1SHCA

Shc ptb domain complexed with a trka receptor phosphopeptide, nmr, minimized average structure
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
195
structure length
195
Chain Sequence
b'GSHMGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALDFNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSSLNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDVISTIGQAFELRFKQYLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SHC
publication title Structure and ligand recognition of the phosphotyrosine binding domain of Shc.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (signal transduction/peptide)
total genus 24
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 1996-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1shcA00
5FI0A 1MK7B 1OMWA 1U5FA 1BAKA 1OQNA 3ODOA 1X1FA 2J0JA 1W1DA 4GMVA 3UZTA 4Y94A 5LONB 1KZ7A 1WGUA 3TFMA 5HE1A 2W2XD 2DLWA 2GCJA 5DHFB 3ML4A 1TJ6A 2ADZA 2VRWB 5DI9B 4CHMA 2D2QA 3MDBC 1NI2A 4L6EA 4IAPA 1MAIA 5L81A 1I7AA 4HDQA 2G35A 4HATB 3WA0A 3U7DA 4KVGB 1Y5OA 3SUZA 1EAZA 5GOWB 1AQCA 2YS5A 1V61A 4A6KA 3DXEA 1X11A 4K17A 1BTKA 5DHAB 3KRWA 2P8VA 3M1IB 2K2JA 3KRXA 4HDOA 3FEHA 1K5GB 1XKEA 2NZ8B 2J0KA 3TCAA 4CHJA 5DH9B 1RJ2A 2MKRA 3DXDA 2P0DA 2YS3A 1ZC4B 2DYQA 3AU5A 2KCJA 2YT0A 2RLOA 1XX0A 2D9ZA 4YL8A 2XQNM 1Z87A 4EKUA 2D9WA 1DDMA 3LJUX 2GCLA 2UZRA 3ULCA 3KSYA 3V5WA 3D8FA 1UEFA 2ELBA 2OTXA 4A6HA 1J19A 1KI1B 3TO1A 4EJNA 1GC6A 5D27A 2K00A 1H4RA 1LW3A 1QQGA 1PLSA 2DHIA 2HTHB 1XD4A 2M38A 2M14A 3SO6A 4TYZA 3G9WA 3SNHA 4CYEA 2MDXA 2N23A 2DYNA 3PSCA 2H7DA 1TQZA 1M7RA 4NY0A 5JHGA 2RVBB 1UNQA 2CRFA 1FB8A 2CY5A 2QKLA 1V5MA 1WJ1A 4NSWA 5D3WA 1FGZA 1DYNA 2Y8GA 2YVCA 1I2HA 4WJ7A 2EJ8A 5EFXA 4D0NB 1MKEA 2VSZA 2DA0A 3PG7A 5KQ4A 1FOEA 1WJMA 3VOQA 2DHJA 3ODXA 1DDVA 1ZM0A 2L2IA 5D3VA 2MWNB 3BJIA 2PZ1A 4WVFB 5HE3A 4F7GA 4HAYB 2LG1A 4F7UP 2L1CA 2RUKB 3U8ZA 2CODA 2LOZA 4IFSA 1LB1A 5C79A 1AWEA 1MIZB 3O96A 1NU2A 3PP2A 1XODA 5CLLB 4MY6A 4IOYX 4BBKA 2R0DA 2Q13A 3CIKA 1E5WA 1WVHA 1FHXA 2Z0QA 2VKIA 3VIAA 4K81A 1GC7A 2CAYA 1P6SA 2W2WA 4DX8A 5FI1A 1SHCA 3P6AA 2CY4A 1EF1A 4GZUA 1IRSA 3PVLA 2UZSA 2W2XC 4KHOA 4P7IA 3A8PA 2Y7BA 4HB3B 3DXCA 1GG3A 1K5DB 1FAOA 5KQ1A 2BCJA 3PVWA 1PFJA 3KZ1A 2D4QA 2YRYA 2DKQA 2COCA 1MK9B 2DHKA 4K2PA 1N3HA 2LKOA 3HK0A 4HAZB 5J3QA 5CLQB 2DN6A 4F7HA 2FJLA 3TVVA 4ZRJA 5J3TA 4KAXB 2KUPA 1P3RA 3F0WA 5D3XA 2I5CA 3A8QA 1J0WA 3TW1A 3RCPA 1W1GA 2Z0PA 2LYDA 5LOPB 4HAXB 3HQCA 2EC1A 3NSUA 2EMTA 1MIXA 3ULBA 3D8EA 2COFA 4HB0B 1FGYA 1V89A 1WI1A 4WSFA 3GYOA 2RNRB 2DFKA 3AU4A 1DDWA 3BINA 2H7EA 5JP4A 1NTVA 3CXBB 4ZRKA 2GJYA 3PEGA 3SV1A 2LOXA 3X23A 3PZDA 1FHWA 2I5FA 4GPTB 1DROA 2D11A 3ODWA 3WYFB 5JLJB 5KCVA 1ZC3B 2J59M 4XWXA 5DIFB 2AEHA 1OY2A 1Q67A 4KHAA 2RGNB 2D10A 3T06A 3HW2B 2EMSA 1X1GA 4TKNA 4HB4B 3F5RA 4C0AA 4A5KA 4PQ0A 2E2XA 2D9YA 4DXAB 3ZDTA 1MPHA 1XR0B 1UPQA 2NMBA 4K2OA 4GMXB 1FHOA 1PMSA 2MFQA 3D8DA 2I1KA 5HE0A 4H8SA 2DKPA 4Z2NA 2Y8FA 4A6FA 1NTYA 1KZGA 4GN1A 4B6HA 3IVFA 2R09A 1BTNA 3KY9A 3N7CA 2COAA 2JP2A 3SYXA 3ZVRA 3FM8C 4PNKA 1U27A 2V76A 1WGQA 1EVHA 4HB2B 2ROZB 3P7ZA 2YS1A 3PVUA 2RSGA 4DX90 5C5BA 2IYBA 1W1HA 3QBVB 1SGHA 4Z2MB 2D9XA 1U5EA 2P0HA 4GXBA 2YT1A 2K2UA 3FSSA 2AL6A 2GS0A 1DBHA 2YF0A 5C16A 4MT7A 4A6FB 1EGXA 1X86A 1H10A 1U29A 4MK0A 2N0YA 2LULA 1U5DA 1B55A 2ZPYA 1TXDA 3AJ4A 1WG7A 2DX5A 1BWNA 3GYPA 1XCGA 5C5BB 1X05A 2DX1A 1M7EA 2Z0OA 1U2BA 2ROVA 1ZVRA 5C6RA 3OANA 4HAUB 2YSZA 2D9VA 5JHHA 5HE2A 4HAVB 1ZSQA 3MPXA 1UNRA 1UNPA 1V5PA 2UVMA 2QKMA 2IFSA 4YONA 4HHVA 4ZRIA 1V88A 1Y19B 4DBBA 1U5GA 5D3YA 2P0FA 1ISNA 1RRPB 4EMOA 4HAWB 2KGXB 2ELAA 1UPRA 3QIJA 2OQBA 2DTCA 3QWMA 5J3YA 4KHBB 2I1JA 2J0MA 1P5TA 1V5UA 3A98B 2X18A 1QC6A 2HE7A
chains in the Genus database with same CATH superfamily
5FI0A 1MK7B 1OMWA 1U5FA 1BAKA 1OQNA 3ODOA 1X1FA 2J0JA 2KUQA 1W1DA 4GMVA 3UZTA 4Y94A 5LONB 1KZ7A 3U12A 1WGUA 3TFMA 5HE1A 2W2XD 2DLWA 2GCJA 5DHFB 3ML4A 1TJ6A 2ADZA 2VRWB 5DI9B 4CHMA 2D2QA 3HSAA 3MDBC 1NI2A 2KIGA 4L6EA 4IAPA 1MAIA 5L81A 1I7AA 4HDQA 2G35A 4HATB 3WA0A 3U7DA 4KVGB 1Y5OA 3SUZA 1EAZA 5GOWB 1AQCA 2YS5A 1V61A 4A6KA 3DXEA 4HSIA 1X11A 4K17A 1BTKA 5DHAB 2KIEA 3KRWA 2P8VA 2K2JA 3M1IB 3KRXA 4GOUA 4HDOA 3FEHA 1K5GB 1XKEA 2NZ8B 2J0KA 3TCAA 4CHJA 5DH9B 1RJ2A 1MI1A 2MKRA 3DXDA 2P0DA 3A58A 2YS3A 1ZC4B 2Z13A 4OT1A 2DYQA 3AU5A 2KCJA 2YT0A 2RLOA 1XX0A 2D9ZA 4YL8A 2XQNM 1Z87A 4EKUA 2D9WA 1DDMA 3LJUX 2GCLA 2UZRA 3ULCA 4KHBA 3KSYA 3V5WA 3D8FA 1UEFA 2ELBA 2OTXA 4A6HA 1J19A 1KI1B 3TO1A 4EJNA 1GC6A 5D27A 2K00A 1H4RA 1LW3A 1QQGA 2K8EA 1PLSA 2DHIA 2HTHB 5LG4B 1XD4A 2M38A 2M14A 4GNKB 3SO6A 2YT2A 4TYZA 3G9WA 4QJ5B 3SNHA 4CYEA 2MDXA 2N23A 2DYNA 3PSCA 2NBVA 4L1RA 2H7DA 1TQZA 1M7RA 4NY0A 5JHGA 2RVBB 1UNQA 2CRFA 1FB8A 2CY5A 2QKLA 2RRFA 2Z59A 1V5MA 1WJ1A 4NSWA 5D3WA 1FGZA 1DYNA 2Y8GA 2YVCA 1I2HA 4WJ7A 2EJ8A 5EFXA 4D0NB 1MKEA 2VSZA 2DA0A 3PG7A 5KQ4A 1FOEA 1WJMA 3VOQA 2DHJA 3ODXA 1DDVA 1ZM0A 2L2IA 5D3VA 2MWNB 3BJIA 2PZ1A 4WVFB 5HE3A 4F7GA 4HAYB 2LG1A 4F7UP 2L1CA 2RUKB 3U8ZA 2CODA 2LOZA 4IFSA 1LB1A 5C79A 1AWEA 1MIZB 3O96A 1NU2A 3PP2A 1XODA 5CLLB 4MY6A 4IOYX 4BBKA 2R0DA 2Q13A 3CIKA 1E5WA 1WVHA 1FHXA 2Z0QA 4QJ4B 2VKIA 3VIAA 4K81A 1GC7A 2CAYA 1P6SA 2W2WA 4DX8A 5FI1A 1SHCA 3P6AA 2CY4A 1EF1A 4GZUA 1IRSA 3PVLA 2UZSA 2KR0A 2W2XC 5IRSA 4KHOA 4P7IA 3A8PA 2Y7BA 4HB3B 5I2MA 3DXCA 1GG3A 1K5DB 1FAOA 4CSQA 5KQ1A 2BCJA 3PVWA 1PFJA 1T77A 2GUMA 3KZ1A 2D4QA 2YRYA 2DKQA 2COCA 1MK9B 2DHKA 4K2PA 1N3HA 2LKOA 3HK0A 4HAZB 5J3QA 5CLQB 2DN6A 4F7HA 2FJLA 3TVVA 4ZRJA 5J3TA 4KAXB 2KUPA 1P3RA 3F0WA 5D3XA 2I5CA 2R2YA 3A8QA 1J0WA 3TW1A 3RCPA 1W1GA 2Z0PA 2LYDA 3B77A 4HAXB 5LOPB 3HQCA 2EC1A 3NSUA 2EMTA 1MIXA 3ULBA 3D8EA 3FVCA 2COFA 3HIEA 4HB0B 1FGYA 1V89A 1WI1A 4WSFA 3GYOA 2RNRB 2DFKA 3AU4A 3NWFA 1DDWA 3BINA 2H7EA 5JP4A 1NTVA 3CXBB 4ZRKA 2GJYA 3PEGA 3SV1A 2LOXA 3X23A 3PZDA 1FHWA 2I5FA 4GPTB 1DROA 2D11A 3ODWA 3WYFB 5JLJB 5KCVA 1ZC3B 2J59M 4XWXA 5DIFB 2AEHA 1OY2A 1Q67A 4KHAA 2RGNB 2Z14A 2D10A 3T06A 3HW2B 2EMSA 1X1GA 4TKNA 4HB4B 3F5RA 4C0AA 2Z4DA 4A5KA 4PQ0A 2E2XA 2D9YA 4DXAB 3ZDTA 1MPHA 3NWAA 1XR0B 1UPQA 2NMBA 4K2OA 4QJ3B 4GMXB 1FHOA 1PMSA 2MFQA 3D8DA 2I1KA 5HE0A 4H8SA 2DKPA 4Z2NA 2Y8FA 4A6FA 1NTYA 1KZGA 4GN1A 4QXAB 4B6HA 3IVFA 2R09A 1BTNA 3KY9A 3N7CA 2COAA 2JP2A 3SYXA 3ZVRA 3FM8C 3NW8A 4PNKA 1U27A 2V76A 1WGQA 3OHMB 1EVHA 4HB2B 2ROZB 3P7ZA 2YS1A 3PVUA 2RSGA 4DX90 5C5BA 2IYBA 1W1HA 3QBVB 1SGHA 4Z2MB 2D9XA 1U5EA 2P0HA 4GXBA 2YT1A 2K2UA 2ZKMX 3FSSA 2AL6A 2GS0A 1DBHA 2YF0A 5C16A 4MT7A 4A6FB 1EGXA 1X86A 1H10A 3DCXA 1U29A 4MK0A 2N0YA 2LULA 1U5DA 1B55A 2ZPYA 1TXDA 3AJ4A 1WG7A 2DX5A 1BWNA 3GYPA 1XCGA 5C5BB 1X05A 1ZYIA 2DX1A 1M7EA 2Z0OA 1U2BA 2ROVA 1ZVRA 5C6RA 3OANA 4HAUB 2YSZA 2D9VA 5JHHA 2FJUB 5HE2A 4HAVB 1ZSQA 4D6WA 3MPXA 1UNRA 1UNPA 1V5PA 2UVMA 2QKMA 2IFSA 2K49A 4OSNA 5M4YB 4YONA 4HHVA 4ZRIA 1V88A 1Y19B 5I2SA 4DBBA 1U5GA 5D3YA 2P0FA 1ISNA 1RRPB 4EMOA 4HAWB 2KGXB 2ELAA 1UPRA 3QIJA 2OQBA 2DTCA 3QWMA 5J3YA 4KHBB 3NWDA 2I1JA 2J0MA 1P5TA 4DIXA 1V5UA 3A98B 2X18A 1QC6A 2HE7A
chains in the Genus database with same CATH topology
5FI0A 1MK7B 1OMWA 1U5FA 1BAKA 1OQNA 3ODOA 1X1FA 2J0JA 1W1DA 4GMVA 3UZTA 4Y94A 5LONB 1KZ7A 1WGUA 3TFMA 5HE1A 2W2XD 2DLWA 2GCJA 5DHFB 3ML4A 1TJ6A 2ADZA 2VRWB 5DI9B 4CHMA 2D2QA 3MDBC 1NI2A 4L6EA 4IAPA 1MAIA 5L81A 1I7AA 4HDQA 2G35A 4HATB 3WA0A 3U7DA 4KVGB 1Y5OA 3SUZA 1EAZA 5GOWB 1AQCA 2YS5A 1V61A 4A6KA 3DXEA 1X11A 4K17A 1BTKA 5DHAB 3KRWA 2P8VA 3M1IB 2K2JA 3KRXA 4HDOA 3FEHA 1K5GB 1XKEA 2NZ8B 2J0KA 3TCAA 4CHJA 5DH9B 1RJ2A 2MKRA 3DXDA 2P0DA 2YS3A 1ZC4B 2DYQA 3AU5A 2KCJA 2YT0A 2RLOA 1XX0A 2D9ZA 4YL8A 2XQNM 1Z87A 4EKUA 2D9WA 1DDMA 3LJUX 2GCLA 2UZRA 3ULCA 3KSYA 3V5WA 3D8FA 1UEFA 2ELBA 2OTXA 4A6HA 1J19A 1KI1B 3TO1A 4EJNA 1GC6A 5D27A 2K00A 1H4RA 1LW3A 1QQGA 1PLSA 2DHIA 2HTHB 1XD4A 2M38A 2M14A 3SO6A 4TYZA 3G9WA 3SNHA 4CYEA 2MDXA 2N23A 2DYNA 3PSCA 2H7DA 1TQZA 1M7RA 4NY0A 5JHGA 2RVBB 1UNQA 2CRFA 1FB8A 2CY5A 2QKLA 1V5MA 1WJ1A 4NSWA 5D3WA 1FGZA 1DYNA 2Y8GA 2YVCA 1I2HA 4WJ7A 2EJ8A 5EFXA 4D0NB 1MKEA 2VSZA 2DA0A 3PG7A 5KQ4A 1FOEA 1WJMA 3VOQA 2DHJA 3ODXA 1DDVA 1ZM0A 2L2IA 5D3VA 2MWNB 3BJIA 2PZ1A 4WVFB 5HE3A 4F7GA 4HAYB 2LG1A 4F7UP 2L1CA 2RUKB 3U8ZA 2CODA 2LOZA 4IFSA 1LB1A 5C79A 1AWEA 1MIZB 3O96A 1NU2A 3PP2A 1XODA 5CLLB 4MY6A 4IOYX 4BBKA 2R0DA 2Q13A 3CIKA 1E5WA 1WVHA 1FHXA 2Z0QA 2VKIA 3VIAA 4K81A 1GC7A 2CAYA 1P6SA 2W2WA 4DX8A 5FI1A 1SHCA 3P6AA 2CY4A 1EF1A 4GZUA 1IRSA 3PVLA 2UZSA 2W2XC 4KHOA 4P7IA 3A8PA 2Y7BA 4HB3B 3DXCA 1GG3A 1K5DB 1FAOA 5KQ1A 2BCJA 3PVWA 1PFJA 3KZ1A 2D4QA 2YRYA 2DKQA 2COCA 1MK9B 2DHKA 4K2PA 1N3HA 2LKOA 3HK0A 4HAZB 5J3QA 5CLQB 2DN6A 4F7HA 2FJLA 3TVVA 4ZRJA 5J3TA 4KAXB 2KUPA 1P3RA 3F0WA 5D3XA 2I5CA 3A8QA 1J0WA 3TW1A 3RCPA 1W1GA 2Z0PA 2LYDA 5LOPB 4HAXB 3HQCA 2EC1A 3NSUA 2EMTA 1MIXA 3ULBA 3D8EA 2COFA 4HB0B 1FGYA 1V89A 1WI1A 4WSFA 3GYOA 2RNRB 2DFKA 3AU4A 1DDWA 3BINA 2H7EA 5JP4A 1NTVA 3CXBB 4ZRKA 2GJYA 3PEGA 3SV1A 2LOXA 3X23A 3PZDA 1FHWA 2I5FA 4GPTB 1DROA 2D11A 3ODWA 3WYFB 5JLJB 5KCVA 1ZC3B 2J59M 4XWXA 5DIFB 2AEHA 1OY2A 1Q67A 4KHAA 2RGNB 2D10A 3T06A 3HW2B 2EMSA 1X1GA 4TKNA 4HB4B 3F5RA 4C0AA 4A5KA 4PQ0A 2E2XA 2D9YA 4DXAB 3ZDTA 1MPHA 1XR0B 1UPQA 2NMBA 4K2OA 4GMXB 1FHOA 1PMSA 2MFQA 3D8DA 2I1KA 5HE0A 4H8SA 2DKPA 4Z2NA 2Y8FA 4A6FA 1NTYA 1KZGA 4GN1A 4B6HA 3IVFA 2R09A 1BTNA 3KY9A 3N7CA 2COAA 2JP2A 3SYXA 3ZVRA 3FM8C 4PNKA 1U27A 2V76A 1WGQA 1EVHA 4HB2B 2ROZB 3P7ZA 2YS1A 3PVUA 2RSGA 4DX90 5C5BA 2IYBA 1W1HA 3QBVB 1SGHA 4Z2MB 2D9XA 1U5EA 2P0HA 4GXBA 2YT1A 2K2UA 3FSSA 2AL6A 2GS0A 1DBHA 2YF0A 5C16A 4MT7A 4A6FB 1EGXA 1X86A 1H10A 1U29A 4MK0A 2N0YA 2LULA 1U5DA 1B55A 2ZPYA 1TXDA 3AJ4A 1WG7A 2DX5A 1BWNA 3GYPA 1XCGA 5C5BB 1X05A 2DX1A 1M7EA 2Z0OA 1U2BA 2ROVA 1ZVRA 5C6RA 3OANA 4HAUB 2YSZA 2D9VA 5JHHA 5HE2A 4HAVB 1ZSQA 3MPXA 1UNRA 1UNPA 1V5PA 2UVMA 2QKMA 2IFSA 4YONA 4HHVA 4ZRIA 1V88A 1Y19B 4DBBA 1U5GA 5D3YA 2P0FA 1ISNA 1RRPB 4EMOA 4HAWB 2KGXB 2ELAA 1UPRA 3QIJA 2OQBA 2DTCA 3QWMA 5J3YA 4KHBB 2I1JA 2J0MA 1P5TA 1V5UA 3A98B 2X18A 1QC6A 2HE7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FI0 A;  1MK7 B;  1OMW A;  1U5F A;  1BAK A;  1OQN A;  3ODO A;  1X1F A;  2J0J A;  1W1D A;  4GMV A;  3UZT A;  4Y94 A;  5LON B;  1KZ7 A;  1WGU A;  3TFM A;  5HE1 A;  2W2X D;  2DLW A;  2GCJ A;  5DHF B;  3ML4 A;  1TJ6 A;  2ADZ A;  2VRW B;  5DI9 B;  4CHM A;  2D2Q A;  3MDB C;  1NI2 A;  4L6E A;  4IAP A;  1MAI A;  5L81 A;  1I7A A;  4HDQ A;  2G35 A;  4HAT B;  3WA0 A;  3U7D A;  4KVG B;  1Y5O A;  3SUZ A;  1EAZ A;  5GOW B;  1AQC A;  2YS5 A;  1V61 A;  4A6K A;  3DXE A;  1X11 A;  4K17 A;  1BTK A;  5DHA B;  3KRW A;  2P8V A;  3M1I B;  2K2J A;  3KRX A;  4HDO A;  3FEH A;  1K5G B;  1XKE A;  2NZ8 B;  2J0K A;  3TCA A;  4CHJ A;  5DH9 B;  1RJ2 A;  2MKR A;  3DXD A;  2P0D A;  2YS3 A;  1ZC4 B;  2DYQ A;  3AU5 A;  2KCJ A;  2YT0 A;  2RLO A;  1XX0 A;  2D9Z A;  4YL8 A;  2XQN M;  1Z87 A;  4EKU A;  2D9W A;  1DDM A;  3LJU X;  2GCL A;  2UZR A;  3ULC A;  3KSY A;  3V5W A;  3D8F A;  1UEF A;  2ELB A;  2OTX A;  4A6H A;  1J19 A;  1KI1 B;  3TO1 A;  4EJN A;  1GC6 A;  5D27 A;  2K00 A;  1H4R A;  1LW3 A;  1QQG A;  1PLS A;  2DHI A;  2HTH B;  1XD4 A;  2M38 A;  2M14 A;  3SO6 A;  4TYZ A;  3G9W A;  3SNH A;  4CYE A;  2MDX A;  2N23 A;  2DYN A;  3PSC A;  2H7D A;  1TQZ A;  1M7R A;  4NY0 A;  5JHG A;  2RVB B;  1UNQ A;  2CRF A;  1FB8 A;  2CY5 A;  2QKL A;  1V5M A;  1WJ1 A;  4NSW A;  5D3W A;  1FGZ A;  1DYN A;  2Y8G A;  2YVC A;  1I2H A;  4WJ7 A;  2EJ8 A;  5EFX A;  4D0N B;  1MKE A;  2VSZ A;  2DA0 A;  3PG7 A;  5KQ4 A;  1FOE A;  1WJM A;  3VOQ A;  2DHJ A;  3ODX A;  1DDV A;  1ZM0 A;  2L2I A;  5D3V A;  2MWN B;  3BJI A;  2PZ1 A;  4WVF B;  5HE3 A;  4F7G A;  4HAY B;  2LG1 A;  4F7U P;  2L1C A;  2RUK B;  3U8Z A;  2COD A;  2LOZ A;  4IFS A;  1LB1 A;  5C79 A;  1AWE A;  1MIZ B;  3O96 A;  1NU2 A;  3PP2 A;  1XOD A;  5CLL B;  4MY6 A;  4IOY X;  4BBK A;  2R0D A;  2Q13 A;  3CIK A;  1E5W A;  1WVH A;  1FHX A;  2Z0Q A;  2VKI A;  3VIA A;  4K81 A;  1GC7 A;  2CAY A;  1P6S A;  2W2W A;  4DX8 A;  5FI1 A;  1SHC A;  3P6A A;  2CY4 A;  1EF1 A;  4GZU A;  1IRS A;  3PVL A;  2UZS A;  2W2X C;  4KHO A;  4P7I A;  3A8P A;  2Y7B A;  4HB3 B;  3DXC A;  1GG3 A;  1K5D B;  1FAO A;  5KQ1 A;  2BCJ A;  3PVW A;  1PFJ A;  3KZ1 A;  2D4Q A;  2YRY A;  2DKQ A;  2COC A;  1MK9 B;  2DHK A;  4K2P A;  1N3H A;  2LKO A;  3HK0 A;  4HAZ B;  5J3Q A;  5CLQ B;  2DN6 A;  4F7H A;  2FJL A;  3TVV A;  4ZRJ A;  5J3T A;  4KAX B;  2KUP A;  1P3R A;  3F0W A;  5D3X A;  2I5C A;  3A8Q A;  1J0W A;  3TW1 A;  3RCP A;  1W1G A;  2Z0P A;  2LYD A;  5LOP B;  4HAX B;  3HQC A;  2EC1 A;  3NSU A;  2EMT A;  1MIX A;  3ULB A;  3D8E A;  2COF A;  4HB0 B;  1FGY A;  1V89 A;  1WI1 A;  4WSF A;  3GYO A;  2RNR B;  2DFK A;  3AU4 A;  1DDW A;  3BIN A;  2H7E A;  5JP4 A;  1NTV A;  3CXB B;  4ZRK A;  2GJY A;  3PEG A;  3SV1 A;  2LOX A;  3X23 A;  3PZD A;  1FHW A;  2I5F A;  4GPT B;  1DRO A;  2D11 A;  3ODW A;  3WYF B;  5JLJ B;  5KCV A;  1ZC3 B;  2J59 M;  4XWX A;  5DIF B;  2AEH A;  1OY2 A;  1Q67 A;  4KHA A;  2RGN B;  2D10 A;  3T06 A;  3HW2 B;  2EMS A;  1X1G A;  4TKN A;  4HB4 B;  3F5R A;  4C0A A;  4A5K A;  4PQ0 A;  2E2X A;  2D9Y A;  4DXA B;  3ZDT A;  1MPH A;  1XR0 B;  1UPQ A;  2NMB A;  4K2O A;  4GMX B;  1FHO A;  1PMS A;  2MFQ A;  3D8D A;  2I1K A;  5HE0 A;  4H8S A;  2DKP A;  4Z2N A;  2Y8F A;  4A6F A;  1NTY A;  1KZG A;  4GN1 A;  4B6H A;  3IVF A;  2R09 A;  1BTN A;  3KY9 A;  3N7C A;  2COA A;  2JP2 A;  3SYX A;  3ZVR A;  3FM8 C;  4PNK A;  1U27 A;  2V76 A;  1WGQ A;  1EVH A;  4HB2 B;  2ROZ B;  3P7Z A;  2YS1 A;  3PVU A;  2RSG A;  4DX9 0;  5C5B A;  2IYB A;  1W1H A;  3QBV B;  1SGH A;  4Z2M B;  2D9X A;  1U5E A;  2P0H A;  4GXB A;  2YT1 A;  2K2U A;  3FSS A;  2AL6 A;  2GS0 A;  1DBH A;  2YF0 A;  5C16 A;  4MT7 A;  4A6F B;  1EGX A;  1X86 A;  1H10 A;  1U29 A;  4MK0 A;  2N0Y A;  2LUL A;  1U5D A;  1B55 A;  2ZPY A;  1TXD A;  3AJ4 A;  1WG7 A;  2DX5 A;  1BWN A;  3GYP A;  1XCG A;  5C5B B;  1X05 A;  2DX1 A;  1M7E A;  2Z0O A;  1U2B A;  2ROV A;  1ZVR A;  5C6R A;  3OAN A;  4HAU B;  2YSZ A;  2D9V A;  5JHH A;  5HE2 A;  4HAV B;  1ZSQ A;  3MPX A;  1UNR A;  1UNP A;  1V5P A;  2UVM A;  2QKM A;  2IFS A;  4YON A;  4HHV A;  4ZRI A;  1V88 A;  1Y19 B;  4DBB A;  1U5G A;  5D3Y A;  2P0F A;  1ISN A;  1RRP B;  4EMO A;  4HAW B;  2KGX B;  2ELA A;  1UPR A;  3QIJ A;  2OQB A;  2DTC A;  3QWM A;  5J3Y A;  4KHB B;  2I1J A;  2J0M A;  1P5T A;  1V5U A;  3A98 B;  2X18 A;  1QC6 A;  2HE7 A; 
#chains in the Genus database with same CATH topology
 5FI0 A;  1MK7 B;  1OMW A;  1U5F A;  1BAK A;  1OQN A;  3ODO A;  1X1F A;  2J0J A;  2KUQ A;  1W1D A;  4GMV A;  3UZT A;  4Y94 A;  5LON B;  1KZ7 A;  3U12 A;  1WGU A;  3TFM A;  5HE1 A;  2W2X D;  2DLW A;  2GCJ A;  5DHF B;  3ML4 A;  1TJ6 A;  2ADZ A;  2VRW B;  5DI9 B;  4CHM A;  2D2Q A;  3HSA A;  3MDB C;  1NI2 A;  2KIG A;  4L6E A;  4IAP A;  1MAI A;  5L81 A;  1I7A A;  4HDQ A;  2G35 A;  4HAT B;  3WA0 A;  3U7D A;  4KVG B;  1Y5O A;  3SUZ A;  1EAZ A;  5GOW B;  1AQC A;  2YS5 A;  1V61 A;  4A6K A;  3DXE A;  4HSI A;  1X11 A;  4K17 A;  1BTK A;  5DHA B;  2KIE A;  3KRW A;  2P8V A;  2K2J A;  3M1I B;  3KRX A;  4GOU A;  4HDO A;  3FEH A;  1K5G B;  1XKE A;  2NZ8 B;  2J0K A;  3TCA A;  4CHJ A;  5DH9 B;  1RJ2 A;  1MI1 A;  2MKR A;  3DXD A;  2P0D A;  3A58 A;  2YS3 A;  1ZC4 B;  2Z13 A;  4OT1 A;  2DYQ A;  3AU5 A;  2KCJ A;  2YT0 A;  2RLO A;  1XX0 A;  2D9Z A;  4YL8 A;  2XQN M;  1Z87 A;  4EKU A;  2D9W A;  1DDM A;  3LJU X;  2GCL A;  2UZR A;  3ULC A;  4KHB A;  3KSY A;  3V5W A;  3D8F A;  1UEF A;  2ELB A;  2OTX A;  4A6H A;  1J19 A;  1KI1 B;  3TO1 A;  4EJN A;  1GC6 A;  5D27 A;  2K00 A;  1H4R A;  1LW3 A;  1QQG A;  2K8E A;  1PLS A;  2DHI A;  2HTH B;  5LG4 B;  1XD4 A;  2M38 A;  2M14 A;  4GNK B;  3SO6 A;  2YT2 A;  4TYZ A;  3G9W A;  4QJ5 B;  3SNH A;  4CYE A;  2MDX A;  2N23 A;  2DYN A;  3PSC A;  2NBV A;  4L1R A;  2H7D A;  1TQZ A;  1M7R A;  4NY0 A;  5JHG A;  2RVB B;  1UNQ A;  2CRF A;  1FB8 A;  2CY5 A;  2QKL A;  2RRF A;  2Z59 A;  1V5M A;  1WJ1 A;  4NSW A;  5D3W A;  1FGZ A;  1DYN A;  2Y8G A;  2YVC A;  1I2H A;  4WJ7 A;  2EJ8 A;  5EFX A;  4D0N B;  1MKE A;  2VSZ A;  2DA0 A;  3PG7 A;  5KQ4 A;  1FOE A;  1WJM A;  3VOQ A;  2DHJ A;  3ODX A;  1DDV A;  1ZM0 A;  2L2I A;  5D3V A;  2MWN B;  3BJI A;  2PZ1 A;  4WVF B;  5HE3 A;  4F7G A;  4HAY B;  2LG1 A;  4F7U P;  2L1C A;  2RUK B;  3U8Z A;  2COD A;  2LOZ A;  4IFS A;  1LB1 A;  5C79 A;  1AWE A;  1MIZ B;  3O96 A;  1NU2 A;  3PP2 A;  1XOD A;  5CLL B;  4MY6 A;  4IOY X;  4BBK A;  2R0D A;  2Q13 A;  3CIK A;  1E5W A;  1WVH A;  1FHX A;  2Z0Q A;  4QJ4 B;  2VKI A;  3VIA A;  4K81 A;  1GC7 A;  2CAY A;  1P6S A;  2W2W A;  4DX8 A;  5FI1 A;  1SHC A;  3P6A A;  2CY4 A;  1EF1 A;  4GZU A;  1IRS A;  3PVL A;  2UZS A;  2KR0 A;  2W2X C;  5IRS A;  4KHO A;  4P7I A;  3A8P A;  2Y7B A;  4HB3 B;  5I2M A;  3DXC A;  1GG3 A;  1K5D B;  1FAO A;  4CSQ A;  5KQ1 A;  2BCJ A;  3PVW A;  1PFJ A;  1T77 A;  2GUM A;  3KZ1 A;  2D4Q A;  2YRY A;  2DKQ A;  2COC A;  1MK9 B;  2DHK A;  4K2P A;  1N3H A;  2LKO A;  3HK0 A;  4HAZ B;  5J3Q A;  5CLQ B;  2DN6 A;  4F7H A;  2FJL A;  3TVV A;  4ZRJ A;  5J3T A;  4KAX B;  2KUP A;  1P3R A;  3F0W A;  5D3X A;  2I5C A;  2R2Y A;  3A8Q A;  1J0W A;  3TW1 A;  3RCP A;  1W1G A;  2Z0P A;  2LYD A;  3B77 A;  4HAX B;  5LOP B;  3HQC A;  2EC1 A;  3NSU A;  2EMT A;  1MIX A;  3ULB A;  3D8E A;  3FVC A;  2COF A;  3HIE A;  4HB0 B;  1FGY A;  1V89 A;  1WI1 A;  4WSF A;  3GYO A;  2RNR B;  2DFK A;  3AU4 A;  3NWF A;  1DDW A;  3BIN A;  2H7E A;  5JP4 A;  1NTV A;  3CXB B;  4ZRK A;  2GJY A;  3PEG A;  3SV1 A;  2LOX A;  3X23 A;  3PZD A;  1FHW A;  2I5F A;  4GPT B;  1DRO A;  2D11 A;  3ODW A;  3WYF B;  5JLJ B;  5KCV A;  1ZC3 B;  2J59 M;  4XWX A;  5DIF B;  2AEH A;  1OY2 A;  1Q67 A;  4KHA A;  2RGN B;  2Z14 A;  2D10 A;  3T06 A;  3HW2 B;  2EMS A;  1X1G A;  4TKN A;  4HB4 B;  3F5R A;  4C0A A;  2Z4D A;  4A5K A;  4PQ0 A;  2E2X A;  2D9Y A;  4DXA B;  3ZDT A;  1MPH A;  3NWA A;  1XR0 B;  1UPQ A;  2NMB A;  4K2O A;  4QJ3 B;  4GMX B;  1FHO A;  1PMS A;  2MFQ A;  3D8D A;  2I1K A;  5HE0 A;  4H8S A;  2DKP A;  4Z2N A;  2Y8F A;  4A6F A;  1NTY A;  1KZG A;  4GN1 A;  4QXA B;  4B6H A;  3IVF A;  2R09 A;  1BTN A;  3KY9 A;  3N7C A;  2COA A;  2JP2 A;  3SYX A;  3ZVR A;  3FM8 C;  3NW8 A;  4PNK A;  1U27 A;  2V76 A;  1WGQ A;  3OHM B;  1EVH A;  4HB2 B;  2ROZ B;  3P7Z A;  2YS1 A;  3PVU A;  2RSG A;  4DX9 0;  5C5B A;  2IYB A;  1W1H A;  3QBV B;  1SGH A;  4Z2M B;  2D9X A;  1U5E A;  2P0H A;  4GXB A;  2YT1 A;  2K2U A;  2ZKM X;  3FSS A;  2AL6 A;  2GS0 A;  1DBH A;  2YF0 A;  5C16 A;  4MT7 A;  4A6F B;  1EGX A;  1X86 A;  1H10 A;  3DCX A;  1U29 A;  4MK0 A;  2N0Y A;  2LUL A;  1U5D A;  1B55 A;  2ZPY A;  1TXD A;  3AJ4 A;  1WG7 A;  2DX5 A;  1BWN A;  3GYP A;  1XCG A;  5C5B B;  1X05 A;  1ZYI A;  2DX1 A;  1M7E A;  2Z0O A;  1U2B A;  2ROV A;  1ZVR A;  5C6R A;  3OAN A;  4HAU B;  2YSZ A;  2D9V A;  5JHH A;  2FJU B;  5HE2 A;  4HAV B;  1ZSQ A;  4D6W A;  3MPX A;  1UNR A;  1UNP A;  1V5P A;  2UVM A;  2QKM A;  2IFS A;  2K49 A;  4OSN A;  5M4Y B;  4YON A;  4HHV A;  4ZRI A;  1V88 A;  1Y19 B;  5I2S A;  4DBB A;  1U5G A;  5D3Y A;  2P0F A;  1ISN A;  1RRP B;  4EMO A;  4HAW B;  2KGX B;  2ELA A;  1UPR A;  3QIJ A;  2OQB A;  2DTC A;  3QWM A;  5J3Y A;  4KHB B;  3NWD A;  2I1J A;  2J0M A;  1P5T A;  4DIX A;  1V5U A;  3A98 B;  2X18 A;  1QC6 A;  2HE7 A; 
#chains in the Genus database with same CATH homology
 5FI0 A;  1MK7 B;  1OMW A;  1U5F A;  1BAK A;  1OQN A;  3ODO A;  1X1F A;  2J0J A;  1W1D A;  4GMV A;  3UZT A;  4Y94 A;  5LON B;  1KZ7 A;  1WGU A;  3TFM A;  5HE1 A;  2W2X D;  2DLW A;  2GCJ A;  5DHF B;  3ML4 A;  1TJ6 A;  2ADZ A;  2VRW B;  5DI9 B;  4CHM A;  2D2Q A;  3MDB C;  1NI2 A;  4L6E A;  4IAP A;  1MAI A;  5L81 A;  1I7A A;  4HDQ A;  2G35 A;  4HAT B;  3WA0 A;  3U7D A;  4KVG B;  1Y5O A;  3SUZ A;  1EAZ A;  5GOW B;  1AQC A;  2YS5 A;  1V61 A;  4A6K A;  3DXE A;  1X11 A;  4K17 A;  1BTK A;  5DHA B;  3KRW A;  2P8V A;  3M1I B;  2K2J A;  3KRX A;  4HDO A;  3FEH A;  1K5G B;  1XKE A;  2NZ8 B;  2J0K A;  3TCA A;  4CHJ A;  5DH9 B;  1RJ2 A;  2MKR A;  3DXD A;  2P0D A;  2YS3 A;  1ZC4 B;  2DYQ A;  3AU5 A;  2KCJ A;  2YT0 A;  2RLO A;  1XX0 A;  2D9Z A;  4YL8 A;  2XQN M;  1Z87 A;  4EKU A;  2D9W A;  1DDM A;  3LJU X;  2GCL A;  2UZR A;  3ULC A;  3KSY A;  3V5W A;  3D8F A;  1UEF A;  2ELB A;  2OTX A;  4A6H A;  1J19 A;  1KI1 B;  3TO1 A;  4EJN A;  1GC6 A;  5D27 A;  2K00 A;  1H4R A;  1LW3 A;  1QQG A;  1PLS A;  2DHI A;  2HTH B;  1XD4 A;  2M38 A;  2M14 A;  3SO6 A;  4TYZ A;  3G9W A;  3SNH A;  4CYE A;  2MDX A;  2N23 A;  2DYN A;  3PSC A;  2H7D A;  1TQZ A;  1M7R A;  4NY0 A;  5JHG A;  2RVB B;  1UNQ A;  2CRF A;  1FB8 A;  2CY5 A;  2QKL A;  1V5M A;  1WJ1 A;  4NSW A;  5D3W A;  1FGZ A;  1DYN A;  2Y8G A;  2YVC A;  1I2H A;  4WJ7 A;  2EJ8 A;  5EFX A;  4D0N B;  1MKE A;  2VSZ A;  2DA0 A;  3PG7 A;  5KQ4 A;  1FOE A;  1WJM A;  3VOQ A;  2DHJ A;  3ODX A;  1DDV A;  1ZM0 A;  2L2I A;  5D3V A;  2MWN B;  3BJI A;  2PZ1 A;  4WVF B;  5HE3 A;  4F7G A;  4HAY B;  2LG1 A;  4F7U P;  2L1C A;  2RUK B;  3U8Z A;  2COD A;  2LOZ A;  4IFS A;  1LB1 A;  5C79 A;  1AWE A;  1MIZ B;  3O96 A;  1NU2 A;  3PP2 A;  1XOD A;  5CLL B;  4MY6 A;  4IOY X;  4BBK A;  2R0D A;  2Q13 A;  3CIK A;  1E5W A;  1WVH A;  1FHX A;  2Z0Q A;  2VKI A;  3VIA A;  4K81 A;  1GC7 A;  2CAY A;  1P6S A;  2W2W A;  4DX8 A;  5FI1 A;  1SHC A;  3P6A A;  2CY4 A;  1EF1 A;  4GZU A;  1IRS A;  3PVL A;  2UZS A;  2W2X C;  4KHO A;  4P7I A;  3A8P A;  2Y7B A;  4HB3 B;  3DXC A;  1GG3 A;  1K5D B;  1FAO A;  5KQ1 A;  2BCJ A;  3PVW A;  1PFJ A;  3KZ1 A;  2D4Q A;  2YRY A;  2DKQ A;  2COC A;  1MK9 B;  2DHK A;  4K2P A;  1N3H A;  2LKO A;  3HK0 A;  4HAZ B;  5J3Q A;  5CLQ B;  2DN6 A;  4F7H A;  2FJL A;  3TVV A;  4ZRJ A;  5J3T A;  4KAX B;  2KUP A;  1P3R A;  3F0W A;  5D3X A;  2I5C A;  3A8Q A;  1J0W A;  3TW1 A;  3RCP A;  1W1G A;  2Z0P A;  2LYD A;  5LOP B;  4HAX B;  3HQC A;  2EC1 A;  3NSU A;  2EMT A;  1MIX A;  3ULB A;  3D8E A;  2COF A;  4HB0 B;  1FGY A;  1V89 A;  1WI1 A;  4WSF A;  3GYO A;  2RNR B;  2DFK A;  3AU4 A;  1DDW A;  3BIN A;  2H7E A;  5JP4 A;  1NTV A;  3CXB B;  4ZRK A;  2GJY A;  3PEG A;  3SV1 A;  2LOX A;  3X23 A;  3PZD A;  1FHW A;  2I5F A;  4GPT B;  1DRO A;  2D11 A;  3ODW A;  3WYF B;  5JLJ B;  5KCV A;  1ZC3 B;  2J59 M;  4XWX A;  5DIF B;  2AEH A;  1OY2 A;  1Q67 A;  4KHA A;  2RGN B;  2D10 A;  3T06 A;  3HW2 B;  2EMS A;  1X1G A;  4TKN A;  4HB4 B;  3F5R A;  4C0A A;  4A5K A;  4PQ0 A;  2E2X A;  2D9Y A;  4DXA B;  3ZDT A;  1MPH A;  1XR0 B;  1UPQ A;  2NMB A;  4K2O A;  4GMX B;  1FHO A;  1PMS A;  2MFQ A;  3D8D A;  2I1K A;  5HE0 A;  4H8S A;  2DKP A;  4Z2N A;  2Y8F A;  4A6F A;  1NTY A;  1KZG A;  4GN1 A;  4B6H A;  3IVF A;  2R09 A;  1BTN A;  3KY9 A;  3N7C A;  2COA A;  2JP2 A;  3SYX A;  3ZVR A;  3FM8 C;  4PNK A;  1U27 A;  2V76 A;  1WGQ A;  1EVH A;  4HB2 B;  2ROZ B;  3P7Z A;  2YS1 A;  3PVU A;  2RSG A;  4DX9 0;  5C5B A;  2IYB A;  1W1H A;  3QBV B;  1SGH A;  4Z2M B;  2D9X A;  1U5E A;  2P0H A;  4GXB A;  2YT1 A;  2K2U A;  3FSS A;  2AL6 A;  2GS0 A;  1DBH A;  2YF0 A;  5C16 A;  4MT7 A;  4A6F B;  1EGX A;  1X86 A;  1H10 A;  1U29 A;  4MK0 A;  2N0Y A;  2LUL A;  1U5D A;  1B55 A;  2ZPY A;  1TXD A;  3AJ4 A;  1WG7 A;  2DX5 A;  1BWN A;  3GYP A;  1XCG A;  5C5B B;  1X05 A;  2DX1 A;  1M7E A;  2Z0O A;  1U2B A;  2ROV A;  1ZVR A;  5C6R A;  3OAN A;  4HAU B;  2YSZ A;  2D9V A;  5JHH A;  5HE2 A;  4HAV B;  1ZSQ A;  3MPX A;  1UNR A;  1UNP A;  1V5P A;  2UVM A;  2QKM A;  2IFS A;  4YON A;  4HHV A;  4ZRI A;  1V88 A;  1Y19 B;  4DBB A;  1U5G A;  5D3Y A;  2P0F A;  1ISN A;  1RRP B;  4EMO A;  4HAW B;  2KGX B;  2ELA A;  1UPR A;  3QIJ A;  2OQB A;  2DTC A;  3QWM A;  5J3Y A;  4KHB B;  2I1J A;  2J0M A;  1P5T A;  1V5U A;  3A98 B;  2X18 A;  1QC6 A;  2HE7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...