1SHJA

Caspase-7 in complex with dica allosteric inhibitor
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
247
structure length
208
Chain Sequence
TYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGARCKTLLEKPKLFFIQACRGTEPRYKIPVEADFLFAYSTVRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFKKQIPCVVSMLTKELYFSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase-7
publication title Discovery of an allosteric site in the caspases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 68
structure length 208
sequence length 247
chains with identical sequence B
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2004-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1shjA00
1M72A 1RHJA 3DEHA 4QUEA 1RWOA 2CNOA 4EHFA 4I1PA 4ZVSA 2CJXA 2J31A 2CNNA 4FEAA 1ICEA 4QU8A 1RWWA 1RWPA 4D3YA 1IBCA 1SC4A 3V4OA 4M9RA 3V3KA 4NOKA 4NBNA 3R5KA 4PS1A 1F9EA 3GJQA 4AWAA 4QUHA 3RJMA 1RE1A 3GJRA 1QTNA 1SHLA 5IBCA 3QNWA 5IC6A 4EJFA 5LUAA 3DEKA 4ZVUA 3SIPA 4QU0A 1NMSA 4QULA 4HQ0A 4N6OA 1QDUA 2HBRA 3PD0A 2XZDA 2XYHA 2C2KA 4NOLA 2FUNB 3R7SA 1BMQA 3NKFA 2QLFA 3E4CA 3H1PA 4IEFB 2QLBA 1GQFA 3IBFA 1RWVA 2H54A 3R6LA 4JR1A 4N5DA 2HBQA 2XYPA 3NS7A 2CDRA 1RHUA 2H5IA 3D6MA 4HQRA 3R6GA 1I3OA 3V4LA 2XZTA 3KJFA 2K7ZA 3NR2A 4JJEA 1CP3A 2H4WA 4D3ZA 5K20A 5IAEA 4EHNA 4ZVOA 3R7BA 3UOAB 4AW9A 3OD5A 5IBPA 2H5JA 1I4OA 4ZVQA 2CJYA 3PCXA 1SC3A 3IBCA 3PD1A 5IASA 3R5JA 2C2OA 3H13A 4NBLA 4EHAA 4AWBA 3GJTA 4QU5A 3H11B 2QL7A 5IAKA 4EHDA 5IC4A 4N6NA 3KJNA 2QL5A 1K86A 4NOJA 3P4UA 1F1JA 2CNLA 3D6FA 3V6MA 5IANA 3V55A 5LU8A 2HBZA 1RHMA 3GJSA 4QU9A 2AR9A 1NW9B 4JJ7A 2CNKA 2QL9A 3KJQA 4I1RA 3V6LA 4DCPA 5IARA 1PYOA 4QUGA 4ZVTA 4QUAA 4JQZA 3UO8B 1QX3A 4JJ8A 3H0EA 4EHLA 3SIRA 2C2ZA 4QTYA 2NN3C 4FDLA 4DCJA 2QLJA 1PAUA 1RWKA 1RHRA 3DEJA 4LSZA 2FP3A 4N7MA 1RWXA 4IYRA 5H0IA 1SC1A 1SHJA 5IABA 4NBKA 4PS0A 2Y1LA 1GFWA 1CVRA 4FXOA 4QTXA 4DCOA 4PRYA 4JR0A 4NOMA 5IAJA 1RHQA 3S70A 2P2CA 2J30A 3K7EA 2J32A 1NMEA 4N7JA 5IBRA 2H4YA 3D6HA 1NMQA 4QUIA 4QUDA 3BIJA 3EDQA 2H48A 4QUBA 4QUJA 3H11A 3DEIA 2H65A 3EDRA 4N6GA 2H51A 1RWMA 5I9TA 4ZVRA 4ZVPA 2C2MA 3ITNA 4PRZA 5JFTA 2HBYA 4EHKA 4JR2A 4EHHA 2Y0BA 4FGUA 1KMCA 5I9BA 1I51A 4JQYA 5LU9A 2C1EA 2XYGA 5LUBA 3R7NA 2WDPA 1I4EB 1K88A 1RHKA 5IAGA 1JXQA 2J33A 4D3XA 3S8EA 1RWNA 4HVAA 4JB8A 2DKOA 3P45A 2FQQA
chains in the Genus database with same CATH superfamily
4XUCA 3B1WA 5BWOA 3SHVA 1WY5A 1ZH2A 2A0YA 3PNYA 4BS9A 2XCLA 4NEQA 3T3MB 1BKSB 1P91A 4Z2AA 4MDFA 2XCSB 4GVXA 1AO3A 2BBTA 5K01A 5JD5A 1ARZA 1SPBS 1IHDA 3ACBA 3OZUA 4MR7B 3TD9A 5ITZB 5EE3A 1YT5A 1HEYA 2V5UA 3MCTA 4GZ6A 4OHVA 3UM9A 5IN5A 4KQ6A 1JHYA 3TUIC 1ML3A 1MORA 3HACA 3RREA 3TVYA 5LA6A 3OJEA 4Z5XA 5F1PA 3ZTYA 3TLMA 3FMGA 1CTQA 3ZJUA 5EC8A 5ECWA 4C7OA 1DINA 2GRAA 4EL0A 3G8BA 5EI5A 3QKTA 2GETA 1EJ6A 1S4MA 4CTKA 3UAYA 3WLLA 1OWNA 1L3IA 4ISCA 2NO4A 5I8WA 3QWFA 3C0KA 4B3MB 1KY4A 1LWNA 3CMMA 1Z5UA 2HV9A 1E1KA 3KAJA 4O2RA 4PF1A 5JS7A 4HBZA 3PC3A 3O91A 4QYWA 1ZI9A 3F4BA 2VHVA 3LXRA 1BS1A 3R6GA 1NZFA 2XEXA 1MOPA 1EB8A 3M6LA 4C0SA 2VDUE 5JYDA 4QTZA 3KC2A 4TL8A 4LZLA 4CM4B 3T1NA 4DMUB 1CP3A 2IS6A 1C1DB 5KVQA 1Z3IX 4K9NA 2PTHA 3OQHA 1F06A 1PNOA 2FDRA 2FLWA 3NBUA 4HN4B 4HQFA 4KIGA 4N5HX 3TNJA 4ZYTA 4BU0A 5H7XA 4MO2A 2HT1A 1YI1A 2GVZC 4PQRA 3VYRB 5CB0A 3FF4A 2IW3A 5ED0A 3SX2A 4EF5A 1N3LA 2C78A 3EBOA 1I9CA 4NG4A 1TMKA 2PT9A 1RBQA 2O57A 4NR0A 4EHDA 3GMTA 2BFBB 4NCJA 3KJNA 5KVAA 4R9UC 3E5MA 5D3QA 3VBCA 1JAZA 3BDAA 4YRNA 5IYZA 1QGYA 2DZDA 2J4DA 3ZVLA 4KNYA 3KXLA 4DTIA 3T54A 5CIQA 4LXIA 3R3JA 3GEBA 3KZVA 1CF2O 3MJCA 3URMA 2P2LA 1XCBA 4UQPA 3L0ZA 3AY3A 3HN2A 5TXGA 2DERA 2QW0X 1QAQA 4H7PA 4YECA 3LUBA 4BX2A 4C6SA 5ALZA 4PBSA 3PG5A 1NSYA 1SD1A 1N75A 2C8LA 2FGJA 4MUIA 4YRQA 4YGYA 5KUTA 3CNEA 3D2AA 1QH1B 3NTXA 4N7MA 4ZVVA 1QE3A 4L75A 2IOFK 5JZVA 1NJ1A 3QVXA 3MINB 3GGJA 2I55A 3KE9A 3UMSA 4KCGA 1PNRA 1MW9X 4Y7CA 3KXKA 4G4IA 4A2QA 1KI4A 1P75A 2AEEA 2ZGVA 3BRWD 3IVXA 4QRHA 2IPAB 3V33A 3GGSA 5J3JA 1E7WA 1Y8AA 1DBQA 4LVUA 4YV7A 1M8FA 2VXCA 1IVNA 5DI3A 1NMXA 1U5AA 1XBTA 2P9CA 1XMXA 2FSUA 4KE8A 4UTOA 5D87A 1NJFA 4HATA 3OX1A 4PX2A 1Z07A 4ABTA 4KRYA 5E3IA 4C3ZA 4FM9A 4LFAB 4PLFA 4Q7MB 3E03A 5H8WA 3PQ5A 4C01A 3O47A 3U9TA 1KDRA 2BCGY 4M1TA 4Q00A 3RVBA 4UBOA 4BEBA 2QKYA 3UHAA 3OZWA 3PJGA 4LZJA 2G09A 1PR3A 4EELA 3L4SO 3BX1A 2BONA 3UBMA 3T4UA 5AMXA 2JH8A 4OH1A 1MG5A 3V2IA 2O1EA 3ESXA 4BTEA 4I9FA 4JYBA 4MVJE 5L7WA 1BIFA 1UL1X 1KQOA 2X4GA 5H3LA 4LJYA 4LYJA 1KJ9A 1VCIA 4N3NA 4EQ6A 1E4YA 1QVWA 3VR5A 4QM6A 1ESEA 3HG7A 4G4JA 1E0JA 4URHA 3MJDA 4CG0A 3I9LA 1QR2A 3LKVA 4YUAA 3JSAA 3A4MA 1JR2A 3DE6X 3MTIA 2BKXA 1OIXA 2QRLA 2BLNA 3EW7A 3QKRB 3ZLJA 1CT9A 4M0FA 4NV0A 3RSFA 1JBQA 4AT1A 4U5XA 4J07A 5HGXA 5IFLA 3H1EA 3KSRA 3G5UA 3MBOA 4ZXPA 1L7VC 3AHDA 4UNNA 2VH2A 3NG1A 4RA6B 4LRSB 5AHOA 1OH8A 2OOKA 1C30A 3E4CA 1FVOA 2PMWB 3UEOA 3WKAA 1FCJA 3GJ8A 4QYXA 4CL0A 3TEJA 3I12A 2XE8A 4HDOB 2JZNA 2JJ2A 3E1SA 1F8XA 4HNVA 5H02A 5A03A 4TWBA 2VT2A 1BQEA 4YQEA 1OZAA 4BNXA 4KMRA 4QFBA 5JDIA 1QIFA 2X2OA 4AULA 4PVDA 4MZDA 5KNDH 4L50A 5AK4A 4DLVA 3PX3A 2HXYA 4AW9A 3MJEA 2X1MA 5IH7A 3PK0A 4DL9A 4M9ZA 5AVXA 4E0BA 3AR4A 3WE7A 1SUPA 2EC5A 4QJ4A 1W2WB 4UMVA 3A31A 4EHAA 1IDN1 4KE7A 3ZNNA 1PSDA 1MP0A 1EBBA 2OB1A 4QGHA 4MUJA 3UT5A 4NOJA 121PA 3B6EA 1KSJA 2AE1A 4TVOA 3AFNA 3CIFA 1QUEA 5CXXA 4P83A 2R62A 1GN9A 4JCCA 4C4SA 1JH9A 3IIKA 1XHEA 3E7XA 2OHGA 1L5HB 3MRXA 2I99A 3GDWA 4Q7EA 4Z4GA 4UTVA 4LF6B 1FJHA 5F1KA 3RRFA 2C9DA 1L4GA 1N2OA 1YCGA 1SUSA 1YRQA 4LZZA 3VZDA 3ESRA 3EZGA 4ALMA 1JPJA 2PUFA 1WZ2A 2MMCA 1OFVA 5CVCA 2W6JD 2WJVA 4Q3CA 4XGIA 3VZCA 3ROQA 2NACA 2JKVA 3PVCA 1NUHA 1YR1A 3H19A 4HZGA 1KKLA 5AUNB 4MYTA 2X14A 4X8LA 3AR6A 1QQ5A 1YR6A 3QY0A 3OJCA 3GGCA 2PKQO 1F2VA 1ORDA 2QQ5A 3KT3A 5AVOA 2ZKIA 3EVZA 4DRZA 1T2DA 1XU7A 1WKBA 1O94A 3KPJA 2HNAA 1IJEA 2XA9A 1L5WA 3I5XA 1FMLA 4AS1A 1XE3A 4GXRA 5IZCC 5K8LA 5KWSA 1E8MA 3MRSA 3ZBUA 4AF7A 5JFTA 1SA0B 4XTCS 1CNEA 2RAVA 3L8FA 4IJUA 1XP5A 3NHYA 3UF0A 4XKJA 4LJSA 1JLSA 1SVKA 3II6X 2OAEA 4FJ1A 5KSOA 3WTCA 3N7UA 1EX6A 2JBWA 1YNOA 3E4DA 4AXBA 4DPLA 5DXAA 5JFGA 3FVWA 1ECGA 3RSLA 3DEHA 1CE8A 4WPGA 1K0FA 5SZJA 2AZXA 1Y1SA 1OYOA 3OZBA 4HNQA 4HWSA 4P54A 1LVHA 2TYSB 1YVUA 1XXHE 1CP2A 3CLTD 4MI6A 3F49S 3VZQA 1Z8HA 3C5HA 3U3RA 4XD7D 1YBAA 2ODWA 3IX7A 2OV3A 2W6OA 2G4LA 4PG4A 4TSRA 5CT4A 1JALA 1OZGA 2ZE7A 1Q95A 4MUFA 4PLTA 1YTUA 2TMDA 3DR5A 1GU0A 4IRXA 4QBGB 2HQBA 1O87A 2BJWA 5FB3A 4KYTA 5EIOA 421PA 4JC0A 1WSAA 2O6LA 1Z06A 2HJGA 1L5SA 3DO6A 3K1TA 3L9XA 1KK0A 1YGYA 3KQPA 3RS4A 5CLIA 1FP2A 1YZKA 3COYA 3HS3A 3QG1A 4REMA 1UEJA 3PI7A 4CR7A 4CV1A 4TL6A 5I7RA 5A9SA 1MQ8B 4MWGA 4ENRA 1FQKA 3UN1A 1Z7YA 4UBLA 4JMLA 1SZJG 4OD0A 1UBGA 3UMRA 5JDCC 1DELA 3WHKA 2ZR7A 3QVVA 3GNLA 3CNLA 5KQGA 1SMKA 3CF6R 5BURA 1HNZB 1W0KD 5CCEA 5K0SA 5J9FA 3G88A 2XMSA 1S2GA 1CZLA 1N2BA 2PRSA 4YRJA 5DGCA 4HLDA 1KJWA 3COVA 5JJBA 3BAFA 2Q2OA 2UUPA 2PL9A 4KO8A 2C4HA 4HY3A 4CIAA 4DV3B 5NULA 3NOVA 1TK9A 4TXNA 1SUAA 1G63A 3CRW1 1NAIA 3NCTA 2E89A 2VXOA 4ZJPA 1KRHA 4U2BA 3BL8A 4Q47A 2V6JA 3B53X 3N70A 1XZ8A 2ZVJA 4WK0B 1JLHA 1B23P 1M83A 3KX2A 1TTHA 2JBAA 3UWMA 1XN1A 4RF2A 2XDAA 2X9VA 2QRUA 4CCAA 2J7PD 5ALXA 4FB4A 1D1PA 1Z29A 3AUTA 1QM5A 5HZGA 1PKEA 1FUKA 5CEEA 2M9MA 1Z0ZA 4KGXA 4QUKA 5TQ0A 4S12A 3DFKA 2WT9A 3O75A 3M6UA 1X1SA 4DC1A 1XZIA 1L7XA 3C1OA 3G6KA 1GQ2A 1VCMA 2P6OA 3HBNA 3JQAB 2GCEA 2Q3LA 2ZRHA 4KMMA 1P7YA 2CXQA 2R6HA 5AKIA 3VKHA 4M0UA 1KI6A 2WJGA 2Q5FA 3G2QA 4W5RA 1IXKA 2BFFA 3SR0A 3V9PA 1JT9A 4J0FA 1N5RA 5F52A 4RH3A 4EYQA 4ZI2A 1KQ3A 4E5VA 3R6WA 1IWOA 3W4KA 2H1OA 2ACEA 4KXNA 3CLSD 2R3SA 1H4TA 2DUJA 1YS7A 4Q18A 4R8SA 1JE0A 5CD9A 1ESZA 1OASA 4XIJA 3WJ7A 1FSSA 3HADA 3PC8C 1EVLA 2GRJA 2VHZA 4TYMA 3SS8A 2GHQA 1NRIA 1ZK0A 4YT4A 5JTTA 4R68A 2AEJA 3FYCA 1TCCA 3CRQA 2X1HA 3IOEA 5ERGB 4J94A 1TIKA 4D8UA 1GG5A 2XJ4A 3IEXA 5A5EA 3K1JA 3TKLA 4GDMA 3QWAA 5D7NA 2BMWA 3WMWA 1GPNA 1YR8A 4IQFA 4CKZA 2A0XA 3R20A 5LP1A 3PFGA 4O1IA 1KK1A 1LTKA 4U2KA 4NCBA 1IY0A 2FPIB 1KNQA 3HKCA 3IUMA 3MQFA 4FYHA 4HDNB 4JI5B 5ADWA 2G82A 1VL2A 2NU9A 2C0CA 1DVRA 1DXQA 1FZQA 3C97A 3E15A 4FLMA 5EJEA 2UYHA 4TTRA 2HEGA 5INTA 1SQGA 1PJRA 2C92A 3DMTC 4P3KA 2DQSA 5GJBA 2NUBA 3BSFA 4UPVA 3GT7A 1T5DX 1P2UA 1IBCA 2WP0A 2JIQA 2ZS8A 4RDIA 4EFLA 4HRXA 2OYSA 3ECAA 4MKHA 3GAAA 1ETUA 1YVEI 2BGNA 3RHZA 4CDGA 2O8VA 3H2YA 3AF2A 4IIUA 5HBRA 1E6CA 2R4TA 4OYRA 1G1AA 1EVYA 1HSOA 2XW6A 4ANFA 1WCWA 1MXHA 2VZ9A 5IKXA 4QULA 3TOSA 3WKDA 2X6RA 5B12A 1V4BA 4O4LB 1JHDA 1KYWA 4JT2A 1XTVA 1J0AA 5ELLA 2C2KA 5CRIA 4URXR 4EY5A 5FJJA 3S0JA 1KEPA 3UA3A 3KYCB 4L5YA 3U17A 4IEFB 4O33A 4OB7A 3X43A 4UQLA 2IHUA 3BB1A 3IOBA 1RYEA 4RPIA 4U2GA 4BN0A 2X0EA 2DWQA 3R09A 3H1FA 2Q6LA 1QP4A 3B1XA 3ENNA 3LBYA 2YNMC 5BSKA 4O4LF 4B8WA 3RVQA 4KXMA 1QCDA 4JUAA 1CWUA 4BP9A 2GT1A 2V7GA 3NTVA 3QSGA 1SBQA 4HADA 2PFKA 3OEYA 3H6GA 1JV2B 5IBPA 3CPHA 4TV8F 2QP9X 4DUGA 2ABWA 1BEZA 2D7CA 2PUEA 5C37A 2FAXA 3QEBZ 3Q1KA 1EFVA 2TRSB 1EIZA 4K81B 3KLBA 1YMVA 4OQDA 4RY0A 5K0TA 3THWA 1BWQA 1HFJA 4C0BA 1GV0A 5KKNB 3BXPA 4OA8A 1OAAA 1U8TA 5DYIA 1TGVA 1N2CB 3D6FA 2WUVA 1AUOA 3VV3A 4D4JA 3W5CA 3DOOA 1QF6A 4MUAA 4K9QA 3KQUA 1XQYA 3A6EA 5WRFA 1Z25A 3PWKA 1SOVA 1H5UA 4X20A 2XQFA 3M3DA 4BMDA 4WOKA 2OENG 2ZRMA 3W3AA 1JDJA 4O4HA 3NJ8A 3HLYA 1G3IA 4OQYA 3G17A 1VZ3A 2I2XB 4LXQA 1NDUA 3H2HA 1NY5A 3FW1A 4UBKA 1LC3A 2PVCA 4LF9B 3TZBA 3K6JA 3L7IA 1PNVA 4H17A 5GZ6A 5LVAA 1T13A 3SEZA 2YHUA 3EEFA 3EIOA 3PTZA 1PFGA 2EQAA 4UDNA 2FRVA 1N4AA 1FZTA 1GGKA 4UMEA 1I1NA 3Q11A 4K6OA 1U9IC 3PNSA 3BK2A 4TMKA 5TY0A 5FTMA 1SOWA 2BSAA 3C7TA 3I72A 4DDMA 1PF7E 2NZVG 3EGOA 1OFUX 4U6QA 2AUTA 2PMKA 1KZ1A 2AJTA 2OLKA 3EEQA 3OC6A 3P2JA 1FA9A 5E2AA 3VKWA 2V74B 1T8YA 4MR9A 4RK5A 3IALA 1KO4A 4OJYA 2ZYVX 3TXYA 1U0BB 1IIRA 3FKSA 5KSPA 1O96A 5BSTA 1V8FA 2HBYA 2NO7A 2PSHA 2FZWA 5JXHA 1A5ZA 1XTZA 1V2HE 1CS0A 2H31A 1HX7A 2GPTA 5ALVA 3ZV4A 1QU2A 2B61A 4WUVA 4AN1A 5AXBA 3Q6IA 2VSNA 2YOHA 2Z2KA 3LLCA 1X1RA 2GGSA 3GLUA 3KFLA 1QB7A 4KN6A 4BGEA 1OROA 2HWYA 4DMGA 5IT9A 1JSZA 1D6JA 2I3DA 1EBUA 3DV0A 3JARB 4Z7NB 3COJA 1B0UA 1SHUX 2IHKA 5E6UB 4CN8A 4OHRA 5FWYB 3NDJA 4FBMA 3HDTA 4RDHA 4XWYA 2ATXA 1JSRA 1WUTA 2H7VA 3KQNA 1H5NA 1MJGA 2C4UA 1QMPA 2NIPA 3NT2A 5A04A 1NT4A 1Z9BA 2ZULA 5ER9A 1P0MA 1K75A 3ACCA 5K0ZA 4CZ2A 2Q6TA 1UT5A 1MBZA 3HEAA 4LYYA 3W1EA 4H77A 6REQB 3V1UA 1ZJYA 3EQ9A 3N2GB 1SU7A 3PPIA 1OC4A 2IOQA 4HG2A 4EGAA 5CA1A 4HDRA 1WF6A 4GP6A 1E4EA 2QW1A 2BH2A 3S2FA 2JVJA 1EG7A 1FNBA 2BFDA 3PDWA 1XP8A 5BV0A 1ZMRA 2V6MA 3HKEA 4V0QA 3USES 2ZTSA 4W5JA 4MW5A 4MEJA 5A7FA 5M7EA 2C5SA 5AI9A 2YDYA 4YHBA 4KO3S 3LP8A 4OQMA 2C77A 5JUWA 3K15A 1LPOA 3DR3A 3F4LA 3LXXA 3MK31 2D62A 1LC0A 1VLJA 2CLIB 2EJTA 2NYAA 3FBWA 3IQFA 4RVHA 1YQXA 5GJWC 5AOAA 1XALA 2CHFA 2XECA 3W5IA 3LYAA 1KMNA 1Z56C 2H4WA 2WHQA 2QTVB 1DG3A 2ZANA 1B8UA 1JJVA 4K9OA 4PAQA 1N34B 1PLLA 4NJEB 1CUIA 4B7UA 4BWGA 1E2GA 2X13A 5IASA 3KNZA 3W34A 1WHSB 5FLYA 2AXPA 3RRMA 3L1JA 4GKBA 4EVSA 3TPZA 3LV8A 3USCS 1Y81A 4ZO4A 4MRMB 2D3WA 1QIGA 3ILSA 4YQYA 3U1TA 5I7FA 3IV9A 2UXCB 3EWAA 4N5LA 3QHAA 1IM8A 4QAQA 1ZO8A 1BW9A 5EHNA 1CJMA 4HCJA 1M76A 1MAVA 3UAXA 3VOSA 5FLXA 4LE2A 1HE4A 4I9NA 1PFKA 3T3IA 2MSLA 1VRWA 2VNJA 3OPXA 4BMSA 4FCVA 1TLTA 3JAWB 3TRFA 4JJ8A 4FXPA 1J2YA 1TM2A 3TLXA 2RAFA 5TPZA 1E63A 3VKGA 2XNCA 1OV6A 1S2IA 3LP5A 3OLQA 1PG5A 3GLHA 1GGJA 1PEAA 1HQKA 2QAGA 2VK4A 1Z39A 3GLTA 4PSCA 1EEXB 3MSCA 4C89A 4YR9A 1XCLA 5B36A 1XPOA 1MVOA 1TQ4A 2J45A 4H1UA 4LY6A 1FX0B 3Q6MA 4MCHA 1ZISA 2O52A 1P1IA 4DC0A 3HKBA 3S2IA 2FFJA 3ERCA 2JLQA 1DRWA 3D1LA 1P9WA 4L7QA 2XUQA 1GRNA 1NQWA 4NE9A 3WYEA 3AIKA 2M1XA 4M0CA 1UBCA 3BHNA 3QPVA 3EIHA 1D2MA 1RWMA 3QJGA 1C0PA 1U7WA 3ER9A 2QQ0A 4AUMA 3S99A 4DMMA 1DPFA 1BA2A 1YJQA 2DWOA 3IULA 3PFWO 5J2UB 3L6EA 2DOKA 1GD1O 4PGMA 1KWGA 1PEDA 1C4OA 3K2BA 5AVWA 2YXEA 2OXIA 1ZD3A 3GRRA 1XEWX 4OAOA 2A5FA 5C7LO 4YO7A 4EB6B 1ECJA 4RTRA 2OK8A 2OFOA 2E4VA 3C39A 2ID4A 1PJLA 2Y0CA 3OFND 3PGJA 4YP7A 3T5TA 4CYMA 2IYSA 4FHZA 2R0QC 1O89A 3EG9B 1XEFA 4Y2TA 3ZWMA 3BSYA 4RD0A 4FYPA 5J2UF 3SWWA 1TB4A 4J3FA 2BL4A 2G7MC 3ETCA 3DMRA 4HS4A 4MYSA 4MI9A 2Q1YA 5KWEA 3NUGA 3RV3A 1JYSA 4C4RA 4KK4A 5BWCA 1KP3A 3GJ6A 3OLYA 3DH0A 1XG5A 3NHLA 4HC4A 5BPFA 4ZDWA 1P2FA 3SP1A 4CU2A 4C7JA 4WEOA 3N75A 5LUAA 4AKHA 2I4RA 4B34A 8GPBA 3QX3A 3E2MA 3OT1B 2I4LA 3GU3A 4RBNA 4BNFA 3BHIA 4JL8A 3QBJA 3PJEA 4FHFA 1G291 4L73A 3N59A 4KV9A 1EFKA 3Q40A 5LN1A 2G5TA 5IMSA 4WJKB 4WVLA 2VUSA 1FTSA 4BJ3A 1K08A 1OBOA 4DT1A 1BTOA 2WU1A 2VBFA 4FQ5A 1VG9B 3UT6A 1RXVA 1Y42X 3DAGA 3Q3CA 5KMGB 2GZAA 4AROA 1GTZA 3OEWA 4MB6A 5FOWA 2OXCA 4LHYA 5BVHB 4Z3DA 4JQOA 4E5NA 1PBTA 3G68A 4IJMA 3A1WA 4JBLA 3W79A 5HQTA 3H65A 3KYIB 3ZV7A 4UHHA 4OXIA 3UJNA 4D4GA 1I4OA 3LQRA 2WAYA 2G07A 4PZYA 4X1YB 1DX4A 2B7BA 2HMVA 4AO6A 1EVEA 4M0LA 4EFDA 1UBRS 5K0BA 1HH4A 1D9XA 1TE2A 4I81A 1U0RA 5CFRA 2HW8A 3ORQA 4S35A 1U80A 1NYTA 3RK0A 3U5TA 3I4CA 4YDSA 4BRUA 5DI9A 4N0PA 1TQ6A 3G2JA 2OR3A 1DRJA 3SKYA 3AKDA 3K16A 5J63A 5JPIA 4P3XA 2NU8B 1CPYA 1YCDA 2IL1A 3HEMA 3EUAA 3DZCA 4DKXA 3T9FA 1M34E 1XZEA 3CW8X 3I8SA 4FYWA 1XZAA 3OT5A 3WQSB 2NU7B 3TE7A 5ALJA 2QG9A 2BEVA 3E3AA 3EF0A 3HUUA 4TRRA 4KITB 1EK0A 4S05A 5HMMA 3TZQA 3QVSA 1XJQA 4X66B 1MO3A 4MUKA 3PQ6A 4YAWA 3ZQKA 4BBZA 1LJ8A 1VE7A 2WWFA 1QO0A 5DIFA 4A8HA 2C5AA 2PD4A 4FXOA 4JELA 3ENWA 2JJYA 1WPGA 3IKJA 4GW3A 1IQ0A 3CH5A 1ISIA 3H1TA 5E7MA 2C54A 3GFFA 1H9CA 3B36A 2PMDA 2H4YA 4CM7A 1YJBA 1JEAA 3RC7A 4IHKA 3KPYA 4QLBA 1KJZA 1DFHA 4PEVA 4Z4HA 5BUZA 4C2BA 3PNMA 2P7HA 3FSRA 4TOIA 5BT9A 2FFHA 3UAOA 4MI1A 3EFBA 1BHJA 1E2JA 3AVTA 1OGIA 3ITNA 2H57A 3NIGB 3IBYA 1MOSA 5H80A 5HIAA 1UXIA 1C3OB 3F7TA 3LPNA 3L1HA 4HKTA 2F8LA 3IE0A 5CB4A 5JH7F 1QRAA 3RR2A 4ZOAA 2XYGA 3GW8A 1QOZA 4A26A 1N25A 4X24A 1QH8B 1CUGA 5ECGC 3TR0A 1CD5A 1CUWA 1H0RA 4N0DA 4UU0A 1NE7A 4G8BA 4JI3B 4M21A 5JAPA 3I0MA 4FKBA 1NPYA 4ZREA 1T3GA 2D4AA 1GZUA 2CNNA 2IUTA 2QM3A 3EPPA 4MROA 4D74A 3D59A 5DX8A 2X15A 2XZLA 1GCAA 5C46F 1RKUA 4CKBB 2QJRA 3OE7D 1G20A 1HMPA 2PA0A 3BN3A 3QUQA 1P18A 1AHIA 4TXJA 4BHTA 4YMVA 5BUQA 4JI0B 1E7SA 2Q0QA 3P9SA 3DFUA 4IIJA 1HG0A 2R68A 2YL2A 2XIJA 1AXRA 3AJEA 3SQXA 4PC1A 3ELWA 3QUAA 5D00A 7REQB 3NIDB 1JJFA 4OG2A 2O0KA 5CH3A 3SIPA 4KWTA 1X86B 2Z6QA 2ZYUX 4RHUA 1L3BA 2Z2IA 1V8ZA 4WESA 2RBKA 1M0SA 2XZDA 3KQOA 1Z13A 3O2NA 4N3CA 4X41A 4AXXA 3K72B 2VHXA 3W5JA 2D5BA 4FFRA 3CCBA 3FFXA 4EUEA 2CCGA 2G5GX 1KZ6A 3B2NA 1S4QA 3R4VA 1T8PA 2WJJA 1N7GA 1Z37A 4O3FA 4QDXA 3RM3A 2X41A 2V7QA 5DYWA 1YUBA 4E4RA 1VLLA 1E2NA 1U0OC 4FHGA 2QMQA 3I04M 4C4XA 4RACA 1B43A 1J0EA 1NLMA 1NI3A 4KDFA 2X7HA 2PNFA 3AI2A 5B3JA 3EISA 4Q6WA 1ORHA 5K3DA 4P4SA 1QIMA 3C16C 3FWHA 3DBRA 3F2VA 3PVZA 3WZMA 4GX1A 2WF9A 1MAHA 3CRZA 4WCVA 4ZQHA 1KQPA 3DNFA 3O92A 4I9UA 4GAEA 4AUKA 6YASA 5DLPA 2FZEA 3R3WA 1C8LA 4UCFA 5SY6A 2V0GA 1DRVA 5KTYA 2JW5A 3I64A 1W5EA 2P4SA 1EDZA 1P4HA 4MUEA 2X4DA 3S28A 3TRKA 2WQ7A 3K9HA 3MMNA 4N5IX 4ROTA 2C2HA 5LM3A 4G26A 3KYDA 1S01A 3I0NA 2EX4A 1JDBB 4RXTA 1D9ZA 3FETA 4B76A 3VR6A 4FMPA 1DJOA 1JI3A 3NAZA 5TT0A 3HYRA 3NWJA 3AVXA 3IAS6 4NZMA 4V2UA 4EHLA 2PSDA 1CYEA 4N0EA 4ZRDA 3LPAA 4DCJA 1K6XA 1N1DA 3C4JA 4ZC1A 1Q83A 1R8QA 3U7QB 4E30A 1R6DA 2C97A 4MIYA 1TM1E 4LRQA 1S3SA 1U9YA 2NSHA 3EZLA 3RVRA 5FOTA 4D57A 3L7CA 5EXDA 5I3CA 3BFJA 1IBMB 3KAKA 4LJRA 3LCRA 3CO5A 3OZGA 3SSAA 1NQTA 4KVFA 2QQGA 1R4MA 3HA7A 4RL4A 4BC0A 5BOSA 2BZSA 3H9GA 5HIJA 1BYIA 2HRCA 2WVGA 4D99A 3DD5A 3SQDA 5KX5F 3OCWA 3PDJA 5DTJA 2ERXA 5G02A 2J0QA 3MJ4A 3MYYA 4BWVA 5LJIA 2V03A 5ALMA 1L7QA 3KQVA 1AZWA 4KSBA 1JR3E 2R44A 1FE8A 2E6KA 3MJVA 3RDPA 1Q92A 1SK8A 3PDUA 1KQNA 5M34A 2D5LA 4RK0A 1GM5A 4IG4A 1VPVA 2JAOA 5FEMA 1L5OA 3ZVMA 1F12A 3B70A 3G6WA 3NHAA 2XOEA 3M2TA 4C7MA 2YQ4A 4MV5A 3VPXA 3K4PA 2RIRA 5AM2A 2AZMA 1SZDA 3HL0A 2RGWA 2N46A 2QT0A 2WMNB 3WB0A 1B73A 1NM5A 4MRSA 4PXSA 4IV5A 5D1HA 4EPXA 1W85B 3IEPA 4P7JA 3H0KA 3WKCA 5AVRA 2XOKA 1DQSA 2GM9A 3QVMA 4BQRA 1INLA 5F7XA 3T35A 2Z98A 4NL4H 1ND5A 4KRXA 4QXPA 3UAVA 1W93A 1YQEA 3LY5A 4IIXA 4DIKA 4BDTA 3ZTWA 2VTDA 1T35A 4ZT4A 1RNLA 5CIYA 2YHBA 5JSZA 2FEMA 1AN0A 1TUEA 3LC0A 4GI7A 1RE1A 2ZEJA 3DCNA 4E21A 3ADDA 1DCKA 1ZUD1 2G06A 1HQCA 3CX8A 1D2AA 1QAOA 3HB0A 4BVGA 5FPSA 4WVFA 4KIJA 4KQEA 2WYHA 4CM6A 4Q0MA 1EFTA 1P1FA 3P19A 2EBWA 1L7OA 2AQHA 1C9DB 1GCUA 1MC5A 2FUNB 2PL5A 2QX6A 5KAPA 1AG9A 3X0DA 2H7CA 5F4BA 2J9GA 2ISSD 3NTRA 4KFTA 3W1WA 1VMIA 2V9ZA 1S89A 2LDXA 3IUPA 3H9JA 1FDVA 1W5FA 1U02A 1V5WA 2G63A 3FCCA 3WLRA 1FP4A 2YVLA 3KOMA 1MF7A 1ZCAA 3TWOA 1EFRD 1HR0B 3O8QA 4QXQA 3FSEA 1WABA 4TV9A 1KVTA 3DBLB 2NNLD 5DW3A 2BGUA 2NO1A 3DXXA 2P2NA 3EIWA 4KP7A 1XK7A 3UGKA 3E58A 3T3PB 5HTOA 4AJPA 4H7HA 2Z8ZA 3IOMA 3PCXA 4OXKA 4FSXA 4QRIA 1QFSA 2Q49A 3R0VA 4PXAA 5IG2A 3AR9A 3R7WB 2BEWB 3QHQA 4WINA 4X71A 3WBKA 4ZAVA 4Q02A 5F3DA 3PE3A 1CDEA 3AESA 3HO8A 3HPRA 3K5WA 4XDZA 1MH1A 1Y8RB 1MVNA 1TIBA 3G02A 3G3EA 4O2BB 4RQBA 1WXDA 1HUQA 1ZX1A 1KXJA 1P4GA 4U7FA 5FV7A 3B20A 4J2OA 3KJQA 1LF0A 4YNBA 3DVRX 4LFCB 4AMYA 4R0MA 4XJXA 2I78A 3AUFA 4KYVA 4BAGA 3P2MA 3R3UA 2IZOA 2IOFA 3DDZX 1DKOA 1N8KA 2YXLA 1WTAA 2Y1DA 3QA3E 1JH8A 3KCNA 3ZQUA 5CBKA 3G79A 5E7IA 2DQKA 4HH0A 4RM2A 1U6JA 1RYBA 4O2BF 1N5LA 2DHEA 2H59A 4GE3A 4BBAA 2XMRA 4KK3A 1M6WA 1W8IA 2OG1A 3FPKA 1MPXA 1KETA 3F6CA 4QM7A 3JWJA 1GZHB 4NE2A 3C3PA 1EHIA 2WFZA 3QXSA 5THQA 1LDEA 3HYTA 3B9RA 5BN5B 4BRSA 3EVGA 3MNFA 5K3AA 1A9ZA 1Z4JA 2XXAB 3JRXA 1PGQA 4L08A 4YP9A 3T0IA 3WLSA 1VKRA 1J97A 4Z3KA 1H2FA 3K4QA 4I50A 1TF2A 1GPLA 4OQLA 1USUA 2WZDA 5ALUA 3SF8B 2FUG1 3X2FA 4YLEA 1J99A 4BX3A 2JAPA 1AQUA 1X7WA 4P31A 2NVUB 4J0CA 4RE5A 5CNKA 4D9EA 3PQFA 5DNYB 4GG1A 1LJLA 3OPYA 3RAFC 2OBBA 3TBHA 3THRA 4AYWA 2JHAA 2PU5A 1DWUA 3QFFA 1R4NA 4QYIB 5DE3A 4MA5A 4QXMA 2E4ZA 4Y2SA 4D0LB 1ABBA 1KO7A 3HR4A 1ZSVA 2C2XA 3HWWA 1JDBC 1O77A 2NAFA 2O0HA 1FL9A 2XDYA 3GDGA 4DR4B 4K0KB 3DBOB 3P20A 4ZOEA 5I7OA 4HZIA 4BNIA 2XGMA 2F8SA 2V3CC 3VR3A 3V42A 1A97A 5FBZA 3KKPA 5KO2A 2WJHA 2Y05A 3DNPA 1U7XA 3T9DA 1KHTA 5KTKA 3X1YA 1GEEA 2Q1UA 3RVKA 3BGOS 1XWIA 2Z57A 3L46A 4CDRA 3P9CA 4J0EA 4JBWA 2VPZA 4BKMA 1WEHA 2QTLA 3CU5A 3VC3A 5CXQA 1B0PA 1K9SA 1UXJA 4GZMA 2GK3A 3SXUB 2EFGA 5HFNA 5IEBA 3AIOA 1KSHA 3JATB 3DB2A 1HT1E 3KU1A 2PSFA 3RT1A 4JP1A 2PLNA 1P4JA 3B1YA 3HVKA 3ANYB 4GMDA 2B20A 3WA7A 5HKAA 1ZA2A 2VDWB 4JC8A 3P9YA 3FKQA 2XUDA 1NRWA 1IZ8A 2Z5GA 5LQRA 1Z5OA 4X00A 2RGNC 3DM9B 3OQMA 2BPOA 4YAKA 1GRCA 1P80A 1R2QA 1TGYA 1N2SA 3X1MA 3CE6A 1XMPA 2OBMA 3C7AA 1AA6A 1NXXA 3KFXA 2WF6A 1U2RA 3ANNA 5AW8A 1EHYA 2ZAMA 2Q8NA 3P9KA 2XNJA 3LDUA 1BZYA 3CLTC 5ITSA 1GNVA 1MABB 2Z4RA 4DWOA 2PKRA 2E5LB 4MSUA 3KHUA 2BC9A 2EEZA 4JI7B 2ZTMA 2QTFA 3HABA 1R88A 1W4CA 2O2DA 2C5HA 1N92A 3STUA 2ZSJA 3BIXA 5EZYB 4GM4A 1JF8A 5D84A 3K0EA 2FMHA 2XKKA 2W4MA 1HOXA 2IWHA 4XUEA 1F60A 3C6MA 2XTJA 2ILVA 2XYVA 4L8GA 1E9AA 4RO0A 3VH1A 5KNBA 4Z4EA 5EOVA 4DOMA 4E31A 2AOTA 2X9GA 3FIUA 4G89A 4TZTA 5FPKA 4NV3A 3ETGA 3TMYA 3W05A 5EZYF 1KK2A 2I7CA 3DA8A 3JRNA 3NHMA 4JEUA 2G04A 2RGRA 2MU1A 2FPKA 3P2YA 4Q7QA 5J43A 4UFOA 1CJSA 3C6QA 4P4NA 2PPVA 3EHDA 3ZGYA 4OMCA 2A59A 1PKXA 1Y8QA 1CNMA 1D0VA 1C7ZA 1NFRA 2BIFA 1W9HA 3FPHA 4FVTA 5DHQA 4IP0A 4U7PB 2Y4NA 2ES4A 4XRGA 2JHCA 5DMHA 5DHAA 2Z3ZA 4BRWA 3CUSA 3DDWA 1VIVA 4KGVA 1GPAA 4KAFA 1IZ0A 1NN3A 3DCYA 3TRJA 5JXWA 4R2KA 4TQGA 4WXHA 4A8JC 4BPRA 4FFNA 4OYYA 3O1IC 4U3JB 3CSSA 1GNLA 4NNOA 3BXXA 4Z49A 1IHOA 1QPBA 1RBYA 5ICMA 3MELA 4ALNA 3C5WP 2UZ4A 2AN5A 1XKQA 5AUQA 1XDGA 1YIOA 2OZLB 1KAOA 1YJAA 2SHKA 3R8CA 1UC4B 2ONYA 4UXIA 5AXDA 1W52X 2P3LA 3MG9A 4DUZB 1GGHA 2YHAA 1HDXA 3Q0TA 1W25A 3KUUA 3E9YA 1Z2NX 4ZVSA 4CN9A 1EP2B 9LDTA 1SNYA 1ZCJA 3ZE8A 1XOIA 3TSWA 3ZCTA 2XAAA 4HHEA 3FWYA 5ALDA 3REQB 2Z1NA 5JY6A 1ZSNA 2HSZA 1JDTA 1U3GA 4PGFA 2J7KA 2PZLA 3ILHA 4YRSA 2O06A 3TBKA 3R4CA 3MERA 4DRXA 4RLQA 2A94A 1HA3A 4G0PA 2WYOA 4I5EA 1KEZA 4RKFA 4W5WA 5EYPA 2G40A 3D5QA 3M6MD 4IXNA 4UEQA 2E1RA 1H9BA 1PTJA 3VM6A 3W4JA 1TEVA 1S8NA 1WHTB 1XA4A 3O3OB 3CLSC 3HNRA 1YBHA 4MICA 1BN6A 2CL0X 5ALEA 4Y9UA 2FQ1A 2GCOB 2P1RA 3AINA 3FRIA 4UHBA 5MN4A 3C7KA 4ARZA 4DJJA 4BGIA 2IS4A 2ON6A 4JXKA 1G66A 2Q5CA 2WC1A 1XAJA 1A96A 3JD3A 3B3JA 5LOVB 1PEYA 3TGPA 2NADA 1GFZA 1Y1KE 1EFCA 3FHCB 4BNKA 3AX6A 1CHDA 2PMFA 1ODIA 2GA8A 5CH5A 2ZJBA 2XT9A 3UUFA 3WISA 2AZDA 3PGVA 5IAEA 2CXNA 2L69A 5IAOA 1F17A 1RJ9A 4O8ZA 5JFOA 2DH5A 3HUTA 2IPLA 3T34A 4GZLA 1LBIA 5LBTA 4LDAA 2VBGA 2Z30A 3GVCA 5FLEX 4BKUA 5LOVF 4EMUA 1PX2A 5KYXB 2QAJA 1IZZA 4YK7A 4WUTA 5JCOC 4G0UA 1G8HA 4X5OA 3BL5A 3L07A 4BO1A 1HLPA 1V45E 3S44A 3VO2A 1OJ7A 1O94D 1VBNA 3CWQA 3I23A 2COEA 1XA3A 3T12A 3KVOA 4IJKA 1HQYE 5T4HA 3KB8A 1Y6FA 3QELB 3DJFA 3JZIA 1HOTA 5EJGA 3OP1A 3H6KA 1PP4A 3OWXA 3CUUA 1Z62A 3GEPA 2GR9A 4HH1A 1XXLA 1T2FA 3E61A 4K8OA 4PSKA 1ZCZA 1KP2A 3OPYI 4KXUA 3LMKA 4YS6A 3U49A 4CR6A 5IJ9B 3MT8A 2O8BA 1OILA 3E0QA 4B3HA 2B8EA 2VDQB 2J0SA 3JWGA 1I9GA 5CYOA 4N3GA 4BN4A 3C4VA 3IQEA 4ZGBA 2OXTA 1YFLA 4K86A 5AT1A 3A9RA 3IS3A 1M2JA 4M0KA 3T3NA 2F4VB 3WK5A 2E4XA 1NQOA 1ZONA 2HQ1A 3QF4B 4FMCF 4PNPA 1V43A 2XQJA 1BC5A 1Q15A 1SCIA 2ZYIA 3N3BC 4GBED 2A1UB 1A9TA 4NPHA 2PANA 4XPIB 1RLMA 2DUWA 1T91A 5K51A 5KCMA 5FOQA 1IBRA 5KYNA 3E27A 2Y1WA 1E32A 1PHPA 3AV0B 1DIAA 1C9MA 4N7BA 1R6BX 3M83A 4F4DA 3CEHA 3KSBC 4HYTA 2H7YA 2JHGA 1E92A 4CCYB 5I6DA 4V02A 1U1IA 3UA4A 2N1MA 4BFLA 2BAGA 1UKEA 2BDTA 1X39A 3D0OA 3GD5A 4I5GA 4R1TA 3RS8A 3ZKAA 2Z5LA 5IDYA 3TOXA 4B47A 1QONA 3EWSA 4IDEA 1OLUB 1ZU4A 2HMAA 3ZHRA 3L8CA 2PV0A 2RSLA 4EH1A 4UMFA 1UKCA 1BDIA 4NZZA 2YWGA 1CSEE 1DKNA 1UBEA 1ULAA 2DKFA 2OGSA 2V54A 3Q3HA 1SG0A 3RBZA 3RIMA 4NS1A 1UZNA 4R98A 3FYUB 3PYLA 1B41A 1C4XA 1P6QA 2E6UX 1HFKA 2JIZA 4H3HB 3RVDA 2YR0A 2WWWA 3O8NA 3LM8A 3AF6A 1MRNA 4J91A 3EDCA 1XTKA 3A4IA 3N6RA 4NBNA 4B17A 3HDGA 3EXG2 4FQ8A 4YH1A 1KYYA 2B2CA 2VQDA 3LX8A 1HFEL 4H3SA 4KN8A 2GKOA 5I9MA 3WIEA 4D6YA 2H18A 1K4YA 2CE2X 1Q3TA 5JSFA 3RGWS 1TAUA 1JLLB 4C4AA 4ZCIA 4G5HA 1UC5B 2KQUA 2NPIA 2OP0A 1AE1A 3PR2B 4HYEA 2WJ4A 3ZKWA 5A0VA 3AIMA 3I6YA 4GU5A 2QR3A 3LX4A 3K1ZA 5F2KA 1QQAA 1TPYA 4AY4A 2IYZA 2LCIA 1AA9A 3BD6A 3G5TA 3JQRA 3V1TC 4B71A 1G7CA 1Z17A 4C22A 1U2EA 1OTYA 4PZEA 3T7CA 1NJ8A 2GUWA 2VUIB 4QPDA 3IBGA 4Q05A 4PHTA 3T3OA 4BC1A 1T8SA 3DE5X 3GG9A 3DBHA 1EXNA 3NR2A 1AKRA 2RGAA 3G0CA 5F7JA 2C3PA 5TGDA 2I0FA 2B78A 1EFPA 3DVQX 4B6SA 5MFPA 3L92A 3LC1O 2FEXA 4BEWA 1XTPA 4D9CA 2QUIA 4X6YA 5IS2A 4XQ9A 4GGOA 3HO6A 4P86A 3CNQS 3GEMA 1CNFA 4WV3A 3HXPA 4C0JA 1VXOA 2H0QA 2OHJA 4MUBA 5EXSA 1RT9A 1SBHA 1TZBA 4GZ3A 5EP3A 2VNHA 5KX5B 2CUZA 4IQ8A 4HPWA 1PQPA 5AI5A 3ZX5A 1YDFA 2PPLA 3BE5A 2ZJFA 1IWBB 3ASZA 4HB4A 1SHTX 3FMOB 4IHQA 4ZHQA 2P62A 2ZBDA 4JODA 3DTTA 3HR8A 5IANA 1I2MA 5A0FA 3RAPR 5AM3A 4IYJA 1MIOB 2XVYA 1UK8A 4BIMA 1GGNA 5HZKA 4INOA 4TKUA 1Y98A 1Q1NA 2ZJ2A 3OECA 5ALSA 3EXAA 4XGKA 3RYHB 3KBBA 2V55B 2JHPA 3OO0A 4X3OA 5IF3A 5JATA 2QDXA 1T9KA 3HXKA 4D9IA 5HJ5A 3CV3A 3H75A 3SHFA 2BHNA 5BY2A 1JEYA 5IKMA 4LYDA 3MTDA 1NKTA 4XIFA 5GGXA 1U63A 3DCIA 4R2XA 1M54A 2O7RA 3E2IA 4YXWA 3UENA 2CLSA 4HDSA 3K9GA 3WL3A 1LRLA 2C0QA 4E2YA 1W35A 1NOJA 3JASA 2BI8A 1G17A 4YRZA 5B4VA 4J16C 1G7TA 2ARKA 4E94A 1NQUA 2PQ6A 2QPOA 1E58A 2O8CB 2IDJA 1E2BA 5FQOA 4LF5B 3SVTA 4HUJA 1GZSA 1RC0A 4HN9A 1E1CA 2RDMA 2SKEA 3OMLA 1M74A 4RVCA 2H48A 2JJ8A 3KLNA 1O6FA 3KQYA 4MQ5A 1Q6YA 1ZZEA 2J4CA 5JHGB 1K5GA 1ZHHA 4PC6A 1Z7WA 5AJZA 3AV3A 4ZCMA 2AEFA 4KQ1A 2N0SA 4CV3A 5H83A 3Q7TA 5JVDF 5JALA 1KO8A 4D3SA 1T26A 5J5VA 3WO1A 4OOFA 4TTQA 2Q6VA 3LL7A 3ZY4A 4ARBA 2W98A 5KI6A 1GHTA 4ID3A 4LX8A 5PGMA 5B55A 3BKXA 4GD3Q 1N7IA 3EJ6A 4ZOCA 1FYWA 2I6SA 3GCDA 4LJAA 4AQYB 3OH8A 1GZ6A 1T6YA 4ZZ1A 1A9XA 2L2QA 1PR4A 3MTBA 5ERYA 3AOEA 3N2ZB 2PH1A 2EP5A 2CHEA 4FSHA 1DIRA 2VYVA 1FFXA 4DUYB 2JDID 2KB0A 4GI5A 4GH5A 1TCAA 1JHRA 2H7XA 5JWRA 3BF7A 5JJCA 1WL8A 4ZVNA 1RPTA 1UQUA 3DBVO 3CF4A 1RI2A 4GYJA 1XELA 3H04A 1G8YA 3X44A 4DUGD 4HH4A 1Q91A 1ZRHA 3G2MA 4MJ3A 1G3UA 3E0XA 3KZCA 4WZBE 4H1TA 4D0GA 1NVXQ 4BQEA 2FPGB 4PINA 4P32A 3FTQA 1BVHA 1HKUA 4IH1A 1ZM9A 1VSBA 5ESWA 2P91A 1MX5A 4MQUA 5HCUA 3ZE6A 1D4ZA 2A9OA 3NGMA 1SH7A 5GGYA 1PQYA 3ZGZA 4DMHA 1QYRA 3DKPA 2WIJA 1P0CA 3P8ZA 1T4CB 2P9EA 3KDPA 2Q4DA 2QROA 3DQZA 4NZOA 3BMXA 1PIWA 4ZT3A 3AR5A 3W3AD 2W2TA 2JGDB 1GZ5A 1C3EA 1H0KA 2AN4A 2BFCA 5FPTA 4FPXA 1RQXA 1H2YA 2WK1A 3DOEA 4I1IA 4JVMA 1RFLA 3IGFA 4D3ZA 2C4NA 4QDKA 2I5PO 2JLAA 3AEKB 3NZEA 4HWTA 3GPDG 3MZ0A 4MAMA 4WDRA 4F6CA 3R8FA 2Z6UA 1CZUA 4UE2A 1MX3A 2R6DA 2XSZD 4DDUA 1XRRA 1LX7A 1DT5A 4IV0A 3IPRA 3NBFA 2GN1A 2GLUA 4IDFA 1A9QA 1W581 2VKQA 5C7YA 4BECA 1VJRA 1XVVA 3FGZA 5LXTB 2R5NA 1XV5A 5EMMA 3FYUC 3IQXA 2VHCA 1W36B 4P82A 4YP1A 5TQ2B 2H1LA 4YPFA 3F5QA 3OFKA 3P1JA 4PHHA 4HLQB 3D6NB 1KGSA 2AXEA 4DZZA 2PJRA 5JBQA 3BS4A 3F3KA 5C0OE 1IWPB 1POWA 5CR9A 2GZDA 2ZUBA 3UWKA 2AWNA 3FPJA 3HN7A 2QIPA 1Z26A 4ERNA 4Y9DA 1FUIA 2W6IA 2NXNA 3C6KA 3DXYA 3LC2O 5IDWA 5JHHB 4D9MA 1PR9A 1WMFA 2ORWA 1QAMA 1EDDA 3BMOA 3EIXA 1VPLA 1CUYA 1UBJS 1ZUNA 2XQKA 3ZOKA 4TGLA 1JQEA 2EVWX 3PKIA 4ETNA 3DC2A 3CR7A 4L4ZA 1W73A 4M54A 4X1KA 5BN4A 2FMTA 1O6ZA 3AXSA 2LE0A 1CQZA 2ZI3A 4DDHA 4BLQA 4JLOA 3KZ1E 3FNGA 1L6IA 3P2IA 4QEDA 2XB4A 1XYYA 3Q3VA 1P5JA 3CBGA 2NVWA 4IPTA 3ZDFA 4F4UA 3NUQA 3IURA 2W6QA 5JI3E 5K0GA 2VF8A 3LP6A 2CV0A 1SUEA 1Z4PX 3AZQA 3JAMA 4G5XA 4JN6B 2WP8J 4Y9RA 3UCFA 1JFVA 5JS6A 5DHUA 1N6HA 1J8YF 3V1YA 2AFIB 3Q0IA 1G9TA 1RQLA 3FIJA 1PW7A 3DM5A 1PJBA 2Q3HA 4K2AA 4BQSA 2R84A 1NW7A 1X7GA 3MPOA 4R1NA 1K6IA 1GGFA 1SB9A 1L5LA 1QRSA 5K8UA 3I9V6 4DEYA 4A36A 2P1ZA 2A9VA 1XMSA 3NONA 3OHMA 3JWIA 4YB8A 1Y5IA 2MSKA 4AK9A 1C1XA 4DCNA 2YWCA 1IB6A 5I45A 4BFZA 4YUZA 4A8TA 1WDKA 5TVKA 4IXDA 1CUZA 4DNXA 1DPGA 5ER6A 1N5KA 1W29A 2JGNA 1E4VA 1Y6QA 1CY8A 5EIHA 3C6XA 5ALHA 3RD5A 2CWWA 2IUFA 3PTLA 1AKWA 5JO9A 2NTNA 3OX2A 4UEJA 2HX1A 2ONKA 3FDZA 4GE0A 4ZA2A 1II8B 1M6NA 1Z16A 2ZM6B 4PBRA 2C7PA 3H97A 4LJ9A 1VJGA 4BQOA 1QGAA 4R0NA 3D7KA 2PH5A 3E35A 2HSWA 1F2UB 3PYMA 4KN5A 2P5YA 4CEJA 2W8ZA 1W4ZA 3MLEA 4IOJA 2J1LA 1LBSA 4CV0A 4Y6GB 4WKNA 2HZBA 4AQDA 4HGQA 2HXGA 3RKUA 1GLGA 3OM0A 2FPMA 3HFRA 1U0HC 3IC5A 4BO3A 1IZ9A 3K8ZA 4K26A 4CL3A 4FT4A 3ZW9A 2GPSA 1IQRA 1JKMA 2BELA 3P2OA 2FPRA 4L72A 3U40A 3ZY2A 1O3YA 1ZJWA 3M1IA 3H16A 3SFVA 2KI5A 2A1TR 2ZB4A 4MUYA 4PQGA 4HAWA 4OREX 4P7GA 2G0TA 4RTMA 3ESDA 4Q9AA 3ZWDA 5BWMA 1NDQA 3WDMA 3THYB 1PZGA 3QKSA 2Z09A 3FH0A 6Q21A 5JYEA 2DHQA 5EEGA 3ESYA 4P4LA 4W7SA 4WN9A 4ZTBA 1S2DA 2CJWA 5ALGA 4IVRA 2WWTA 3SZRA 4DQVA 5JPCA 3LGAA 4RTSA 3P0JA 3AEUA 5EWJB 4B3XA 2HSEA 2PL1A 2GN6A 5TE9A 2QUAA 5F64A 4IKOA 3UW3A 5M5BA 1E9SA 5GMOA 2Y1GA 5E1DA 1W5SA 1S5PA 1Y5NA 5I4BA 2GEFA 4W6ZA 2OBNA 4U00A 4GLJA 3OIFA 2ZTHA 5L40A 4A0FA 2JLXA 2G77B 1E9BA 1F51E 4RMHA 1EE9A 3KLPX 2PWPA 2K4MA 1LXCA 3WLFA 5BRAA 1TVKA 1Z8NA 3E7WA 5D85A 2AG1A 3EXEB 3EUFA 4FYXA 1QHEA 3PNOA 1OWLA 4XDHA 2XEDA 3KDAA 3P0EA 4GRIA 1ZJ6A 5IC5A 3A9CA 1N2IA 6AT1A 5J58A 1NG9A 5F2NA 1U3FA 1MUUA 1DSSG 1GLVA 4H7DA 5EGNA 5T8KA 1F8GA 1FXUA 2QR5A 1QHHA 2AWOA 4YR7A 2JLUA 1TDJA 5E3JA 5LQUA 2LP4Y 3WYGA 5DSTA 3L18A 4QGFA 2OILA 2WJYA 2HPZA 1M1UA 1YNSA 2JAXA 3KXDA 4M88A 2QLLA 2X9QA 3CJTA 2CLCX 2QUZA 2ZI7A 2P2CA 2Y2UA 3QP9A 3WL4A 1TYCA 2BKEA 4OXNA 4LV6A 1CXZA 2JA2A 4LMRA 4MPRA 4NBSA 1OX4A 3L8DA 1KPIA 1T9AA 2HC9A 2P5SA 5LA6B 2FE1A 2XMQA 1SKQA 1YC2A 4JP5A 3KZNA 5A7GA 4O25A 3YASA 2F55A 2Q5HA 4IZ6A 3AG5A 5L53A 3V4RA 2Q07A 2ZB7A 5EN4A 3VDRA 4AURA 5IUNC 1XDUA 5A1TA 4B7CA 1AV6A 2W2KA 4U0JA 9ABPA 3WMEA 4D97A 1JG3A 5TC4A 1AMNA 4GMKA 2AEMA 4L0MA 1UJ6A 2WBLC 1FVHA 2VP9A 2XVAA 4RQTA 1NVDA 3VJLA 5JS8A 3E9RA 3TVTA 2AYYA 2HRZA 1U7UA 3CHYA 3VBEA 1F8YA 2LPMA 1VCHA 3BFPA 3CKLA 3IJRA 3FNEA 4JUFA 2EKPA 4BO2A 3D1VA 4MLZA 3THXA 1U5CA 4V24A 5EUBA 2HWUA 1YE8A 4KKXB 2GJ4A 2WFLA 4XXHA 4IW3B 2LIVA 1XZKA 4J0IA 1M7GA 2X40A 1IM5A 1EUQA 3NYWA 3RBXA 3GJQA 4UAJA 2VUHB 8ATCA 2YYSA 4FGZA 1N0IA 4N03A 1IULA 1KOGA 4EARA 3EIFA 1OI2A 1TT7A 2H1FA 1VSQA 1PZXA 4FX5A 5E2IA 5IYZB 5KJEA 4ND8A 4RTPA 2OSBA 1JE1A 2ZAIA 5J5AA 5JMOA 1SVNA 4M22A 3OM1A 2VSOA 2PX2A 1AHHA 2J3MA 4NI5A 2C7QA 2FOIA 2R8EA 3LUPA 1THTA 4Q1AA 4MRAA 1BE0A 2B2NA 3IUEA 2YYAA 4EY3A 1VL8A 2LWIA 2P75A 2EG9A 3C85A 4J1TC 2JLCA 4ZV7A 4CM8A 4HTAA 5GY7A 1DKMA 3GWGA 3QE4A 4YRDA 4B83A 4A10A 4AZ0A 1M5RA 3GROA 1UKYA 2C99A 2QSJA 2YFYA 4RGYA 1SXJD 4YN3A 2XTAA 4YRKA 3BAZA 3WLTA 3ZGNA 2H4XA 3DXFA 3FHOA 4G63A 4JBIA 1ILEA 2DFKB 5IUJC 3MWLA 4HWPA 3N0VA 3H99A 2VRNA 3WOVA 2HEIA 1JJIA 2Y66A 2Q6IA 4N6NA 7YASA 2OCBA 4KHZA 1W30A 5DI3B 4C5BA 1TZKA 3ULKA 5JU6A 2C59A 4RCVA 1XMVA 3GPCA 4IMJB 3HM9A 2I87A 1NNEA 3RS5A 2X9NA 2YFHA 5I9IA 2FW8A 3AONB 4Q4JA 2RKBA 3OQPA 4E3ZA 1UJBA 3AT1A 1TTPB 1ZICA 1NP6A 1QC5A 4BMCA 3ND7A 1QZ3A 1R6AA 1Y4AE 4EGQA 5AFSA 2XHEA 2FA9A 2IX9A 1GPWB 1VLHA 3DWEX 4H27A 4LC9A 4Q1VA 3LVFO 1RIIA 3GG2A 2B0JA 2ZSEA 4AG3A 4ZKDA 1NVTA 3U7JA 1YSCA 1CG6A 4BQPA 4ND3A 1XLUA 1EFLA 1L7NA 4YWJA 3ZCRA 2BH9A 2R00A 2DWPA 4XLTA 4EQ6B 1H2ZA 5ALRA 3EIUA 2VSQA 3WQHA 2V7PA 3NEPX 3PDCA 4OK3A 2WUFA 3SSNA 3B6KA 2J5KA 3FSGA 2QAIA 2Y1OA 1X77A 4F2DA 1VHLA 1VIDA 4NH4A 3A05A 1A69A 3CZAA 4FZ5A 2ZQ5A 1WB9A 5JARA 1FS4A 1IM2A 2X0RA 3W8RA 3OZVA 2PG3A 2OP1A 1G7RA 1KNXA 3LQFA 4DAOA 2ZJAA 3Q1LA 4H6PA 4MOWA 2JK1A 4ZU6X 4JUBA 1U0NA 4OI4A 1NXOA 1MGOA 4F06A 5HXAA 3TUZC 1NF2A 4BLSA 3TRHA 1C30B 1BFDA 4L27A 3UK6A 1IFXA 4NH0A 4URZR 4BLTA 1AX9A 1P1HA 1U0FA 1BFKA 2XD9A 2ZQZA 2WPDA 3DDUA 4R2LA 4NCAA 4MV8A 2P0EA 4QIHA 1JXQA 1VXRA 2FDCA 4IICA 1TMYA 5K8VA 2V7QD 1G60A 1UIMA 1VQ1A 5CVUA 1FNCA 2ZJ3A 2VQ3A 1TT5A 2HB6A 2Y1CA 4QPJC 4K9PA 5DM4A 5FADA 1C9YA 1UIRA 3PQEA 3B3FA 4YA6A 5FHQA 3TPFA 4CR8A 2ZAOA 1AB5A 2QTZA 4MCJA 4AP9A 2E5FA 5JO0A 5FL7A 4F9TA 1PGOA 1TZJA 4XFDA 1LK7A 2B99A 5IWCA 1W94A 3CRNA 2FSHA 2IXGA 3HUDA 3O73A 1SVLA 2GCPA 3DFFA 1GZ3A 2H1RA 5CM2Z 3UT5B 3ZNPA 1B0ZA 1MNQA 1B6SA 1ES9A 1QDUA 1T5OA 2HH9A 4EHJA 4F3TA 1AGYA 4HQKA 1TAGA 3K5HA 3PI6A 4UVHA 5BQXA 3IQIX 1FP7A 2ZK7A 3I92A 2XRFA 3M7IA 4P5EA 3CEMA 3UVEA 3C1AA 2I6FA 3W2IA 1KI2A 2KPOA 6PFKA 4PU0A 1PJ8A 5CJ2A 1NX6A 1TRHA 1C14A 2IZ0A 2NU6A 2IHTA 3Q72A 4ESEA 2J67A 1ORWA 4J3JA 2WDZA 4D43A 4B45A 4JEHA 3DTVA 4CBVA 4IJQA 1XNRB 1YZYA 4PCUA 5DN6D 2MMGA 2WE8A 3K8QA 4OGFA 1DEOA 2G9VA 4RFSA 4X6LA 2O5VA 3OCUA 4PR3A 5CUQA 4DLZA 5I7HA 3D7MA 3L8EA 1F0KA 4MEBA 1Z0UA 3CVOA 1DWPA 4E13A 5KREA 2VCEA 2DBYA 4YROA 5BUCA 3FBGA 4FD2A 4RFLA 4AWBA 3MD0A 3DDOA 2AA3A 3U31A 3CVJA 3B78A 1JG4A 1OT5A 2IZ6A 3M89A 3ZD9A 5ITVA 1J5XA 1ZYUA 2P90A 4D4MA 3JYOA 3RYIB 4YONB 3PX7A 2GBGA 2FXVA 3KQTA 4JVLA 5SZHB 4A2PA 1F20A 4BVLA 2EGUA 3GT0A 1WDLA 1YVPA 2ACWA 2P9TA 4P7BA 5KYYB 1VLVA 1CRPA 2VYNA 2QSUA 1GL9B 1U6KA 3ODPA 2WIFA 1NVGA 3OEHA 4XWTA 4DR5B 1QX3A 2Q4TA 3BGSA 4TL9A 1P73A 2JKZA 4GSYA 5J1TB 2FSIA 2GZ2A 1E18A 3PC6A 4IIEA 1XZFA 2DE0X 1SURA 2BE9A 3QVGA 4MRNA 1CE8B 3R74A 3LZ6A 1OFGA 2XMDA 3FDFA 1IVSA 3KSMA 2FR0A 2YWHA 4QG3A 4X94A 4EUKA 1KOJA 3FLMA 4G3XA 5CEJA 1DTSA 3AU8A 3QXCA 2AN3A 4KI7A 4ENTA 2CF6A 3K9FC 4QTXA 1XYVA 3PFCA 5A4AA 2FRDA 2OV6A 1EHCA 2V7TA 2ZTUA 1VG8A 1APBA 3KSDO 4E2FA 4F2PA 1NTOA 1WCV1 1AGNA 4R1OA 2YHSA 3HB1A 4XWOA 1AD2A 3G0OA 4MWZA 5FTWA 3LSYA 1PN3A 1PS0A 1YR9A 3M6FA 4XQCA 2IP2A 3JQEA 1E7RA 1EDEA 1X1TA 1E77A 1RLTA 3H7AA 2I8AA 1T0IA 4WLNA 5J4KA 2HA5A 2G8NA 1KRWA 4RV4A 4KLZA 4DABA 3NORA 4RABA 1O03A 4J4HA 4NAVA 4WXMA 3FGPA 1WX1A 3PUKA 1I80A 3HFGA 1VPEA 1W47A 2PLAA 2QOEA 5DBIA 5B1DA 1BEUB 2WF5A 1V7ZA 3NKLA 3V32A 3A7EA 5LQSA 2OBFA 2WDPA 2JJMA 4WNAA 3HM2A 2AJDA 3DYBA 1YI8A 2GPYA 2OV8A 4TROA 1LTHR 5ARCA 4QOJA 5LQJA 2ZU6A 3K5PA 4G5SA 1XDDA 4V39A 1AF4A 4Y9SA 4MR8A 4Z54A 3IL2A 1F7UA 4CMEA 3IPAA 2FOXA 2YVQA 2IK8A 1JAXA 4QXAA 4BVHA 2IYXA 2J07A 2QVGA 1GTL1 1HLFA 221PA 3C41J 3GRPA 3IDAA 3AFGA 3FNQA 3ZWCA 3DAOA 2XE6A 3HYLA 3R5KA 4RVGA 1ZD5A 5BN3B 2EJBA 5KIAA 4G01B 1GFSA 1HV8A 3BQNB 2FVXA 1AKTA 3LQQA 2QDKA 4KR6A 1SBIA 1Z82A 1DAFA 4R9RA 3ZIAA 5C5EA 5CITA 3L49A 2VK8A 4DM4A 3BEOA 1ZNYA 4YUYA 3BGVA 3RVLA 3CNHA 4UM5A 5LQAA 2Q7OE 3MPUA 1U28C 2QPAA 1BDJA 3MUFA 3DVAA 1WZUA 3Q9UA 4OQZA 4P98A 1P6XA 2IYNA 1IMJA 5F5NA 2G9ZA 2FJ0A 3N76A 2R4UA 3VR5H 1I7NA 2GJSA 3QOFA 1BYUA 4OHZA 3WBFA 4B84A 2WYVA 3BTVA 2FJPA 3EZ6A 2E48A 2HRDA 5J2TF 1HMYA 3HJHA 2PZFA 1VKOA 4NONA 4LRTB 4EUFA 2QX9A 4XPZA 2CXHA 4E2XA 1AOXA 1KI6B 1Y3DE 4U4AA 5CT5A 2QTBA 4TT3A 4DCTA 4EO7A 4MITA 1IL0A 4NCKA 3M4YA 2EFDB 2DJIA 2YJTD 2EW2A 5T57A 4E5UA 1IN7A 1BSVA 4JGIA 1FRFS 4M37A 1B42A 3OF5A 4QWWA 1KDTA 1NBHA 2V4UA 1ZM3A 5KTNA 3R3YA 3W7VA 2GJAA 5JT1A 2WUDA 2BVNA 4P5DA 1KY2A 1XD9A 2R6JA 1P2GA 4L0CA 1Z7BA 1TD1A 5CK5A 1F48A 4JBHA 2DKNA 4RPLA 2CNKA 3ND6A 3DF9A 1QB8A 5G1OA 4MWSA 1A95A 2ZZMA 3N2LA 3NIBA 3O9VA 3HKCB 3F74A 2V59A 4GM0A 5KAMA 3EOBI 2XTNA 4M7PA 3U4IA 2NU9B 3DAHA 3AHIA 4FR2A 5FFFA 2OZVA 4YC7A 2AN9A 3AJRA 4KWCA 4Y6SA 3R75A 3ZQJA 1QCZA 3ITKA 4I08A 2R66A 3KT0A 1NQAO 3HRIA 4OV6B 5CK4A 4RLHA 4GUAA 2CLLB 3IJ5A 2PX5A 2R25B 3EW9A 4R2HA 3BREA 5D3MA 2CMGA 1N77A 3S70A 5CA0A 3VR3D 1Y3CE 3I04A 1BXGA 1YE3A 2PL3A 3FTEA 3K05A 1B7GO 1NI4A 1SBZA 1AQIA 2WKQA 2ZBRA 1GT6A 2EW1A 2FN3A 3CUTA 3QEJA 3STXA 3I6QA 4JJGA 2RK6A 1M2NA 4JBGA 1FF9A 3LA6A 1J21A 2PKWA 4D4KA 5G0TA 2I1QA 3AYZB 1D6MA 2LUOA 4Q1DA 2ZI5A 1KEKA 4UM9D 4K1LA 3C3DA 1LH0A 3IMCA 5LB2A 4ZOQI 1NXQA 5HQJA 1MKYA 3GNTA 3NFYA 4HEJA 1ISHA 3O6VA 3PNLA 4IWNA 4JR2A 1QQ7A 4K05A 1PGJA 5M04A 1FW6A 1O94C 2R7NA 4FK8A 1TRKA 2I6GA 3HYCA 5KOJA 3ZZMA 1MAAA 3VR2A 1ICIA 3N07A 2ZE6A 1RXSA 3SYLA 2BRUC 3P4YA 3IQGX 4JKIA 1UAGA 4YQZA 4WW0A 1L7PA 2J0EA 5C1BA 1X6VA 2ZWIA 1ICEA 1T9HA 5JZMA 4WWHA 2X42A 3O4HA 3TR6A 2QD2A 3PT5A 3TW0A 3L1UA 3NW9A 4NVRA 3UY4A 3WLHA 3FB1A 3PQ2A 3VSDA 5FYDA 4Q3LA 4Z51A 5B1YA 1QP8A 3W8FA 2O1WA 1P1RA 1MX1A 3QI2A 5LL6P 2C5FA 3WADA 1EFVB 3THWB 2JIOA 3K6KA 3DYVA 2OYCA 3MCUA 5BQPA 1FVXA 4NY1A 3PXGA 2HK7A 4B2PA 3DXZA 3HP4A 3NNNA 1RCFA 4LOAA 1PJQA 2A3RA 3N1UA 2R9VA 4N49A 3TGWA 1G21B 4O1MA 4EG7A 3V7NA 5JXIA 4X20B 3WGIA 3QFRA 1OZFA 4O4HB 2FQWA 1V6SA 1XMIA 2PRYA 2HK9A 3ABSB 3ETLA 3IUBA 4BVFA 2GILA 4GX2A 3CURA 2PN1A 2ZBFA 1RYFA 2KLBA 3FZEA 2CDAA 1GAEO 1ZD4A 1RAIA 4BWFB 4F5WA 1E1YA 4EZEA 3I5MA 1RKQA 2IIVA 3SS9X 2JARA 4MIKA 3ZGLA 3AY6A 4KR0A 4NZ9A 2OOSA 3AUSA 4QLOA 3NU1A 3QLEA 4O4HF 4K6MA 4C6TA 2JFVA 5KVCA 1YGPA 5EJ7A 4IZHA 3ZDZB 1VYHA 2F8MA 3RFCA 3VDMA 2C7VA 2RHLA 4HWOA 3RFUA 1RRCA 5JNWA 2C2YA 3F9RA 3FTNA 1H22A 4JB0A 3K6SA 3GMSA 3A6FA 1CY7A 1O96B 1BROA 4GPTA 4CQLA 2ZS9A 4U7TB 1CS0B 1L8XA 2EHDA 1L7DA 1TO2E 3L6RA 3NHWA 2Y67A 2HU5A 4L5IA 3TZCA 3PXAA 5DLEA 5ADHA 3O95A 1GGMA 3PQCA 2H17A 1CHNA 3TAHA 1KFBB 2Q5EA 1T43A 4Q9IA 3OZIA 1N1MA 3DV0B 1PQWA 1OXVA 1DKQA 2YRWA 3KIPA 4B0PA 4DJFC 1T24A 5ITWA 3JVDA 1WXHA 2NWQA 1FK8A 4Q9HA 5J59A 5BRNA 4CUJA 1LW6E 1RADA 2DFDA 2PEYA 2H11A 5JQGA 3FUUA 1HT0A 1FFHA 3UB2A 2NVOA 2X0DA 3SS7X 3WV5A 3BIWA 4MQMA 1NMEA 3TOCA 2BMVA 3EWNA 4RXUA 3T1TA 2HMTA 3ZXUB 3K53A 1R5OA 1JQ5A 2B4TO 5CA1B 3NXKA 2CB9A 4HDRB 5DHFA 4Z7QB 4PLYA 4PZPA 2XB9A 4S0XA 1NE2A 2FV8A 2BFDB 1AK2A 4W8OA 1DOZA 4G2TA 3WSWA 4O3MA 3HKEB 1FFGA 1XLWA 3GFTA 3JQBA 3Q85A 5BWNA 4I4TA 3AVQA 1VPTA 2PM8A 3WIOA 3ROZA 3DDCA 3TEFA 1SQ5A 2XWBF 1STOA 1LBHA 4O63O 1GG9A 1HLGA 1ZEMA 2C03A 4BO8A 2V7XA 3VDQA 3AHHA 1D1TA 3TECE 3NDBB 1AH2A 3ROTA 3G49A 2YV1A 1GPBA 1WUHS 1JGTA 3IKTA 3LAWA 1RHJA 5F21A 2B5OA 3HV2A 1J5PA 2IDMA 1D4OA 1JI0A 3PUYA 2IKSA 5EPUA 4LOLA 2P9ZA 3GZNA 3B1VA 3FDXA 3AMVA 4LI0A 3UB3A 1ZOOA 1Z88A 2HA2A 2VXYA 3CF0A 1FXSA 2OFWA 3KLOA 4OEHA 3VNAA 3TMKA 4CI0B 4MIOA 1O97C 1OXKB 2O20A 1C7QA 1L8LA 3E3LA 3KZMA 2WSMA 3LE8A 4FMDB 3KTAA 4XAQA 1GARA 4YP0A 4LJ7A 3UWDA 1F8FA 3UKOA 1GDTA 4QUHA 2CZGA 3T1QA 3NP9A 3J80A 1QP7A 1TCVA 5IW8A 3KVYA 1ZZGA 4XVRA 1C8VB 1F14A 1BW9B 1IYZA 3EVAA 3LYLA 3NHSA 1O9HA 3QBEA 4PCAA 4YRAA 1XCMA 1TKRA 4ER3A 1G7SA 5DM1A 1RVDA 4CMIA 1R4AA 1Z4OA 3GLQA 5K3OA 2QGFA 5KNCA 2R4QA 1I2DA 4HLNA 1KEUA 1Y6RA 3GL9A 2OO5A 4GQBA 4JHXA 4C5AA 3LY8A 3SY8A 1LQUA 1DJMA 3UMBA 1SIUA 5JXGA 1EVKA 9ATCA 1N9ZA 2HADA 2ZT7A 2ZVPX 3GLHB 3IH5A 1GZ4A 4DNQA 5GZ1A 2VAMA 2ICAA 2QAGB 4BLWA 3EC7A 1P2DA 4FX2A 4KQJA 4OL0A 1XK6A 3QLTA 5HJ7A 1N33B 2X7XA 3HKBB 4D44A 3AI7A 3NRBA 3C3CA 4JLNA 3LDFA 5AW1A 2FWIA 4KE6A 3ZGVA 3FY4A 3L4BA 4KQMA 1FLVA 2PO7A 1Q22A 3B85A 1ULBA 4LZOA 4KUGA 3HXTA 2XUPA 4Y18A 1OLXA 5ILOA 3T7KA 2DUUA 2VSXA 1QZXA 1ZIOA 3FNRA 2WTNA 2OHIA 1QGDA 4XASA 3OC0A 2QG6A 4B6JA 2HBZA 4O5OA 3WSVA 2QN2A 2GQ0A 3RH0A 3LECA 4LZAA 1NOKA 3HJGA 2HK8A 3LHIA 3HJNA 4YRIA 1USVA 2P41A 1D6SA 1PJCA 1SGWA 1VKHA 2IUUA 2REQA 1Z4QA 5K4GA 1DBRA 3E18A 1WLSA 4MO9A 4QYSA 2OD9A 4S04A 1Z22A 4HXEB 5CVJA 3AFMA 1TW3A 3EPLA 3QFHA 4ZAFA 4YYZA 1E5VA 2GK4A 1M8JA 3IVAA 4BX9A 4IFEA 4QFCA 2RKWA 4NBRA 2QVYX 4Y2VA 2OQ2A 2C2BA 4RMJA 5HR5A 1V41E 4C43A 3UWPA 3L0PA 4HYYA 1ID1A 4L02A 3F8SA 4UC0A 3QQ5A 1EGAA 3QSYA 5BNWA 3EF3A 3W3AH 1SR8A 1YKSA 1P1JA 1SUFA 2FPLA 4KFSA 4BATA 1D8TA 3SF0A 5FAKA 5ALOA 5JSQA 2C9YA 3ZCUA 1KXZA 1WV1A 1U8FO 1YL5A 1QMGA 1UR5A 1EGMB 2ZYHA 3LLVA 3EVTA 1Z6XA 3KJEA 4HYQA 1Z4LA 2MSWA 3NAQA 4JQYA 4JNKA 3SJ7A 1PWHA 1ZXLA 1O8CA 1UJ5A 3HUFA 2OZEA 2CMKA 2QTMA 4KV7A 4MHSA 4O08A 2GDZA 1BNCA 3GT4A 3L04A 4OI1A 4Q3EA 5CD1A 3PUZA 2HSGA 1T6ZA 4AJ4A 3HV0A 3NLLA 5FI1B 1OY1A 1Y63A 4TTTS 4K28A 1WNTA 1PK7A 1RZUA 1SVIA 2E4WA 1ZRMA 3HMKA 3UPDA 2VP3A 2JVKA 2JVIA 4WMLA 1X92A 1U2SA 5AJVB 2B6NA 1U8UA 1IXYA 3E48A 2V7WA 1XHLA 4KMSA 5M3BA 1IAVA 5C52B 2AVDA 5JNVA 4OGKA 1B76A 4MDHA 4K6FA 1MU0A 1XD2A 4J2HA 4ZZIA 2JFYA 5B2ZA 3RNLA 5E8RA 4ZTZB 4N7RA 1FP1D 4LISA 2R6CA 2P8SA 4R1SA 4O2AF 1EM6A 3I3SR 3GA0A 2CSXA 1YAHA 4JY7A 5FNZA 2D1TA 3GBPA 4YMHA 4OQNA 4RDXA 3LUKA 1G5PA 1NN1A 3GUZA 2WV7A 3ZXIA 4KAJA 1M34A 1ZN9A 1S6YA 1VLMA 1ENZA 2EARA 3CFYA 4JIGA 2PXAA 2BEVB 1JLMA 1C1HA 1J33A 2VPPA 2YX1A 3GFQA 1FNDA 3DZKA 3GWZA 3JVUA 3WGHA 2VSFA 4LVCA 5KDLA 1R0RE 3T7RA 5JOQA 4A1OA 3OQ6A 1R9JA 5BSGA 4GLOA 5C8VA 2UZ3A 3DF7A 3JALA 1LU9A 2QMYA 1EIWA 3AKZA 5BMOA 2REBA 2WU0A 4YXWD 1BH2A 2YMPA 1WQ4A 3JTEA 3A26A 1L9XA 3DHEA 4LW8A 4M87A 4US1R 5IM5A 3TMAA 2IYRA 1PZFA 4Q4DA 5ANRB 2X0NA 2Y1XA 4J90A 1UADA 4FGWA 3GCWA 4M46A 1WMBA 3SSOA 5A62A 1M8GA 1Q2XA 3V1LA 4GMXA 1A5SB 1KF0A 2ODBA 3PEVA 3KVNA 2IX3A 1NHWA 5FT9A 1U7TA 3WKEA 1ATIA 1HE8B 4LG1A 3V34A 2EKQA 4Y3UA 1FLDA 1N6KA 5DX0A 1QBKC 4IIVA 3L8MA 1XFAA 4PANA 1O2DA 3BE6A 5CB4B 4H0FA 3PA8A 1T4GA 3QKUA 4NPCA 4RSMA 3OU7A 4IGIA 1ZHOA 3W6PA 3WWCA 2H8KA 2Y9MB 3U0BA 3JU3A 1AS0A 1LLDA 3F71A 3LUJA 2GJKA 3MAJA 2X7JA 4UZFA 5DBGA 5T41A 1U2DA 3TD6A 3IVRA 4QOFA 4CLRB 1MC1A 4Q37A 5CVVA 1GU1A 2IPMA 3AHFA 3LHFA 3QXJA 2QA5A 5BYJA 3NBQA 1Q0SA 2J59A 3MJRA 1G20B 2CFCA 2GAOA 2H9IA 2VYVD 3EUWA 1ZRSA 3IAUA 1H2AS 2W2NA 4Q19A 5D8DA 1XWWA 3K7EA 5I5EA 3C87A 2Y3IA 3GVPA 1DJPA 1ZJJA 4IIJB 5EWMB 1H4QA 3CH4B 3G2PA 1YB7A 4P3YA 3EDQA 5IJAA 2QAGC 2Z4SA 2YN4A 4E15A 1SCQA 4IO0A 1NNSA 2ZS7A 1JFRA 4ZVRA 2PGJA 2WU3A 4WESB 4P0QB 1U1GA 1E1QD 1QDLB 2ETXA 2O2GA 3FOWA 5HBGA 2JAWA 5CDFA 4IIJF 1SQ6A 1I51A 1NNI1 3JQ9A 3OAAA 2CDCA 2WE7A 2Z43A 1HE2A 1PYGA 2QT9A 4NBVA 2RHCA 2QRMA 3OO1A 2PZJA 2C4TA 2X6QA 3IMEA 3MCWA 3U2QA 4BO5A 2IHNA 5F33A 4V0KA 3R7DA 1IONA 3DE4X 1NW4A 1Q84A 3G2KA 4G81A 2YS6A 4MP6A 3OIWA 4ACAA 3LF2A 4C21A 3Q5EA 4P4SB 2D0DA 2X3UA 5HQ3A 1R6VA 3DBRB 4ZQGA 5BR7A 3ZGOA 1VE5A 3URKA 3UXHA 5AW2A 3PF8A 5CNJA 3NPAA 2AOUA 2Q8PA 5KU1A 1CZOA 4X9XA 3FVQA 4TTVA 4NDAA 5F76A 2Q1TA 2NT4A 4DCUA 3U9SA 3F5DA 4UFPA 1QWSA 1FPMA 1SHLA 3M8KA 4RIEA 1Q21A 2DBQA 2GYYA 1I1HA 2A67A 2POCA 2QW8A 2XOXA 3DKKA 4FWBA 3BXOA 2HBRA 4H31A 2YIMA 3KYDB 5C8ZA 4A0RA 1RAGA 4DJ5X 4HNAA 1E4OA 4DPMA 4Z4CA 2DXIA 4BKQA 2XWQA 2H1SA 1H1LA 4OLJA 1EUDA 2I2CA 2EZ9A 1C1YA 2W22A 3L8YA 3KJXA 5EKUA 4ZCSA 4BNGA 5JC1A 1JEQA 3R40A 4DQDA 1QNLA 4UM8B 1TEXA 1VJ5A 5TF4A 4WZ6A 4E14A 2O3RA 2AI3A 5JBNA 5K6TA 1IN6A 4OM7A 3HVIA 4I3HA 4GLLA 3NH9A 2Q41A 3MJHA 4FCCA 4ZOLA 1UK7A 3F6EX 3O7WA 4Z9XA 2G0AA 1OH6A 3D64A 1P29A 1W2GA 1DGQA 3WMXA 4BMXA 1ZD8A 5JJ5A 4M2LA 1CR2A 1Y9AA 5FKJA 4P3OA 5T4FA 3BD9A 5F3WB 1CQPA 1HSZA 2IVZA 5BOSB 1C0LA 4ME6A 5L4NA 3LHDA 1UPFA 2WMDA 3BICA 3S8MA 3SZLA 5HP4A 3H0CA 1W4LA 4GGMX 3GBSA 1CF9A 3OKCA 4DCSA 3MWJA 3GA5A 4YCJA 1E8NA 1Q1GA 4XIGS 2F7SA 2W2LA 2VWGA 4S1TA 3V55A 4M8NE 3IP9A 1JXMA 3H5IA 4ML3A 1A82A 3DMYA 2YWEA 1M1YA 2R96A 5F73A 1QG4A 5DLYA 1S9DA 1R8SA 1TXGA 2JFOA 4MV3A 2M6KA 4C7BA 3BJEA 1FUUA 4CIYA 2C2WA 4OQQA 5TNXA 2ECPA 1I4TD 3RIGA 3D3NA 1VL5A 2JGFA 3FWZA 2NUTA 3TCNA 5AVZA 4O4IF 3M9LA 4B1FA 2EKDA 3CLKA 2ZRBA 3A0UA 4F4JA 5KOHA 4G0NA 2ZSHA 3H8VA 5EHZA 4TMXA 4V0ME 4B3JA 4QE3A 1YCHA 4ZT2A 5C2JB 3PJDA 4CQMA 3BB4A 3AGQA 1EXVA 1Q19A 2QUHA 2IH4A 3FZNA 5JSZB 2UUCB 4AC9A 3OMXA 3GLSA 5EMJA 2GBIA 1SXJC 4AS2A 5TMPA 2Y1FA 1TF5A 1YZGA 3KR0A 1OUMA 1C81A 2I71A 3IIIA 3OZCA 1QG2A 3AFOA 4ZO8A 1PV4A 4U2DA 3RWMB 5EE0A 4PRZA 3AVVA 5CDGA 3T5BA 1VL0A 1W4AA 4IVQA 3V4FA 2PWBA 1E9RA 3TNLA 3P0HA 1R27A 4ZKEA 2ECQA 2C3YA 4C0HA 3L6DA 2GFIA 2ORED 3DAYA 3T0FA 1OWPA 1HE3A 1TO1E 1VBFA 1K89A 1JPUA 3DDHA 4DLYA 4BUJA 1FP4B 2WICA 4FZRA 1A9OA 2KJQA 5E7QA 4LFBB 1VE3A 1QVZA 2J46A 1Q0HA 1Z8FA 1Z5NA 2H07A 3O8QB 4HEHA 3B7PA 5HMLA 5TRTA 2C04A 4JROA 4TV9B 1CC1S 5IN4A 3BH0A 4H7JA 1Z08A 5TF0A 4IHJF 1CK4A 1ZVJA 3BRCA 3HC7A 1H8ED 4TS1A 1BU8A 3A4NA 3ZX4A 3N3AC 3KPUA 5CURA 3EY4A 3EXG1 3DVSX 3EH1A 5KYGA 3BWYA 2VJOA 3CN7A 3EXHB 1NXTA 3MD9A 4H60A 4V1CA 3RYCA 1XLTA 3X1KA 1VGRA 2LTAA 4RPJA 2ECKA 1JSCA 1L8OA 2BKVA 3AESB 3NDRA 1ZLYA 4Q1FA 4DPKA 1XZGA 4LDPA 1XVIA 4R6WA 4YMSA 3O3NB 1ZGBA 3VUEA 2G67A 2OV2A 3E3MA 4FMBB 1BDBA 1YS6A 5B2EA 2FMUA 3HCDA 3UK0A 5I9NA 1I3LA 5CT9A 4L5JA 4TM8A 3W2TA