;  5J8F A;  5E3R A;  1HPT A;  5FUX A;  2KCX A;  2LUY A;  2YQP A;  3TO7 A;  3UEJ A;  2JYY A;  3UGI A;  1P9Z A;  2DIP A;  2GIV A;  2UVO A;  1TBR R;  2E73 A;  1KBF A;  2PQ8 A;  3R5B A;  4SGB I;  2BUS A;  1FYB A;  1WGC A;  1PCE A;  2DB6 A;  1XA6 A;  1M8B A;  2N1A B;  5J8C A;  3OXG A;  2A20 A;  5FUY A;  1TBQ R;  1S20 A;  3HH2 C;  4A24 A;  2M5X A;  2WCY A;  2SGF I;  2E5R A;  1TBO A;  2RIJ A;  3OL0 A;  3GOX A;  1UVF A;  2X52 A;  2KMQ A;  1N13 A;  1KMA A;  1ULK A;  2NU4 I;  1UVG A;  1V1H A;  1P9G A;  1CSO I;  3OVO A;  2GKR I;  2LEO A;  2QPO A;  1OMT A;  1SGR I;  3R5A A;  3TJQ A;  2SGP I;  5EX3 A;  1OVO A;  2N71 A;  2N17 A;  3QAH A;  2VRW B;  5CCL A;  4WP4 A;  1TIH A;  2W0T A;  3BJI A;  1HJA I;  4GI3 C;  3TO6 A;  3D00 A;  1TGS I;  1M8C A;  2CWF A;  1AN1 I;  2QQ0 A;  5HQ8 A;  1ULN A;  1Y1B A;  2ORV A;  3QWP A;  1XBT A;  2KMP A;  2L8E A;  5HI7 A;  1IY5 A;  3FSY A;  1HDL A;  1CT0 I;  2NU2 I;  3SEK C;  1MJA A;  2JA1 A;  4UXJ A;  2KMR A;  1R79 A;  2ENZ A;  3RU0 A;  3UFF A;  3UOE A;  1NUB A;  3VDP A;  1PTR A;  1WTJ A;  1CT2 I;  1OMU A;  3CXL A;  4B6D A;  2J87 A;  3R5C A;  4E1P A;  1K7U A;  2CWG A;  2JZM A;  3OXL A;  1LR8 A;  1CT4 I;  2OVO A;  2F3C I;  1HEV A;  1Y8F A;  4UXI A;  2XRC A;  5FUV A;  1TBN A;  2JXD A; 
#chains in the Genus database with same CATH homology
 1TOT A;  2ARP F;  1YU6 C;  3VDU A;  1CGI I;  5FUW A;  2WVJ A;  1W3S A;  1W4R A;  5JHW C;  2J9R A;  1VDD A;  5CCM A;  1PJU A;  1TUR A;  4L9M A;  3VE5 A;  2YUU A;  1TUS A;  1X4S A;  2V1C A;  2QQC A;  1DS2 I;  4UXH A;  2GKT I;  1CE3 A;  1LR7 A;  2OD1 A;  2UZ3 A;  2NU0 I;  1OYV I;  2ERW A;  2B8T A;  4FKD A;  3UEY A;  2QQE A;  2GKV A;  5DAE A;  3FC3 A;  1U5K A;  1CGJ I;  1XX6 A;  2SGD I;  2QQD A;  2V53 A;  2L7X A;  1BUS A;  2NU1 I;  1R0R I;  2FNF X;  1SGY I;  1SGD I;  2ELI A;  2ROW A;  2V1C C;  4JCV E;  1Y1C A;  3UGL A;  1RFH A;  1FAR A;  3E2I A;  4OVO A;  3SGB I;  1Z7K B;  2JW6 A;  2ODD A;  4E1R A;  1MT1 A;  1BMO A;  1FAQ A;  2SGE I;  1V1I A;  3UGD A;  3PDN A;  1X74 A;  2CJS C;  1DS3 I;  2KMO A;  2GVI A;  4HGU A;  1KBE A;  1SGQ I;  2K9H A;  3KY9 A;  3MEK A;  2P6A C;  3B4V C;  1H0Z A;  1CHO I;  2ORW A;  3SGQ I;  1IY6 A;  1SGE I;  2ENN A;  2N52 A;  2SGQ I;  1UUC A;  1LR9 A;  2NU3 I;  1PPF I;  1PTQ A;  1YTP A;  3E59 A;  3OXF A;  2B0U C;  1SGN I;  5EX0 A;  3QTL D;  1IW4 A;  1SGP I;  1HPT A;  5FUX A;  2KCX A;  2LUY A;  2YQP A;  3UEJ A;  2JYY A;  3UGI A;  2DIP A;  1KBF A;  1TBR R;  2E73 A;  4SGB I;  2BUS A;  1FYB A;  1PCE A;  2DB6 A;  1XA6 A;  1M8B A;  2N1A B;  3OXG A;  2A20 A;  5FUY A;  1TBQ R;  3HH2 C;  4A24 A;  2M5X A;  2WCY A;  2SGF I;  2E5R A;  1TBO A;  3OL0 A;  3GOX A;  1UVF A;  2KMQ A;  1N13 A;  1KMA A;  2NU4 I;  1UVG A;  1V1H A;  1CSO I;  3OVO A;  2GKR I;  2LEO A;  2QPO A;  1OMT A;  1SGR I;  3TJQ A;  2SGP I;  5EX3 A;  1OVO A;  2N71 A;  2N17 A;  2VRW B;  5CCL A;  1TIH A;  2W0T A;  3BJI A;  1HJA I;  4GI3 C;  3D00 A;  1TGS I;  1M8C A;  2QQ0 A;  1AN1 I;  5HQ8 A;  1Y1B A;  2ORV A;  3QWP A;  1XBT A;  2KMP A;  2L8E A;  5HI7 A;  1IY5 A;  1HDL A;  1CT0 I;  2NU2 I;  3SEK C;  4UXJ A;  2JA1 A;  2KMR A;  1R79 A;  2ENZ A;  3RU0 A;  3UFF A;  3VDP A;  1NUB A;  1PTR A;  1CT2 I;  1OMU A;  3CXL A;  4B6D A;  2J87 A;  4E1P A;  2JZM A;  3OXL A;  1LR8 A;  1CT4 I;  2OVO A;  2F3C I;  1Y8F A;  4UXI A;  2XRC A;  5FUV A;  1TBN A;  2JXD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...