1SGYI

Tyr 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b at ph 6.5
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
51
structure length
51
Chain Sequence
VDCSEYPKPACTYEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptogrisin B
publication title Recruitment of a Buried K+ Ion to Stabilize the Negative Charge of Ionized P1 in the Hydrophobic Pocket: Crystal Structures of Glu18, Gln18, Asp18 and Asn18 Variants of Turkey Ovomucoid Inhibitor Third Domain Complexed with Streptomyces griseus Protease B at Various pH's
rcsb
source organism Meleagris gallopavo
molecule tags Hydrolase/hydrolase inhibitor
total genus 12
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 1999-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1sgyI00
1PCEA 1LR9A 1DS3I 3SGBI 1KMAA 2N71A 1N13A 1Y1CA 5DAEA 1CSOI 1UVFA 1CT4I 1CE3A 2SGEI 1TBRR 1SGEI 2F3CI 1R0RI 1YTPA 2M5XA 5JHWC 2GKTI 2KMPA 1LR8A 1AN1I 2KMOA 2BUSA 2NU4I 1SGYI 4SGBI 1SGRI 1Y1BA 1HPTA 2XRCA 1OYVI 1CHOI 1BUSA 1OVOA 3TJQA 1H0ZA 2P6AC 1CGII 3HH2C 1UVGA 1LR7A 1TUSA 1YU6C 3SGQI 1DS2I 1CGJI 1TIHA 1M8BA 2KMRA 2OVOA 1PJUA 1SGDI 3QTLD 2NU3I 2QQCA 2JYYA 1FYBA 4GI3C 2NU1I 1IW4A 2QQDA 3OVOA 1Z7KB 2SGPI 2SGDI 2KMQA 1BMOA 2GKVA 1M8CA 1SGPI 1CT2I 2N52A 2ARPF 2LEOA 4HGUA 2KCXA 2SGQI 2WCYA 1OMUA 1HJAI 1PPFI 1IY5A 1CT0I 1OMTA 2V53A 2GKRI 2NU0I 1UUCA 1IY6A 1NUBA 3SEKC 2JZMA 1SGQI 1HDLA 1TURA 2NU2I 2SGFI 3B4VC 2B0UC 4OVOA 2N17A 2JXDA 2ERWA 1SGNI 1TBQR 1MT1A 1TGSI
chains in the Genus database with same CATH superfamily
1PCEA 1V1HA 3TOBA 1LR9A 1XBTA 2RC4A 1DS3I 3OL0A 3UOEA 3UEYA 1MJBA 2ORWA 3SGBI 1FARA 4MPIA 2E5RA 1KMAA 1ULNA 2N71A 1N13A 2V1CC 3E59A 3TO7A 1Y1CA 2JW6A 2PQ8A 5DAEA 4AMLA 1X4SA 2DKVA 1CSOI 1UVFA 2J9RA 2YUUA 1CT4I 1CE3A 2RIJA 4WP4A 2GVIA 3OXFA 2SGEI 5CCLA 1TBRR 1K7UA 1XX6A 1SGEI 2DB6A 2A20A 2F3CI 4JCVE 4UXIA 1R0RI 1YTPA 5HI7A 2M5XA 2QPOA 3TOAA 5JHWC 2N1AB 2OZUA 2GKTI 2KMPA 1LR8A 1TBNA 3UEJA 1WGCA 1AN1I 2BUSA 2KMOA 5FUVA 2NU4I 3BJIA 1K7TA 1SGYI 4SGBI 1SGRI 1RFHA 3QAHA 1Y1BA 1HPTA 3UGDA 7WGAA 2LB7A 2FNFX 1Z2IA 2LUYA 2ROWA 1NXUA 2XRCA 1OYVI 4UXJA 1KBEA 1CHOI 4E1RA 1BUSA 2CWHA 1MT1A 2ORVA 2OU2A 1OVOA 2W0TA 1UHAA 3R5CA 3TJQA 3VDUA 1H0ZA 1WKXA 2L8EA 3RU0A 2P6AC 1CGII 3HH2C 4A24A 1UVGA 3FSXA 4L9MA 1LR7A 3PDNA 5E3PA 1TUSA 2CWFA 2WVJA 1YU6C 3QWPA 2CWGA 3SGQI 2JA1A 1DS2I 2L7XA 1CGJI 1W4RA 1TIHA 3OXGA 2E73A 2VRWB 1M8BA 5FUYA 1XA6A 2YQPA 1V1IA 2QQ0A 1ULMA 3VDPA 4E1PA 1FAQA 3GOXA 9WGAA 2KMRA 1HEVA 2OVOA 1PJUA 1SGDI 3QTLD 2NU3I 2DIPA 2QQCA 2JYYA 1Y8FA 3UGLA 5J8FA 1FYBA 5EX3A 3FSYA 3TO9A 5J8CA 1S20A 1ULKA 4GI3C 2NU1I 1K7VA 5CCMA 3OXLA 3R5BA 1IW4A 4DNCA 1PTQA 2ELIA 3VE5A 2ENZA 1Q9BA 1TOTA 2CJSC 1P9GA 3UGIA 2J87A 2QQDA 1FY7A 3D00A 2OD1A 3OVOA 1Z7KB 2SGPI 3R5DA 2SGDI 2KMQA 1P9ZA 1BMOA 2GKVA 1TBOA 1M8CA 1SGPI 3E2IA 3UFFA 3KY9A 3MEKA 1VDDA 3FC3A 1CT2I 2V1CA 5EX0A 2N52A 2ARPF 2LEOA 2ODDA 2WGCA 4HGUA 5E3RA 4FKDA 2ENNA 5HQ8A 2KCXA 2SGQI 4UXHA 3TO6A 2WCYA 2B8TA 1OMUA 1MJ9A 1HJAI 2GIVA 1PPFI 1IY5A 1CT0I 2UVOA 4B6DA 1OMTA 5FUWA 2V53A 2K9HA 2GKRI 1X74A 1UUCA 2NU0I 1NUBA 1IY6A 3SEKC 2JZMA 2UZ3A 1SGQI 1HDLA 1TURA 2NU2I 2SGFI 3B4VC 1WGTA 2B0UC 5E3QA 5FUXA 1WTJA 4OVOA 2Y0MA 2N17A 1PTRA 1KBFA 2QQEA 2X3TA 3CXLA 1U5KA 2JXDA 3R5AA 2X52A 1MJAA 2ERWA 1SGNI 1TBQR 1W3SA 1R79A 1TGSI
chains in the Genus database with same CATH topology
1PCEA 1V1HA 1LR9A 1XBTA 1DS3I 3OL0A 3UEYA 2ORWA 3SGBI 1FARA 2E5RA 1KMAA 2N71A 1N13A 2V1CC 3E59A 1Y1CA 2JW6A 5DAEA 1X4SA 1CSOI 1UVFA 2J9RA 2YUUA 1CT4I 1CE3A 2GVIA 3OXFA 2SGEI 5CCLA 1TBRR 1XX6A 1SGEI 2DB6A 2A20A 2F3CI 4JCVE 4UXIA 1R0RI 1YTPA 5HI7A 2M5XA 2QPOA 5JHWC 2N1AB 2GKTI 2KMPA 1LR8A 1TBNA 3UEJA 1AN1I 2BUSA 2KMOA 5FUVA 2NU4I 3BJIA 1SGYI 4SGBI 1SGRI 1RFHA 1Y1BA 1HPTA 3UGDA 2FNFX 2LUYA 2ROWA 2XRCA 4UXJA 1OYVI 1KBEA 1CHOI 4E1RA 1BUSA 1MT1A 2ORVA 3VDUA 1OVOA 2W0TA 3TJQA 1H0ZA 2L8EA 3RU0A 2P6AC 1CGII 3HH2C 4A24A 1UVGA 4L9MA 1LR7A 3PDNA 1TUSA 2WVJA 1YU6C 3QWPA 3SGQI 2JA1A 1DS2I 2L7XA 1CGJI 1W4RA 1TIHA 3OXGA 2E73A 2VRWB 1M8BA 5FUYA 1XA6A 2YQPA 1V1IA 2QQ0A 3VDPA 4E1PA 1FAQA 3GOXA 2KMRA 2OVOA 1PJUA 1SGDI 3QTLD 2NU3I 2DIPA 2QQCA 2JYYA 1Y8FA 3UGLA 1FYBA 5EX3A 4GI3C 2NU1I 5CCMA 3OXLA 1IW4A 1PTQA 2ELIA 3VE5A 2ENZA 1TOTA 2CJSC 3UGIA 2J87A 2QQDA 3D00A 2OD1A 3OVOA 1Z7KB 2SGPI 2SGDI 2KMQA 1BMOA 2GKVA 1TBOA 1M8CA 1SGPI 3E2IA 3UFFA 3KY9A 3MEKA 1VDDA 3FC3A 1CT2I 2V1CA 5EX0A 2N52A 2ARPF 2LEOA 2ODDA 4HGUA 5HQ8A 4FKDA 2ENNA 2KCXA 2SGQI 4UXHA 2WCYA 2B8TA 1OMUA 1HJAI 1PPFI 1IY5A 1CT0I 4B6DA 1OMTA 5FUWA 2V53A 2K9HA 2GKRI 1X74A 1UUCA 2NU0I 1NUBA 1IY6A 3SEKC 2JZMA 2UZ3A 1SGQI 1HDLA 1TURA 2NU2I 2SGFI 3B4VC 2B0UC 5FUXA 4OVOA 2N17A 1PTRA 1KBFA 2QQEA 3CXLA 1U5KA 2JXDA 2ERWA 1SGNI 1TBQR 1W3SA 1R79A 1TGSI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PCE A;  1LR9 A;  1DS3 I;  3SGB I;  1KMA A;  2N71 A;  1N13 A;  1Y1C A;  5DAE A;  1CSO I;  1UVF A;  1CT4 I;  1CE3 A;  2SGE I;  1TBR R;  1SGE I;  2F3C I;  1R0R I;  1YTP A;  2M5X A;  5JHW C;  2GKT I;  2KMP A;  1LR8 A;  1AN1 I;  2KMO A;  2BUS A;  2NU4 I;  1SGY I;  4SGB I;  1SGR I;  1Y1B A;  1HPT A;  2XRC A;  1OYV I;  1CHO I;  1BUS A;  1OVO A;  3TJQ A;  1H0Z A;  2P6A C;  1CGI I;  3HH2 C;  1UVG A;  1LR7 A;  1TUS A;  1YU6 C;  3SGQ I;  1DS2 I;  1CGJ I;  1TIH A;  1M8B A;  2KMR A;  2OVO A;  1PJU A;  1SGD I;  3QTL D;  2NU3 I;  2QQC A;  2JYY A;  1FYB A;  4GI3 C;  2NU1 I;  1IW4 A;  2QQD A;  3OVO A;  1Z7K B;  2SGP I;  2SGD I;  2KMQ A;  1BMO A;  2GKV A;  1M8C A;  1SGP I;  1CT2 I;  2N52 A;  2ARP F;  2LEO A;  4HGU A;  2KCX A;  2SGQ I;  2WCY A;  1OMU A;  1HJA I;  1PPF I;  1IY5 A;  1CT0 I;  1OMT A;  2V53 A;  2GKR I;  2NU0 I;  1UUC A;  1IY6 A;  1NUB A;  3SEK C;  2JZM A;  1SGQ I;  1HDL A;  1TUR A;  2NU2 I;  2SGF I;  3B4V C;  2B0U C;  4OVO A;  2N17 A;  2JXD A;  2ERW A;  1SGN I;  1TBQ R;  1MT1 A;  1TGS I; 
#chains in the Genus database with same CATH topology
 1PCE A;  1V1H A;  3TOB A;  1LR9 A;  1XBT A;  2RC4 A;  1DS3 I;  3OL0 A;  3UOE A;  3UEY A;  1MJB A;  2ORW A;  3SGB I;  1FAR A;  4MPI A;  2E5R A;  1KMA A;  1ULN A;  2N71 A;  1N13 A;  2V1C C;  3E59 A;  3TO7 A;  1Y1C A;  2JW6 A;  2PQ8 A;  5DAE A;  4AML A;  1X4S A;  2DKV A;  1CSO I;  1UVF A;  2J9R A;  2YUU A;  1CT4 I;  1CE3 A;  2RIJ A;  4WP4 A;  2GVI A;  3OXF A;  2SGE I;  5CCL A;  1TBR R;  1K7U A;  1XX6 A;  1SGE I;  2DB6 A;  2A20 A;  2F3C I;  4JCV E;  4UXI A;  1R0R I;  1YTP A;  5HI7 A;  2M5X A;  2QPO A;  3TOA A;  5JHW C;  2N1A B;  2OZU A;  2GKT I;  2KMP A;  1LR8 A;  1TBN A;  3UEJ A;  1WGC A;  1AN1 I;  2BUS A;  2KMO A;  5FUV A;  2NU4 I;  3BJI A;  1K7T A;  1SGY I;  4SGB I;  1SGR I;  1RFH A;  3QAH A;  1Y1B A;  1HPT A;  3UGD A;  7WGA A;  2LB7 A;  2FNF X;  1Z2I A;  2LUY A;  2ROW A;  1NXU A;  2XRC A;  1OYV I;  4UXJ A;  1KBE A;  1CHO I;  4E1R A;  1BUS A;  2CWH A;  1MT1 A;  2ORV A;  2OU2 A;  1OVO A;  2W0T A;  1UHA A;  3R5C A;  3TJQ A;  3VDU A;  1H0Z A;  1WKX A;  2L8E A;  3RU0 A;  2P6A C;  1CGI I;  3HH2 C;  4A24 A;  1UVG A;  3FSX A;  4L9M A;  1LR7 A;  3PDN A;  5E3P A;  1TUS A;  2CWF A;  2WVJ A;  1YU6 C;  3QWP A;  2CWG A;  3SGQ I;  2JA1 A;  1DS2 I;  2L7X A;  1CGJ I;  1W4R A;  1TIH A;  3OXG A;  2E73 A;  2VRW B;  1M8B A;  5FUY A;  1XA6 A;  2YQP A;  1V1I A;  2QQ0 A;  1ULM A;  3VDP A;  4E1P A;  1FAQ A;  3GOX A;  9WGA A;  2KMR A;  1HEV A;  2OVO A;  1PJU A;  1SGD I;  3QTL D;  2NU3 I;  2DIP A;  2QQC A;  2JYY A;  1Y8F A;  3UGL A;  5J8F A;  1FYB A;  5EX3 A;  3FSY A;  3TO9 A;  5J8C A;  1S20 A;  1ULK A;  4GI3 C;  2NU1 I;  1K7V A;  5CCM A;  3OXL A;  3R5B A;  1IW4 A;  4DNC A;  1PTQ A;  2ELI A;  3VE5 A;  2ENZ A;  1Q9B A;  1TOT A;  2CJS C;  1P9G A;  3UGI A;  2J87 A;  2QQD A;  1FY7 A;  3D00 A;  2OD1 A;  3OVO A;  1Z7K B;  2SGP I;  3R5D A;  2SGD I;  2KMQ A;  1P9Z A;  1BMO A;  2GKV A;  1TBO A;  1M8C A;  1SGP I;  3E2I A;  3UFF A;  3KY9 A;  3MEK A;  1VDD A;  3FC3 A;  1CT2 I;  2V1C A;  5EX0 A;  2N52 A;  2ARP F;  2LEO A;  2ODD A;  2WGC A;  4HGU A;  5E3R A;  4FKD A;  2ENN A;  5HQ8 A;  2KCX A;  2SGQ I;  4UXH A;  3TO6 A;  2WCY A;  2B8T A;  1OMU A;  1MJ9 A;  1HJA I;  2GIV A;  1PPF I;  1IY5 A;  1CT0 I;  2UVO A;  4B6D A;  1OMT A;  5FUW A;  2V53 A;  2K9H A;  2GKR I;  1X74 A;  1UUC A;  2NU0 I;  1NUB A;  1IY6 A;  3SEK C;  2JZM A;  2UZ3 A;  1SGQ I;  1HDL A;  1TUR A;  2NU2 I;  2SGF I;  3B4V C;  1WGT A;  2B0U C;  5E3Q A;  5FUX A;  1WTJ A;  4OVO A;  2Y0M A;  2N17 A;  1PTR A;  1KBF A;  2QQE A;  2X3T A;  3CXL A;  1U5K A;  2JXD A;  3R5A A;  2X52 A;  1MJA A;  2ERW A;  1SGN I;  1TBQ R;  1W3S A;  1R79 A;  1TGS I; 
#chains in the Genus database with same CATH homology
 1PCE A;  1V1H A;  1LR9 A;  1XBT A;  1DS3 I;  3OL0 A;  3UEY A;  2ORW A;  3SGB I;  1FAR A;  2E5R A;  1KMA A;  2N71 A;  1N13 A;  2V1C C;  3E59 A;  1Y1C A;  2JW6 A;  5DAE A;  1X4S A;  1CSO I;  1UVF A;  2J9R A;  2YUU A;  1CT4 I;  1CE3 A;  2GVI A;  3OXF A;  2SGE I;  5CCL A;  1TBR R;  1XX6 A;  1SGE I;  2DB6 A;  2A20 A;  2F3C I;  4JCV E;  4UXI A;  1R0R I;  1YTP A;  5HI7 A;  2M5X A;  2QPO A;  5JHW C;  2N1A B;  2GKT I;  2KMP A;  1LR8 A;  1TBN A;  3UEJ A;  1AN1 I;  2BUS A;  2KMO A;  5FUV A;  2NU4 I;  3BJI A;  1SGY I;  4SGB I;  1SGR I;  1RFH A;  1Y1B A;  1HPT A;  3UGD A;  2FNF X;  2LUY A;  2ROW A;  2XRC A;  4UXJ A;  1OYV I;  1KBE A;  1CHO I;  4E1R A;  1BUS A;  1MT1 A;  2ORV A;  3VDU A;  1OVO A;  2W0T A;  3TJQ A;  1H0Z A;  2L8E A;  3RU0 A;  2P6A C;  1CGI I;  3HH2 C;  4A24 A;  1UVG A;  4L9M A;  1LR7 A;  3PDN A;  1TUS A;  2WVJ A;  1YU6 C;  3QWP A;  3SGQ I;  2JA1 A;  1DS2 I;  2L7X A;  1CGJ I;  1W4R A;  1TIH A;  3OXG A;  2E73 A;  2VRW B;  1M8B A;  5FUY A;  1XA6 A;  2YQP A;  1V1I A;  2QQ0 A;  3VDP A;  4E1P A;  1FAQ A;  3GOX A;  2KMR A;  2OVO A;  1PJU A;  1SGD I;  3QTL D;  2NU3 I;  2DIP A;  2QQC A;  2JYY A;  1Y8F A;  3UGL A;  1FYB A;  5EX3 A;  4GI3 C;  2NU1 I;  5CCM A;  3OXL A;  1IW4 A;  1PTQ A;  2ELI A;  3VE5 A;  2ENZ A;  1TOT A;  2CJS C;  3UGI A;  2J87 A;  2QQD A;  3D00 A;  2OD1 A;  3OVO A;  1Z7K B;  2SGP I;  2SGD I;  2KMQ A;  1BMO A;  2GKV A;  1TBO A;  1M8C A;  1SGP I;  3E2I A;  3UFF A;  3KY9 A;  3MEK A;  1VDD A;  3FC3 A;  1CT2 I;  2V1C A;  5EX0 A;  2N52 A;  2ARP F;  2LEO A;  2ODD A;  4HGU A;  5HQ8 A;  4FKD A;  2ENN A;  2KCX A;  2SGQ I;  4UXH A;  2WCY A;  2B8T A;  1OMU A;  1HJA I;  1PPF I;  1IY5 A;  1CT0 I;  4B6D A;  1OMT A;  5FUW A;  2V53 A;  2K9H A;  2GKR I;  1X74 A;  1UUC A;  2NU0 I;  1NUB A;  1IY6 A;  3SEK C;  2JZM A;  2UZ3 A;  1SGQ I;  1HDL A;  1TUR A;  2NU2 I;  2SGF I;  3B4V C;  2B0U C;  5FUX A;  4OVO A;  2N17 A;  1PTR A;  1KBF A;  2QQE A;  3CXL A;  1U5K A;  2JXD A;  2ERW A;  1SGN I;  1TBQ R;  1W3S A;  1R79 A;  1TGS I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...