1SHCA

Shc ptb domain complexed with a trka receptor phosphopeptide, nmr, minimized average structure
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
195
structure length
195
Chain Sequence
GSHMGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALDFNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSSLNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDVISTIGQAFELRFKQYLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SHC
publication title Structure and ligand recognition of the phosphotyrosine binding domain of Shc.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (signal transduction/peptide)
total genus 24
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 1996-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1shcA00
1OMWA 1U2BA 3UZTA 1E5WA 1FB8A 1RRPB 2X18A 3QBVB 2W2WA 3TW1A 3A8PA 1RJ2A 2W2XD 3D8DA 5HE0A 2Y8GA 1FHWA 4DXAB 1H4RA 1QC6A 3VIAA 5C5BB 2DTCA 1PMSA 2MKRA 3KRWA 4HAZB 1V88A 3D8EA 3PVWA 2GS0A 1PFJA 1GC6A 4TKNA 3ODWA 2I5CA 1XCGA 4YL8A 4HHVA 1UEFA 4WJ7A 2ADZA 4A5KA 1FGYA 3KY9A 2RSGA 1EVHA 1FAOA 2UVMA 2JP2A 3G9WA 1UNPA 3IVFA 1FHXA 1V5UA 2DHKA 1TXDA 2CY5A 3P7ZA 3VOQA 2D9ZA 1WJ1A 4WVFB 2EC1A 3KZ1A 2H7DA 1U29A 1U5DA 4KHOA 5C16A 1ZSQA 5C79A 4F7UP 3U7DA 1LW3A 1B55A 2HE7A 2YS5A 2Y8FA 3A8QA 4IOYX 2EMSA 2YRYA 1KZGA 2ROZB 4HAYB 4K2OA 1MPHA 3ULBA 1U27A 2K2UA 1OQNA 2M14A 4MT7A 1XX0A 2I1KA 2ROVA 3CIKA 3ZDTA 3SO6A 3TFMA 3KRXA 3LJUX 1W1HA 3KSYA 4BBKA 2D9WA 2KUPA 3T06A 1ZVRA 1SGHA 1X86A 2L1CA 2HTHB 3P6AA 3X23A 2DHIA 4GXBA 2RGNB 2Z0PA 1Z87A 5HE2A 1X1FA 5L81A 1GG3A 2W2XC 1DROA 3QWMA 2DKPA 4XWXA 3WA0A 1TQZA 2RUKB 1J0WA 3NSUA 2V76A 1EAZA 5JP4A 2Z0OA 1KI1B 2NMBA 2UZRA 1U5GA 4HAUB 2IYBA 1UPQA 2QKLA 5LOPB 1P6SA 3DXDA 1XODA 3PZDA 2VKIA 5KQ1A 1DYNA 5DIFB 1QQGA 4L6EA 2PZ1A 3QIJA 2J0KA 4TYZA 2MDXA 2LOXA 4HAXB 4F7HA 4NSWA 4KVGB 3TCAA 3O96A 1W1GA 1P3RA 1V5PA 3FSSA 2YT1A 1AWEA 2K00A 3AJ4A 2R09A 5LONB 1V89A 4CHMA 2AL6A 3MPXA 2CY4A 2Q13A 2QKMA 3GYPA 3AU5A 1M7RA 2RLOA 2OTXA 2LYDA 4MK0A 3DXEA 4EKUA 4D0NB 3F5RA 2YVCA 2I1JA 1IRSA 2DA0A 1J19A 3GYOA 2LG1A 1X05A 2LKOA 5D27A 2MWNB 2KGXB 2DKQA 5FI1A 2YS1A 4ZRIA 3PVLA 4DX90 5C5BA 1U5FA 1NTVA 2DYQA 5DHFB 4CHJA 2J0MA 1PLSA 5D3WA 4P7IA 3A98B 3DXCA 4GN1A 1MAIA 2M38A 1I7AA 4A6HA 2EJ8A 3SYXA 4A6FB 3SUZA 3ODXA 3PEGA 2P0HA 4GZUA 1FOEA 1BTKA 3HW2B 1FGZA 1WJMA 4CYEA 1ISNA 5GOWB 1DBHA 4GPTB 2P8VA 5D3YA 2D9VA 3SNHA 2J0JA 4K2PA 2D11A 1P5TA 2CAYA 2FJLA 3BINA 5KCVA 2DHJA 1UNRA 1ZC3B 5EFXA 2K2JA 1K5GB 4HDQA 2ELBA 3MDBC 3V5WA 1Q67A 1DDMA 1WVHA 4GMVA 2YSZA 2LOZA 4HB4B 2RVBB 4IFSA 2GCJA 3ULCA 2DYNA 2VRWB 1BAKA 2D9XA 1M7EA 4H8SA 2YF0A 1UNQA 1EF1A 2DX1A 2KCJA 1V61A 2Y7BA 4A6KA 5KQ4A 4HB0B 1ZM0A 4ZRKA 4HDOA 2BCJA 4C0AA 1MIXA 2R0DA 2G35A 1V5MA 1X1GA 1MIZB 2XQNM 2J59M 2DLWA 2I5FA 1K5DB 2Z0QA 1KZ7A 1OY2A 1XKEA 1WI1A 5HE3A 4K17A 1WG7A 1NTYA 3HQCA 2EMTA 4HATB 5JHHA 1W1DA 4KHAA 5CLLB 4DX8A 2RNRB 1DDVA 2COAA 1XD4A 4NY0A 3RCPA 1Y5OA 4PNKA 2CODA 1U5EA 1LB1A 4EMOA 1MKEA 1TJ6A 5D3VA 3M1IB 3ODOA 1X11A 1MK7B 3N7CA 3TO1A 3PG7A 5D3XA 3U8ZA 4Y94A 2YT0A 5FI0A 2VSZA 3ML4A 2DN6A 1NI2A 4B6HA 1NU2A 2LULA 2CRFA 4HB2B 3OANA 4K81A 5DHAB 1WGUA 2N23A 2H7EA 2L2IA 2GJYA 5C6RA 5CLQB 5DH9B 3TVVA 4HAWB 3FM8C 1DDWA 2DFKA 1ZC4B 2D2QA 5JLJB 3WYFB 4WSFA 4PQ0A 2OQBA 2DX5A 3SV1A 2N0YA 2MFQA 4KAXB 2YS3A 1MK9B 5JHGA 2D4QA 3PVUA 3ZVRA 3BJIA 5J3TA 4HAVB 2ELAA 4HB3B 5HE1A 1WGQA 3PP2A 4F7GA 4DBBA 1I2HA 5J3QA 2P0DA 2D10A 5J3YA 1Y19B 2NZ8B 1BWNA 3D8FA 4ZRJA 1BTNA 1XR0B 1EGXA 1SHCA 3F0WA 3PSCA 4A6FA 3FEHA 2IFSA 5DI9B 2COCA 2P0FA 2D9YA 4EJNA 4MY6A 3AU4A 4KHBB 2COFA 1GC7A 4Z2MB 4Z2NA 1AQCA 3CXBB 2GCLA 4IAPA 2E2XA 4YONA 2ZPYA 1N3HA 1FHOA 2AEHA 2UZSA 3HK0A 1UPRA 4GMXB 1H10A
chains in the Genus database with same CATH superfamily
1OMWA 1U2BA 3UZTA 1E5WA 1FB8A 1RRPB 2X18A 3QBVB 2W2WA 3TW1A 3A8PA 1RJ2A 2W2XD 3D8DA 5HE0A 2RRFA 3NWDA 4HSIA 2Y8GA 1FHWA 3FVCA 4DXAB 1H4RA 1QC6A 3VIAA 5C5BB 2DTCA 1PMSA 2MKRA 3KRWA 5I2MA 4HAZB 1V88A 3D8EA 3PVWA 2GS0A 1PFJA 1GC6A 4TKNA 3ODWA 2I5CA 5I2SA 1XCGA 4YL8A 4HHVA 1UEFA 4WJ7A 2ADZA 4A5KA 1FGYA 3KY9A 2RSGA 1EVHA 1FAOA 2UVMA 2JP2A 3A58A 3G9WA 1UNPA 3IVFA 1FHXA 1V5UA 2DHKA 1TXDA 2CY5A 3P7ZA 3VOQA 2D9ZA 1WJ1A 4WVFB 2Z4DA 2EC1A 3KZ1A 2H7DA 1U29A 1U5DA 4KHOA 5C16A 1ZSQA 5C79A 4F7UP 3U7DA 1LW3A 1B55A 2HE7A 2YS5A 2Y8FA 3A8QA 4IOYX 2EMSA 2YRYA 1KZGA 2ROZB 4HAYB 4K2OA 1MPHA 3ULBA 1U27A 2K2UA 1MI1A 1OQNA 2M14A 4MT7A 1XX0A 2I1KA 2ROVA 2Z13A 2Z59A 3CIKA 3ZDTA 3SO6A 3TFMA 4DIXA 3KRXA 3LJUX 1W1HA 3KSYA 4BBKA 2D9WA 2KUPA 3T06A 1ZVRA 1SGHA 1X86A 3NW8A 2L1CA 2HTHB 3P6AA 3X23A 2DHIA 4OSNA 4GXBA 2RGNB 2Z0PA 1Z87A 5HE2A 1X1FA 5L81A 1GG3A 2W2XC 1DROA 3QWMA 2DKPA 4XWXA 3WA0A 1TQZA 2RUKB 1J0WA 3NSUA 2V76A 1EAZA 4L1RA 5JP4A 2Z0OA 1KI1B 2NMBA 2UZRA 1U5GA 4HAUB 2IYBA 1UPQA 2QKLA 5LOPB 1P6SA 3DXDA 1XODA 3PZDA 2VKIA 2Z14A 5KQ1A 1DYNA 5DIFB 1QQGA 4L6EA 2PZ1A 3QIJA 2J0KA 4TYZA 2MDXA 5IRSA 2LOXA 2K49A 4HAXB 4F7HA 4NSWA 4KVGB 3TCAA 3O96A 4KHBA 1W1GA 1P3RA 3NWAA 1V5PA 3FSSA 2YT1A 1AWEA 2K00A 3AJ4A 2NBVA 2R09A 5LONB 1V89A 4CHMA 2AL6A 3MPXA 2CY4A 2Q13A 2QKMA 3GYPA 2K8EA 3AU5A 1M7RA 2RLOA 2OTXA 2LYDA 4MK0A 3DXEA 4EKUA 4D0NB 3F5RA 2YVCA 2I1JA 1IRSA 2DA0A 1J19A 3GYOA 2LG1A 1X05A 2LKOA 5D27A 2MWNB 2KGXB 2DKQA 5FI1A 2YS1A 4ZRIA 3PVLA 4DX90 5C5BA 1U5FA 1NTVA 2DYQA 5DHFB 4CHJA 2J0MA 1PLSA 5D3WA 4P7IA 3A98B 3DXCA 4GN1A 1MAIA 2M38A 1I7AA 4A6HA 2EJ8A 2ZKMX 3SYXA 4A6FB 3SUZA 3ODXA 3PEGA 2P0HA 4GZUA 1FOEA 1BTKA 3HW2B 1FGZA 2FJUB 1WJMA 4CYEA 1ISNA 5GOWB 1DBHA 4GPTB 2P8VA 5M4YB 5D3YA 2D9VA 3SNHA 2J0JA 4K2PA 2D11A 2R2YA 3HIEA 1P5TA 2CAYA 4GOUA 2FJLA 3BINA 5KCVA 3DCXA 2DHJA 1UNRA 1ZC3B 5EFXA 2K2JA 2GUMA 1K5GB 4HDQA 2ELBA 3MDBC 3V5WA 1Q67A 1DDMA 3OHMB 1WVHA 4GMVA 2YSZA 2LOZA 4HB4B 2RVBB 4IFSA 2GCJA 4QJ4B 3ULCA 2DYNA 2VRWB 1BAKA 2D9XA 1M7EA 4H8SA 2YF0A 1UNQA 1EF1A 2DX1A 2KUQA 2KCJA 1V61A 2Y7BA 4A6KA 5KQ4A 4HB0B 1ZM0A 4ZRKA 4HDOA 2BCJA 4C0AA 1MIXA 2R0DA 2G35A 1V5MA 1X1GA 2KIGA 1MIZB 2XQNM 2J59M 2DLWA 2I5FA 1K5DB 2Z0QA 1KZ7A 1OY2A 1XKEA 1WI1A 5HE3A 4OT1A 4K17A 1WG7A 1NTYA 3HQCA 3U12A 2EMTA 4HATB 5JHHA 3HSAA 1W1DA 4KHAA 5CLLB 4DX8A 2RNRB 1DDVA 2COAA 1XD4A 4NY0A 3RCPA 1Y5OA 4PNKA 2CODA 1U5EA 1LB1A 4EMOA 4D6WA 1MKEA 1TJ6A 5D3VA 3M1IB 3ODOA 1X11A 1MK7B 3N7CA 3TO1A 3PG7A 5D3XA 3U8ZA 4Y94A 2YT0A 5FI0A 2VSZA 3ML4A 2DN6A 1NI2A 4QXAB 4B6HA 1NU2A 2LULA 2CRFA 4HB2B 3OANA 2KIEA 4K81A 5DHAB 1WGUA 2N23A 2H7EA 2L2IA 2GJYA 5C6RA 5CLQB 5DH9B 3TVVA 4HAWB 3FM8C 1DDWA 2DFKA 1ZC4B 2D2QA 5JLJB 3WYFB 4WSFA 4PQ0A 4GNKB 2OQBA 5LG4B 4CSQA 2DX5A 3SV1A 2N0YA 2MFQA 4KAXB 2KR0A 2YS3A 1MK9B 1ZYIA 3NWFA 5JHGA 2D4QA 3PVUA 3ZVRA 3BJIA 5J3TA 4HAVB 2ELAA 4HB3B 5HE1A 1WGQA 3PP2A 4F7GA 4DBBA 1I2HA 5J3QA 2P0DA 2D10A 5J3YA 1Y19B 2NZ8B 1BWNA 3D8FA 4ZRJA 4QJ5B 1BTNA 1XR0B 1EGXA 1SHCA 3F0WA 3B77A 3PSCA 4A6FA 2YT2A 3FEHA 2IFSA 5DI9B 2COCA 2P0FA 2D9YA 4EJNA 4MY6A 3AU4A 4KHBB 2COFA 1GC7A 1T77A 4Z2MB 4Z2NA 1AQCA 3CXBB 2GCLA 4IAPA 2E2XA 4YONA 4QJ3B 2ZPYA 1N3HA 1FHOA 2AEHA 2UZSA 3HK0A 1UPRA 4GMXB 1H10A
chains in the Genus database with same CATH topology
1OMWA 1U2BA 3UZTA 1E5WA 1FB8A 1RRPB 2X18A 3QBVB 2W2WA 3TW1A 3A8PA 1RJ2A 2W2XD 3D8DA 5HE0A 2Y8GA 1FHWA 4DXAB 1H4RA 1QC6A 3VIAA 5C5BB 2DTCA 1PMSA 2MKRA 3KRWA 4HAZB 1V88A 3D8EA 3PVWA 2GS0A 1PFJA 1GC6A 4TKNA 3ODWA 2I5CA 1XCGA 4YL8A 4HHVA 1UEFA 4WJ7A 2ADZA 4A5KA 1FGYA 3KY9A 2RSGA 1EVHA 1FAOA 2UVMA 2JP2A 3G9WA 1UNPA 3IVFA 1FHXA 1V5UA 2DHKA 1TXDA 2CY5A 3P7ZA 3VOQA 2D9ZA 1WJ1A 4WVFB 2EC1A 3KZ1A 2H7DA 1U29A 1U5DA 4KHOA 5C16A 1ZSQA 5C79A 4F7UP 3U7DA 1LW3A 1B55A 2HE7A 2YS5A 2Y8FA 3A8QA 4IOYX 2EMSA 2YRYA 1KZGA 2ROZB 4HAYB 4K2OA 1MPHA 3ULBA 1U27A 2K2UA 1OQNA 2M14A 4MT7A 1XX0A 2I1KA 2ROVA 3CIKA 3ZDTA 3SO6A 3TFMA 3KRXA 3LJUX 1W1HA 3KSYA 4BBKA 2D9WA 2KUPA 3T06A 1ZVRA 1SGHA 1X86A 2L1CA 2HTHB 3P6AA 3X23A 2DHIA 4GXBA 2RGNB 2Z0PA 1Z87A 5HE2A 1X1FA 5L81A 1GG3A 2W2XC 1DROA 3QWMA 2DKPA 4XWXA 3WA0A 1TQZA 2RUKB 1J0WA 3NSUA 2V76A 1EAZA 5JP4A 2Z0OA 1KI1B 2NMBA 2UZRA 1U5GA 4HAUB 2IYBA 1UPQA 2QKLA 5LOPB 1P6SA 3DXDA 1XODA 3PZDA 2VKIA 5KQ1A 1DYNA 5DIFB 1QQGA 4L6EA 2PZ1A 3QIJA 2J0KA 4TYZA 2MDXA 2LOXA 4HAXB 4F7HA 4NSWA 4KVGB 3TCAA 3O96A 1W1GA 1P3RA 1V5PA 3FSSA 2YT1A 1AWEA 2K00A 3AJ4A 2R09A 5LONB 1V89A 4CHMA 2AL6A 3MPXA 2CY4A 2Q13A 2QKMA 3GYPA 3AU5A 1M7RA 2RLOA 2OTXA 2LYDA 4MK0A 3DXEA 4EKUA 4D0NB 3F5RA 2YVCA 2I1JA 1IRSA 2DA0A 1J19A 3GYOA 2LG1A 1X05A 2LKOA 5D27A 2MWNB 2KGXB 2DKQA 5FI1A 2YS1A 4ZRIA 3PVLA 4DX90 5C5BA 1U5FA 1NTVA 2DYQA 5DHFB 4CHJA 2J0MA 1PLSA 5D3WA 4P7IA 3A98B 3DXCA 4GN1A 1MAIA 2M38A 1I7AA 4A6HA 2EJ8A 3SYXA 4A6FB 3SUZA 3ODXA 3PEGA 2P0HA 4GZUA 1FOEA 1BTKA 3HW2B 1FGZA 1WJMA 4CYEA 1ISNA 5GOWB 1DBHA 4GPTB 2P8VA 5D3YA 2D9VA 3SNHA 2J0JA 4K2PA 2D11A 1P5TA 2CAYA 2FJLA 3BINA 5KCVA 2DHJA 1UNRA 1ZC3B 5EFXA 2K2JA 1K5GB 4HDQA 2ELBA 3MDBC 3V5WA 1Q67A 1DDMA 1WVHA 4GMVA 2YSZA 2LOZA 4HB4B 2RVBB 4IFSA 2GCJA 3ULCA 2DYNA 2VRWB 1BAKA 2D9XA 1M7EA 4H8SA 2YF0A 1UNQA 1EF1A 2DX1A 2KCJA 1V61A 2Y7BA 4A6KA 5KQ4A 4HB0B 1ZM0A 4ZRKA 4HDOA 2BCJA 4C0AA 1MIXA 2R0DA 2G35A 1V5MA 1X1GA 1MIZB 2XQNM 2J59M 2DLWA 2I5FA 1K5DB 2Z0QA 1KZ7A 1OY2A 1XKEA 1WI1A 5HE3A 4K17A 1WG7A 1NTYA 3HQCA 2EMTA 4HATB 5JHHA 1W1DA 4KHAA 5CLLB 4DX8A 2RNRB 1DDVA 2COAA 1XD4A 4NY0A 3RCPA 1Y5OA 4PNKA 2CODA 1U5EA 1LB1A 4EMOA 1MKEA 1TJ6A 5D3VA 3M1IB 3ODOA 1X11A 1MK7B 3N7CA 3TO1A 3PG7A 5D3XA 3U8ZA 4Y94A 2YT0A 5FI0A 2VSZA 3ML4A 2DN6A 1NI2A 4B6HA 1NU2A 2LULA 2CRFA 4HB2B 3OANA 4K81A 5DHAB 1WGUA 2N23A 2H7EA 2L2IA 2GJYA 5C6RA 5CLQB 5DH9B 3TVVA 4HAWB 3FM8C 1DDWA 2DFKA 1ZC4B 2D2QA 5JLJB 3WYFB 4WSFA 4PQ0A 2OQBA 2DX5A 3SV1A 2N0YA 2MFQA 4KAXB 2YS3A 1MK9B 5JHGA 2D4QA 3PVUA 3ZVRA 3BJIA 5J3TA 4HAVB 2ELAA 4HB3B 5HE1A 1WGQA 3PP2A 4F7GA 4DBBA 1I2HA 5J3QA 2P0DA 2D10A 5J3YA 1Y19B 2NZ8B 1BWNA 3D8FA 4ZRJA 1BTNA 1XR0B 1EGXA 1SHCA 3F0WA 3PSCA 4A6FA 3FEHA 2IFSA 5DI9B 2COCA 2P0FA 2D9YA 4EJNA 4MY6A 3AU4A 4KHBB 2COFA 1GC7A 4Z2MB 4Z2NA 1AQCA 3CXBB 2GCLA 4IAPA 2E2XA 4YONA 2ZPYA 1N3HA 1FHOA 2AEHA 2UZSA 3HK0A 1UPRA 4GMXB 1H10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OMW A;  1U2B A;  3UZT A;  1E5W A;  1FB8 A;  1RRP B;  2X18 A;  3QBV B;  2W2W A;  3TW1 A;  3A8P A;  1RJ2 A;  2W2X D;  3D8D A;  5HE0 A;  2Y8G A;  1FHW A;  4DXA B;  1H4R A;  1QC6 A;  3VIA A;  5C5B B;  2DTC A;  1PMS A;  2MKR A;  3KRW A;  4HAZ B;  1V88 A;  3D8E A;  3PVW A;  2GS0 A;  1PFJ A;  1GC6 A;  4TKN A;  3ODW A;  2I5C A;  1XCG A;  4YL8 A;  4HHV A;  1UEF A;  4WJ7 A;  2ADZ A;  4A5K A;  1FGY A;  3KY9 A;  2RSG A;  1EVH A;  1FAO A;  2UVM A;  2JP2 A;  3G9W A;  1UNP A;  3IVF A;  1FHX A;  1V5U A;  2DHK A;  1TXD A;  2CY5 A;  3P7Z A;  3VOQ A;  2D9Z A;  1WJ1 A;  4WVF B;  2EC1 A;  3KZ1 A;  2H7D A;  1U29 A;  1U5D A;  4KHO A;  5C16 A;  1ZSQ A;  5C79 A;  4F7U P;  3U7D A;  1LW3 A;  1B55 A;  2HE7 A;  2YS5 A;  2Y8F A;  3A8Q A;  4IOY X;  2EMS A;  2YRY A;  1KZG A;  2ROZ B;  4HAY B;  4K2O A;  1MPH A;  3ULB A;  1U27 A;  2K2U A;  1OQN A;  2M14 A;  4MT7 A;  1XX0 A;  2I1K A;  2ROV A;  3CIK A;  3ZDT A;  3SO6 A;  3TFM A;  3KRX A;  3LJU X;  1W1H A;  3KSY A;  4BBK A;  2D9W A;  2KUP A;  3T06 A;  1ZVR A;  1SGH A;  1X86 A;  2L1C A;  2HTH B;  3P6A A;  3X23 A;  2DHI A;  4GXB A;  2RGN B;  2Z0P A;  1Z87 A;  5HE2 A;  1X1F A;  5L81 A;  1GG3 A;  2W2X C;  1DRO A;  3QWM A;  2DKP A;  4XWX A;  3WA0 A;  1TQZ A;  2RUK B;  1J0W A;  3NSU A;  2V76 A;  1EAZ A;  5JP4 A;  2Z0O A;  1KI1 B;  2NMB A;  2UZR A;  1U5G A;  4HAU B;  2IYB A;  1UPQ A;  2QKL A;  5LOP B;  1P6S A;  3DXD A;  1XOD A;  3PZD A;  2VKI A;  5KQ1 A;  1DYN A;  5DIF B;  1QQG A;  4L6E A;  2PZ1 A;  3QIJ A;  2J0K A;  4TYZ A;  2MDX A;  2LOX A;  4HAX B;  4F7H A;  4NSW A;  4KVG B;  3TCA A;  3O96 A;  1W1G A;  1P3R A;  1V5P A;  3FSS A;  2YT1 A;  1AWE A;  2K00 A;  3AJ4 A;  2R09 A;  5LON B;  1V89 A;  4CHM A;  2AL6 A;  3MPX A;  2CY4 A;  2Q13 A;  2QKM A;  3GYP A;  3AU5 A;  1M7R A;  2RLO A;  2OTX A;  2LYD A;  4MK0 A;  3DXE A;  4EKU A;  4D0N B;  3F5R A;  2YVC A;  2I1J A;  1IRS A;  2DA0 A;  1J19 A;  3GYO A;  2LG1 A;  1X05 A;  2LKO A;  5D27 A;  2MWN B;  2KGX B;  2DKQ A;  5FI1 A;  2YS1 A;  4ZRI A;  3PVL A;  4DX9 0;  5C5B A;  1U5F A;  1NTV A;  2DYQ A;  5DHF B;  4CHJ A;  2J0M A;  1PLS A;  5D3W A;  4P7I A;  3A98 B;  3DXC A;  4GN1 A;  1MAI A;  2M38 A;  1I7A A;  4A6H A;  2EJ8 A;  3SYX A;  4A6F B;  3SUZ A;  3ODX A;  3PEG A;  2P0H A;  4GZU A;  1FOE A;  1BTK A;  3HW2 B;  1FGZ A;  1WJM A;  4CYE A;  1ISN A;  5GOW B;  1DBH A;  4GPT B;  2P8V A;  5D3Y A;  2D9V A;  3SNH A;  2J0J A;  4K2P A;  2D11 A;  1P5T A;  2CAY A;  2FJL A;  3BIN A;  5KCV A;  2DHJ A;  1UNR A;  1ZC3 B;  5EFX A;  2K2J A;  1K5G B;  4HDQ A;  2ELB A;  3MDB C;  3V5W A;  1Q67 A;  1DDM A;  1WVH A;  4GMV A;  2YSZ A;  2LOZ A;  4HB4 B;  2RVB B;  4IFS A;  2GCJ A;  3ULC A;  2DYN A;  2VRW B;  1BAK A;  2D9X A;  1M7E A;  4H8S A;  2YF0 A;  1UNQ A;  1EF1 A;  2DX1 A;  2KCJ A;  1V61 A;  2Y7B A;  4A6K A;  5KQ4 A;  4HB0 B;  1ZM0 A;  4ZRK A;  4HDO A;  2BCJ A;  4C0A A;  1MIX A;  2R0D A;  2G35 A;  1V5M A;  1X1G A;  1MIZ B;  2XQN M;  2J59 M;  2DLW A;  2I5F A;  1K5D B;  2Z0Q A;  1KZ7 A;  1OY2 A;  1XKE A;  1WI1 A;  5HE3 A;  4K17 A;  1WG7 A;  1NTY A;  3HQC A;  2EMT A;  4HAT B;  5JHH A;  1W1D A;  4KHA A;  5CLL B;  4DX8 A;  2RNR B;  1DDV A;  2COA A;  1XD4 A;  4NY0 A;  3RCP A;  1Y5O A;  4PNK A;  2COD A;  1U5E A;  1LB1 A;  4EMO A;  1MKE A;  1TJ6 A;  5D3V A;  3M1I B;  3ODO A;  1X11 A;  1MK7 B;  3N7C A;  3TO1 A;  3PG7 A;  5D3X A;  3U8Z A;  4Y94 A;  2YT0 A;  5FI0 A;  2VSZ A;  3ML4 A;  2DN6 A;  1NI2 A;  4B6H A;  1NU2 A;  2LUL A;  2CRF A;  4HB2 B;  3OAN A;  4K81 A;  5DHA B;  1WGU A;  2N23 A;  2H7E A;  2L2I A;  2GJY A;  5C6R A;  5CLQ B;  5DH9 B;  3TVV A;  4HAW B;  3FM8 C;  1DDW A;  2DFK A;  1ZC4 B;  2D2Q A;  5JLJ B;  3WYF B;  4WSF A;  4PQ0 A;  2OQB A;  2DX5 A;  3SV1 A;  2N0Y A;  2MFQ A;  4KAX B;  2YS3 A;  1MK9 B;  5JHG A;  2D4Q A;  3PVU A;  3ZVR A;  3BJI A;  5J3T A;  4HAV B;  2ELA A;  4HB3 B;  5HE1 A;  1WGQ A;  3PP2 A;  4F7G A;  4DBB A;  1I2H A;  5J3Q A;  2P0D A;  2D10 A;  5J3Y A;  1Y19 B;  2NZ8 B;  1BWN A;  3D8F A;  4ZRJ A;  1BTN A;  1XR0 B;  1EGX A;  1SHC A;  3F0W A;  3PSC A;  4A6F A;  3FEH A;  2IFS A;  5DI9 B;  2COC A;  2P0F A;  2D9Y A;  4EJN A;  4MY6 A;  3AU4 A;  4KHB B;  2COF A;  1GC7 A;  4Z2M B;  4Z2N A;  1AQC A;  3CXB B;  2GCL A;  4IAP A;  2E2X A;  4YON A;  2ZPY A;  1N3H A;  1FHO A;  2AEH A;  2UZS A;  3HK0 A;  1UPR A;  4GMX B;  1H10 A; 
#chains in the Genus database with same CATH topology
 1OMW A;  1U2B A;  3UZT A;  1E5W A;  1FB8 A;  1RRP B;  2X18 A;  3QBV B;  2W2W A;  3TW1 A;  3A8P A;  1RJ2 A;  2W2X D;  3D8D A;  5HE0 A;  2RRF A;  3NWD A;  4HSI A;  2Y8G A;  1FHW A;  3FVC A;  4DXA B;  1H4R A;  1QC6 A;  3VIA A;  5C5B B;  2DTC A;  1PMS A;  2MKR A;  3KRW A;  5I2M A;  4HAZ B;  1V88 A;  3D8E A;  3PVW A;  2GS0 A;  1PFJ A;  1GC6 A;  4TKN A;  3ODW A;  2I5C A;  5I2S A;  1XCG A;  4YL8 A;  4HHV A;  1UEF A;  4WJ7 A;  2ADZ A;  4A5K A;  1FGY A;  3KY9 A;  2RSG A;  1EVH A;  1FAO A;  2UVM A;  2JP2 A;  3A58 A;  3G9W A;  1UNP A;  3IVF A;  1FHX A;  1V5U A;  2DHK A;  1TXD A;  2CY5 A;  3P7Z A;  3VOQ A;  2D9Z A;  1WJ1 A;  4WVF B;  2Z4D A;  2EC1 A;  3KZ1 A;  2H7D A;  1U29 A;  1U5D A;  4KHO A;  5C16 A;  1ZSQ A;  5C79 A;  4F7U P;  3U7D A;  1LW3 A;  1B55 A;  2HE7 A;  2YS5 A;  2Y8F A;  3A8Q A;  4IOY X;  2EMS A;  2YRY A;  1KZG A;  2ROZ B;  4HAY B;  4K2O A;  1MPH A;  3ULB A;  1U27 A;  2K2U A;  1MI1 A;  1OQN A;  2M14 A;  4MT7 A;  1XX0 A;  2I1K A;  2ROV A;  2Z13 A;  2Z59 A;  3CIK A;  3ZDT A;  3SO6 A;  3TFM A;  4DIX A;  3KRX A;  3LJU X;  1W1H A;  3KSY A;  4BBK A;  2D9W A;  2KUP A;  3T06 A;  1ZVR A;  1SGH A;  1X86 A;  3NW8 A;  2L1C A;  2HTH B;  3P6A A;  3X23 A;  2DHI A;  4OSN A;  4GXB A;  2RGN B;  2Z0P A;  1Z87 A;  5HE2 A;  1X1F A;  5L81 A;  1GG3 A;  2W2X C;  1DRO A;  3QWM A;  2DKP A;  4XWX A;  3WA0 A;  1TQZ A;  2RUK B;  1J0W A;  3NSU A;  2V76 A;  1EAZ A;  4L1R A;  5JP4 A;  2Z0O A;  1KI1 B;  2NMB A;  2UZR A;  1U5G A;  4HAU B;  2IYB A;  1UPQ A;  2QKL A;  5LOP B;  1P6S A;  3DXD A;  1XOD A;  3PZD A;  2VKI A;  2Z14 A;  5KQ1 A;  1DYN A;  5DIF B;  1QQG A;  4L6E A;  2PZ1 A;  3QIJ A;  2J0K A;  4TYZ A;  2MDX A;  5IRS A;  2LOX A;  2K49 A;  4HAX B;  4F7H A;  4NSW A;  4KVG B;  3TCA A;  3O96 A;  4KHB A;  1W1G A;  1P3R A;  3NWA A;  1V5P A;  3FSS A;  2YT1 A;  1AWE A;  2K00 A;  3AJ4 A;  2NBV A;  2R09 A;  5LON B;  1V89 A;  4CHM A;  2AL6 A;  3MPX A;  2CY4 A;  2Q13 A;  2QKM A;  3GYP A;  2K8E A;  3AU5 A;  1M7R A;  2RLO A;  2OTX A;  2LYD A;  4MK0 A;  3DXE A;  4EKU A;  4D0N B;  3F5R A;  2YVC A;  2I1J A;  1IRS A;  2DA0 A;  1J19 A;  3GYO A;  2LG1 A;  1X05 A;  2LKO A;  5D27 A;  2MWN B;  2KGX B;  2DKQ A;  5FI1 A;  2YS1 A;  4ZRI A;  3PVL A;  4DX9 0;  5C5B A;  1U5F A;  1NTV A;  2DYQ A;  5DHF B;  4CHJ A;  2J0M A;  1PLS A;  5D3W A;  4P7I A;  3A98 B;  3DXC A;  4GN1 A;  1MAI A;  2M38 A;  1I7A A;  4A6H A;  2EJ8 A;  2ZKM X;  3SYX A;  4A6F B;  3SUZ A;  3ODX A;  3PEG A;  2P0H A;  4GZU A;  1FOE A;  1BTK A;  3HW2 B;  1FGZ A;  2FJU B;  1WJM A;  4CYE A;  1ISN A;  5GOW B;  1DBH A;  4GPT B;  2P8V A;  5M4Y B;  5D3Y A;  2D9V A;  3SNH A;  2J0J A;  4K2P A;  2D11 A;  2R2Y A;  3HIE A;  1P5T A;  2CAY A;  4GOU A;  2FJL A;  3BIN A;  5KCV A;  3DCX A;  2DHJ A;  1UNR A;  1ZC3 B;  5EFX A;  2K2J A;  2GUM A;  1K5G B;  4HDQ A;  2ELB A;  3MDB C;  3V5W A;  1Q67 A;  1DDM A;  3OHM B;  1WVH A;  4GMV A;  2YSZ A;  2LOZ A;  4HB4 B;  2RVB B;  4IFS A;  2GCJ A;  4QJ4 B;  3ULC A;  2DYN A;  2VRW B;  1BAK A;  2D9X A;  1M7E A;  4H8S A;  2YF0 A;  1UNQ A;  1EF1 A;  2DX1 A;  2KUQ A;  2KCJ A;  1V61 A;  2Y7B A;  4A6K A;  5KQ4 A;  4HB0 B;  1ZM0 A;  4ZRK A;  4HDO A;  2BCJ A;  4C0A A;  1MIX A;  2R0D A;  2G35 A;  1V5M A;  1X1G A;  2KIG A;  1MIZ B;  2XQN M;  2J59 M;  2DLW A;  2I5F A;  1K5D B;  2Z0Q A;  1KZ7 A;  1OY2 A;  1XKE A;  1WI1 A;  5HE3 A;  4OT1 A;  4K17 A;  1WG7 A;  1NTY A;  3HQC A;  3U12 A;  2EMT A;  4HAT B;  5JHH A;  3HSA A;  1W1D A;  4KHA A;  5CLL B;  4DX8 A;  2RNR B;  1DDV A;  2COA A;  1XD4 A;  4NY0 A;  3RCP A;  1Y5O A;  4PNK A;  2COD A;  1U5E A;  1LB1 A;  4EMO A;  4D6W A;  1MKE A;  1TJ6 A;  5D3V A;  3M1I B;  3ODO A;  1X11 A;  1MK7 B;  3N7C A;  3TO1 A;  3PG7 A;  5D3X A;  3U8Z A;  4Y94 A;  2YT0 A;  5FI0 A;  2VSZ A;  3ML4 A;  2DN6 A;  1NI2 A;  4QXA B;  4B6H A;  1NU2 A;  2LUL A;  2CRF A;  4HB2 B;  3OAN A;  2KIE A;  4K81 A;  5DHA B;  1WGU A;  2N23 A;  2H7E A;  2L2I A;  2GJY A;  5C6R A;  5CLQ B;  5DH9 B;  3TVV A;  4HAW B;  3FM8 C;  1DDW A;  2DFK A;  1ZC4 B;  2D2Q A;  5JLJ B;  3WYF B;  4WSF A;  4PQ0 A;  4GNK B;  2OQB A;  5LG4 B;  4CSQ A;  2DX5 A;  3SV1 A;  2N0Y A;  2MFQ A;  4KAX B;  2KR0 A;  2YS3 A;  1MK9 B;  1ZYI A;  3NWF A;  5JHG A;  2D4Q A;  3PVU A;  3ZVR A;  3BJI A;  5J3T A;  4HAV B;  2ELA A;  4HB3 B;  5HE1 A;  1WGQ A;  3PP2 A;  4F7G A;  4DBB A;  1I2H A;  5J3Q A;  2P0D A;  2D10 A;  5J3Y A;  1Y19 B;  2NZ8 B;  1BWN A;  3D8F A;  4ZRJ A;  4QJ5 B;  1BTN A;  1XR0 B;  1EGX A;  1SHC A;  3F0W A;  3B77 A;  3PSC A;  4A6F A;  2YT2 A;  3FEH A;  2IFS A;  5DI9 B;  2COC A;  2P0F A;  2D9Y A;  4EJN A;  4MY6 A;  3AU4 A;  4KHB B;  2COF A;  1GC7 A;  1T77 A;  4Z2M B;  4Z2N A;  1AQC A;  3CXB B;  2GCL A;  4IAP A;  2E2X A;  4YON A;  4QJ3 B;  2ZPY A;  1N3H A;  1FHO A;  2AEH A;  2UZS A;  3HK0 A;  1UPR A;  4GMX B;  1H10 A; 
#chains in the Genus database with same CATH homology
 1OMW A;  1U2B A;  3UZT A;  1E5W A;  1FB8 A;  1RRP B;  2X18 A;  3QBV B;  2W2W A;  3TW1 A;  3A8P A;  1RJ2 A;  2W2X D;  3D8D A;  5HE0 A;  2Y8G A;  1FHW A;  4DXA B;  1H4R A;  1QC6 A;  3VIA A;  5C5B B;  2DTC A;  1PMS A;  2MKR A;  3KRW A;  4HAZ B;  1V88 A;  3D8E A;  3PVW A;  2GS0 A;  1PFJ A;  1GC6 A;  4TKN A;  3ODW A;  2I5C A;  1XCG A;  4YL8 A;  4HHV A;  1UEF A;  4WJ7 A;  2ADZ A;  4A5K A;  1FGY A;  3KY9 A;  2RSG A;  1EVH A;  1FAO A;  2UVM A;  2JP2 A;  3G9W A;  1UNP A;  3IVF A;  1FHX A;  1V5U A;  2DHK A;  1TXD A;  2CY5 A;  3P7Z A;  3VOQ A;  2D9Z A;  1WJ1 A;  4WVF B;  2EC1 A;  3KZ1 A;  2H7D A;  1U29 A;  1U5D A;  4KHO A;  5C16 A;  1ZSQ A;  5C79 A;  4F7U P;  3U7D A;  1LW3 A;  1B55 A;  2HE7 A;  2YS5 A;  2Y8F A;  3A8Q A;  4IOY X;  2EMS A;  2YRY A;  1KZG A;  2ROZ B;  4HAY B;  4K2O A;  1MPH A;  3ULB A;  1U27 A;  2K2U A;  1OQN A;  2M14 A;  4MT7 A;  1XX0 A;  2I1K A;  2ROV A;  3CIK A;  3ZDT A;  3SO6 A;  3TFM A;  3KRX A;  3LJU X;  1W1H A;  3KSY A;  4BBK A;  2D9W A;  2KUP A;  3T06 A;  1ZVR A;  1SGH A;  1X86 A;  2L1C A;  2HTH B;  3P6A A;  3X23 A;  2DHI A;  4GXB A;  2RGN B;  2Z0P A;  1Z87 A;  5HE2 A;  1X1F A;  5L81 A;  1GG3 A;  2W2X C;  1DRO A;  3QWM A;  2DKP A;  4XWX A;  3WA0 A;  1TQZ A;  2RUK B;  1J0W A;  3NSU A;  2V76 A;  1EAZ A;  5JP4 A;  2Z0O A;  1KI1 B;  2NMB A;  2UZR A;  1U5G A;  4HAU B;  2IYB A;  1UPQ A;  2QKL A;  5LOP B;  1P6S A;  3DXD A;  1XOD A;  3PZD A;  2VKI A;  5KQ1 A;  1DYN A;  5DIF B;  1QQG A;  4L6E A;  2PZ1 A;  3QIJ A;  2J0K A;  4TYZ A;  2MDX A;  2LOX A;  4HAX B;  4F7H A;  4NSW A;  4KVG B;  3TCA A;  3O96 A;  1W1G A;  1P3R A;  1V5P A;  3FSS A;  2YT1 A;  1AWE A;  2K00 A;  3AJ4 A;  2R09 A;  5LON B;  1V89 A;  4CHM A;  2AL6 A;  3MPX A;  2CY4 A;  2Q13 A;  2QKM A;  3GYP A;  3AU5 A;  1M7R A;  2RLO A;  2OTX A;  2LYD A;  4MK0 A;  3DXE A;  4EKU A;  4D0N B;  3F5R A;  2YVC A;  2I1J A;  1IRS A;  2DA0 A;  1J19 A;  3GYO A;  2LG1 A;  1X05 A;  2LKO A;  5D27 A;  2MWN B;  2KGX B;  2DKQ A;  5FI1 A;  2YS1 A;  4ZRI A;  3PVL A;  4DX9 0;  5C5B A;  1U5F A;  1NTV A;  2DYQ A;  5DHF B;  4CHJ A;  2J0M A;  1PLS A;  5D3W A;  4P7I A;  3A98 B;  3DXC A;  4GN1 A;  1MAI A;  2M38 A;  1I7A A;  4A6H A;  2EJ8 A;  3SYX A;  4A6F B;  3SUZ A;  3ODX A;  3PEG A;  2P0H A;  4GZU A;  1FOE A;  1BTK A;  3HW2 B;  1FGZ A;  1WJM A;  4CYE A;  1ISN A;  5GOW B;  1DBH A;  4GPT B;  2P8V A;  5D3Y A;  2D9V A;  3SNH A;  2J0J A;  4K2P A;  2D11 A;  1P5T A;  2CAY A;  2FJL A;  3BIN A;  5KCV A;  2DHJ A;  1UNR A;  1ZC3 B;  5EFX A;  2K2J A;  1K5G B;  4HDQ A;  2ELB A;  3MDB C;  3V5W A;  1Q67 A;  1DDM A;  1WVH A;  4GMV A;  2YSZ A;  2LOZ A;  4HB4 B;  2RVB B;  4IFS A;  2GCJ A;  3ULC A;  2DYN A;  2VRW B;  1BAK A;  2D9X A;  1M7E A;  4H8S A;  2YF0 A;  1UNQ A;  1EF1 A;  2DX1 A;  2KCJ A;  1V61 A;  2Y7B A;  4A6K A;  5KQ4 A;  4HB0 B;  1ZM0 A;  4ZRK A;  4HDO A;  2BCJ A;  4C0A A;  1MIX A;  2R0D A;  2G35 A;  1V5M A;  1X1G A;  1MIZ B;  2XQN M;  2J59 M;  2DLW A;  2I5F A;  1K5D B;  2Z0Q A;  1KZ7 A;  1OY2 A;  1XKE A;  1WI1 A;  5HE3 A;  4K17 A;  1WG7 A;  1NTY A;  3HQC A;  2EMT A;  4HAT B;  5JHH A;  1W1D A;  4KHA A;  5CLL B;  4DX8 A;  2RNR B;  1DDV A;  2COA A;  1XD4 A;  4NY0 A;  3RCP A;  1Y5O A;  4PNK A;  2COD A;  1U5E A;  1LB1 A;  4EMO A;  1MKE A;  1TJ6 A;  5D3V A;  3M1I B;  3ODO A;  1X11 A;  1MK7 B;  3N7C A;  3TO1 A;  3PG7 A;  5D3X A;  3U8Z A;  4Y94 A;  2YT0 A;  5FI0 A;  2VSZ A;  3ML4 A;  2DN6 A;  1NI2 A;  4B6H A;  1NU2 A;  2LUL A;  2CRF A;  4HB2 B;  3OAN A;  4K81 A;  5DHA B;  1WGU A;  2N23 A;  2H7E A;  2L2I A;  2GJY A;  5C6R A;  5CLQ B;  5DH9 B;  3TVV A;  4HAW B;  3FM8 C;  1DDW A;  2DFK A;  1ZC4 B;  2D2Q A;  5JLJ B;  3WYF B;  4WSF A;  4PQ0 A;  2OQB A;  2DX5 A;  3SV1 A;  2N0Y A;  2MFQ A;  4KAX B;  2YS3 A;  1MK9 B;  5JHG A;  2D4Q A;  3PVU A;  3ZVR A;  3BJI A;  5J3T A;  4HAV B;  2ELA A;  4HB3 B;  5HE1 A;  1WGQ A;  3PP2 A;  4F7G A;  4DBB A;  1I2H A;  5J3Q A;  2P0D A;  2D10 A;  5J3Y A;  1Y19 B;  2NZ8 B;  1BWN A;  3D8F A;  4ZRJ A;  1BTN A;  1XR0 B;  1EGX A;  1SHC A;  3F0W A;  3PSC A;  4A6F A;  3FEH A;  2IFS A;  5DI9 B;  2COC A;  2P0F A;  2D9Y A;  4EJN A;  4MY6 A;  3AU4 A;  4KHB B;  2COF A;  1GC7 A;  4Z2M B;  4Z2N A;  1AQC A;  3CXB B;  2GCL A;  4IAP A;  2E2X A;  4YON A;  2ZPY A;  1N3H A;  1FHO A;  2AEH A;  2UZS A;  3HK0 A;  1UPR A;  4GMX B;  1H10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...