1SHJA

Caspase-7 in complex with dica allosteric inhibitor
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
247
structure length
208
Chain Sequence
b'TYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGARCKTLLEKPKLFFIQACRGTEPRYKIPVEADFLFAYSTVRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFKKQIPCVVSMLTKELYFSQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase-7
publication title Discovery of an allosteric site in the caspases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 68
structure length 208
sequence length 247
chains with identical sequence B
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2004-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1shjA00
4I1PA 2AR9A 2Y1LA 1QDUA 3SIPA 2J30A 4EHHA 4QU0A 4JJ7A 4AWAA 4QUDA 2XZDA 3K7EA 4HQRA 4N6OA 4N6NA 4QUIA 4ZVRA 5IBRA 2J31A 4IYRA 2CJYA 4PRYA 3H13A 4JB8A 4FGUA 5IAJA 4NOMA 4NOLA 1RWOA 2C2ZA 3EDQA 1K86A 3V6MA 2CJXA 5IANA 2HBRA 1GFWA 1RHRA 1I4EB 1ICEA 2XYPA 4PRZA 4ZVPA 3V55A 3D6FA 4FXOA 2XZTA 1SC1A 2CNOA 3GJSA 3OD5A 5IASA 3DEKA 3GJQA 4ZVSA 1QTNA 2C2OA 4EHNA 1M72A 1RHQA 2H4WA 3R6GA 3KJNA 4QU5A 5IC4A 3NR2A 2QLFA 2H48A 3GJRA 3KJFA 4JR2A 4QUJA 3D6MA 3H11B 1F9EA 1BMQA 4QU9A 5IABA 4I1RA 4NOKA 3SIRA 3RJMA 2QLBA 2Y0BA 1NMSA 5K20A 4IEFB 1SC4A 1NMQA 4M9RA 3V3KA 4HVAA 4QUGA 2H4YA 3NKFA 4JR1A 4JQZA 4JJ8A 5I9TA 4N5DA 4D3YA 2QLJA 1RHJA 4LSZA 4PS0A 3R6LA 1RWNA 2HBYA 3V4LA 1IBCA 1PYOA 4AWBA 2C2MA 3P4UA 4EHKA 2H51A 4PS1A 2QL9A 3H0EA 4JQYA 1RWPA 2QL7A 1RWWA 2CNNA 5JFTA 4DCJA 4QUAA 4D3ZA 3PD1A 2HBZA 3DEHA 4EJFA 1I3OA 2FQQA 2HBQA 4N6GA 5IAEA 1SC3A 1RHKA 3EDRA 3H11A 4HQ0A 4ZVTA 3PCXA 3R7SA 5IBCA 4FDLA 1PAUA 4QUEA 1I51A 4DCPA 4N7MA 4EHFA 2XYGA 2H5IA 3UO8B 1RWVA 2P2CA 3S8EA 4QUHA 4QULA 1K88A 2XYHA 4ZVOA 1RE1A 2NN3C 3V4OA 2H54A 5IAKA 3DEJA 3KJQA 1JXQA 2H5JA 4QTYA 2CDRA 3D6HA 3NS7A 3UOAB 4ZVQA 3S70A 1RWMA 2QL5A 1NMEA 2J32A 2CNKA 5LU8A 2FUNB 4EHDA 3R5JA 4JJEA 1SHJA 1I4OA 4NOJA 2DKOA 2FP3A 1GQFA 2H65A 3IBFA 5IAGA 5LUBA 3R7BA 3P45A 3ITNA 5LUAA 1CVRA 1CP3A 3GJTA 1F1JA 4QTXA 3QNWA 2C2KA 3PD0A 5H0IA 3R7NA 5IC6A 4DCOA 1QX3A 4JR0A 1RWXA 4ZVUA 3R5KA 2WDPA 5LU9A 2J33A 4QU8A 5IARA 5IBPA 1SHLA 1RHMA 4QUBA 4AW9A 1NW9B 2C1EA 4D3XA 4NBLA 4EHAA 4NBKA 3E4CA 1RWKA 3BIJA 3IBCA 2CNLA 3H1PA 4N7JA 1RHUA 3V6LA 2K7ZA 5I9BA 4EHLA 3DEIA 1KMCA 4NBNA 4FEAA
chains in the Genus database with same CATH superfamily
3TTUA 3DEZA 4JJ7A 3EZ6A 5J2UB 5HJ5A 1J25A 2D4AA 4D46A 1WUJS 1HE5A 4FFPA 4ZV7A 1IULA 5GOTA 3H2HA 1KJIA 1U02A 3OTGA 4KLZA 4P82A 4CMBA 3GRZA 3D4PA 4V1CI 1G6HA 4EJSB 3FOFC 3PIIA 1U63A 3H0CA 3PGKA 5ILGA 2KLHA 4XPIA 4N49A 2IC5A 3A6LA 4QXPA 1XQ9A 4RS4A 4M3NA 1PJRA 4PBTA 4XVRA 2IGTA 2G9UA 2Y1DA 1G9XA 3H19A 5HA5A 5KBYA 4LQ4A 1E9FA 2XXBA 1P7VA 4XJVA 3TKYA 5JXJA 2HD4A 1TIPA 4Q7EA 1C30A 5CR9A 1RI1A 2PU7A 3AR6A 3PSHA 4K1LA 1XNRB 2P90A 2QSYA 2F1KA 2NGRA 3DL4A 2AG6A 1CIJA 2Y93A 3KPJA 3FPFA 3ST7A 4XWWA 4HZGA 3W2HA 4DGQA 1ECJA 2X2EA 1HE8B 2VXYA 3FHJA 3PC7A 3EOZA 3TJRA 2IZZA 2X8WA 2F8SA 3LRXA 1XELA 3HY6A 1M2KA 1TMKA 3KP1A 1KJJA 3LCCA 4HVCA 3KQWA 2AK2A 3TLGB 2PR7A 4BV3A 1ZK2A 3ZZ0A 4N8DA 2ZFUA 1UBMS 3PJRA 2ORWA 1E6WA 3ZHXA 4HFJA 5TQ0A 1T2EA 4B80A 1MAAA 3OEEA 2HXGA 4OB8A 2ATVA 3SF0A 2UYCA 5IYZF 1KDTA 4BUCA 3MGAA 5HCIA 3T38A 1O5IA 2PT9A 4D4IA 3ED5A 1G9TA 4JHLA 4S2UA 1EWKA 3UAZA 5CA1B 1HR0B 1QGDA 1E3TA 1FOEB 2ORIA 1USVA 3ML1A 4N0PA 4WT7A 5IJAA 3TD6A 1ORWA 2HMUA 3A6DA 3QOFA 3AI3A 3WGMA 4LK2A 2YW9A 3ZWKA 3DEHA 4CM4B 3G9QA 1BVYF 1N1DA 3UUFA 4LOKA 1L4YA 4MUJA 2IY9A 4NQRA 3TUIC 3AINA 3NXKA 2P2GA 4D9IA 4D9JA 4S1PA 3UGJA 3NTRA 4MW9A 3MGGA 1KQ3A 4NI5A 1S1MA 1E7MA 2EEPA 4XGIA 1HNXB 3G2JA 4CQMB 4HDMA 3WMXA 1EFVA 1RPAA 3VSDA 3M81A 4CIYA 1SC9A 4DR2B 2HJVA 3KDPA 3P0FA 4JEHA 4ZV9A 3JASB 1K7YA 3F3MA 4ZDJA 4KPYA 5INTA 3S70A 3STYA 1EU1A 2Q07A 5IN5A 1OOEA 4Z54A 2HKIA 1P6UA 3D8RA 2H9AA 1PJ4A 1ZR2A 1PL7A 4TV9B 3GGDA 4OI2A 5C46F 1TYEB 3UUWA 2QRPA 4UM7A 2VAPA 4DQ0A 4XSVA 2WYVA 4ECEA 5ILOA 3CT4A 4O2BA 4OHXA 1EESA 1BJTA 1E6KA 1TC2A 1NUAA 5JAUA 4FUQA 2EX4A 4QBKA 5FOQA 1NPTO 3PQ2A 1E5TA 4P5PA 2NPFA 4K2HA 1P8AA 3L7CA 4BVAA 4F3YA 3A3NA 3NHWA 4N9WA 3MJRA 3LQRA 3PDHA 3TZLA 1XZPA 3AIIA 5BV1A 4L08A 1BGXT 2ZJ7A 2OV6A 3H2IA 3NP7A 1G3MA 3A2LA 2YL2A 2P1DA 1P1HA 1KH1A 4JLAA 5HOQA 1F17A 4ML3A 4ZRDA 4TLAA 1GGKA 4AM8A 3W8DA 2AC4A 3FHLA 2BMVA 2QEQA 4AWXA 1Z7EA 5EYPA 1RVV1 4KX5A 4L6CA 3R0XA 3T5BA 3W8EA 3LHKA 1TU4A 4Q3NA 4JELA 1N0IA 3BWDD 2QN2A 3L7OA 1ZM4A 2C2ZA 2UZIR 3B1VA 1V39A 1WHSB 2CL0X 2FV8A 3BL8A 2JFOA 3GNTA 4KVGA 4Q1DA 1TAQA 1EHIA 1I24A 2VWHA 4OJMX 3KS9A 3W9BA 2GYYA 4HK4A 4ZXPA 4DIOA 1Y3AA 1K6JA 4FFWA 1YL7A 1DAPA 2E4AA 4F96A 5E6SB 4ZZIA 3ZXIA 3OZWA 1AUVA 3QJYA 2IE8A 3JALB 4NAHA 3KR1A 3N7UA 3NIWA 4FR0A 4W6ZA 3AFNA 3IUSA 5JXGA 3TXYA 1XU9A 4PZAA 4C14A 1P1FA 2P27A 2I2WA 5FYDA 4EMUA 5IX8A 4JC4A 1TQDA 3C1UA 5HVNA 1EUDB 2R0QC 4DWJA 2C57A 4JP8A 2C4WA 1BDMA 1RCTE 1SXJE 2Z8ZA 1DC7A 3IOEA 4RNCA 1T9HA 5JSZB 1BX0A 1QLJA 5ARDA 2H06A 3KVNA 4HLUC 1R6DA 1X1DA 2RHWA 5KTRA 2M6LA 1FIUA 5ALSA 1OW3B 5IKXA 2R1VB 4B7AA 4W8GA 1K0FA 3B52X 3BMQB 3C3BA 1TJPB 4MV1A 1UFKA 2QP9X 2QLJA 3U5ZB 2VJBA 3IL2A 5LLSA 3FMIA 1X7YA 2HWUA 1QHYA 2MIIA 3IRUA 2QE6A 1OLUA 2JLZA 1Q7TA 3HCOA 5AM5A 3SOPA 3TW0A 5KOHB 4IJKA 2R79A 4FUTA 2G9NA 2F1IA 3MNFA 4ESEA 5AESA 3GZ4A 3A2KA 1H85A 1QYXA 3WR5A 3V1KA 2JKVA 1E8DA 1HSZA 1RQLA 2GHTA 4H77A 3UEOA 1CXZA 1J90A 1FNNA 1PNVA 3C3AA 4F3CA 4I6JA 2QM7A 5E38A 3AU9A 3JSAA 1EWTA 3BMNB 1U0FA 2W48A 1FNBA 4C03A 3BWYA 2IX9A 3ISJA 3OQOA 3VNQA 3KZNA 2H17A 3GEDA 1QHXA 1E61A 3A05A 3DV2A 3MJVA 1R0BA 3ZVLA 1WB9A 3HTXA 4DW8A 4BE7B 2P2CA 3EH2A 2JK1A 2QTVA 5IXSA 2DERA 2PD6A 4A6PA 5BQFA 1Q2UA 1XV5A 3ABSB 4EYSA 1PEDA 3RU3A 4II2A 4FR5A 4KPGA 5JO9A 2W43A 3R5JA 1SPXA 4DCUA 4M0CA 4EA7A 4IL5A 4BO3A 1QG4A 3FA2A 3QOYA 4KVAA 1J7JA 3KIPA 3F8SA 4OQDA 3HEBA 3WWEA 4CEJA 4J0HA 4Q6BA 4R2WA 1ZRNA 2FMFA 3AONB 1Z2DA 4MIEA 1FNMA 1YB6A 2JHGA 4RTSA 1KY4A 3OVMA 1W85A 3WNQA 4X3OA 1XIVA 1MFPA 3I4FA 4MRVA 1VKZA 2W83A 1IWPB 1KO5A 4HPWA 4UD6A 3V80A 3LO5A 2YWFA 3LUCA 4HDAA 4K9DA 2Y0DA 1N33B 2IYPA 4IDAA 1KFJB 5M7EA 3EIEA 3FETA 1ZU4A 4M8KA 5LB2A 1PJTA 2BMJA 3P94A 2NZJA 1C0EA 2ZYGA 3LYHA 1G8JA 3RLFA 1T9KA 1W6RA 1VPEA 1C8BA 1PJ2A 2HRRA 3DEAA 2Z5VA 1FLVA 2QZJA 2ACEA 2X0JA 1E98A 4NCBA 3DDCA 2WFAA 4TLMB 4F86A 2SKCA 3GJ8A 2WIGA 3I28A 3THXB 3UXYA 3NTXA 3X1XA 1QG2A 1Q5PA 3UWMA 3WGKA 3CW2A 1ZWLA 1OKKA 5KNCA 3NVDA 4G8JA 1MB3A 4C4OA 4FN5A 4WCDA 4RY8A 3FAZA 1TO6A 3ZR4B 3KKZA 5TIIA 2G36A 4GZMA 5I7RA 3VX3A 2HF8A 3R9WA 1Y7TA 2AGVA 5EOVA 5EXEA 4FXPA 4KQJA 4HH1A 4A2CA 1XZFA 3P0HA 4TSRA 1JTFA 1E3EA 2GESA 4XD7A 3ADBA 5DTQA 2FZEA 3R6GA 3ZE8A 3EPKA 3KFXA 2TMDA 1UDAA 1YCDA 4MH0R 5DBFA 1Z17A 1CUGA 1YUBA 3B36A 1EP9A 3GLGA 1DADA 1CQXA 1Q1NA 2NVWA 1VCNA 3OF5A 2YNMA 4G81A 2Z9CA 3T1VA 1E0KA 1XVLA 2O50A 2VZ9A 2XNHA 3QXCA 4F7DA 3LY9A 2NSYA 3WSVA 1NMQA 2A0WA 4WEQA 3QLUC 1U6JA 5BSWA 4IYJA 3RAPR 4OQLA 2ZK7A 4B32A 3GCGA 5I4IA 5CGZA 2VHVA 1DINA 4LXGA 4MKFA 2EL7A 2Q99A 2AE1A 3JV7A 3ZLUA 2I7TA 1DKMA 1F1BA 1XXHB 4LY3A 4P83A 5B2EA 3SX4A 4XGRA 3JRWA 4HRYA 2CEAA 4TWBA 1MO5A 4D6YA 1OGYA 2IYLD 4F4CA 2Q6TA 1WDKA 2VR1A 1JALA 2MSDB 3UAYA 2JLCA 2ZG6A 1XHEA 3AUFA 1JDNA 4N3GA 1NVTA 4PZ0A 5D8DA 3SM3A 4D7AA 4YRSA 5HMLA 4LV6A 1NXPA 1A9XB 2P1RA 1JYEA 1TMGE 1J8FA 1PNQA 2XDQB 3K0HA 4HGQA 4QO7A 2HSJA 2V5AA 4U9HS 4YP6A 5LKRA 1T5IA 3HUFA 3C24A 2O2XA 3HFSA 4KXUA 1JEDA 4GGMX 1HDIA 3ACCA 1YFKA 4TKUB 1YFZA 2R5WA 4UMFA 4UNQA 4QC2A 2W2KB 3KPUA 1FRFS 3AETA 3PUVA 3JS5A 4YRDA 3ZGOA 3HJHA 4G0PA 2YYYA 1EGQA 4B31A 3H04A 2XT6A 1DUIA 2FWJA 3ZWDA 2PS9A 3GFFA 2W2LD 2C4UA 4X1OA 5H5JA 3OIDA 3KETA 1AKYA 1V6SA 2B7CA 4WWHA 2R8RA 4CEIB 3FRHA 3C70A 5CLFA 2MSNA 3QXSA 2HCBA 4JT2A 4A6DA 5ESXA 4D4JA 1A8UA 1ZIPA 1W47A 1NLZA 2Z9DA 2NYVA 3KL2A 3OKAA 2PX8A 3Q7RA 3T7DA 2JGFA 4A6EA 1ZC3A 2B1GA 3QFRA 4HNAB 1KO1A 3Q8MA 4MB0A 4OBEA 3AR7A 3IT3A 3EXG2 4IIJB 3WGVA 4PINA 4G5GA 1IN5A 4PQRA 5GGYA 5E8RA 1SAYA 2C4NA 1T4CA 2C58A 5KOIA 2VI5A 3F47A 4ENSA 5IH3A 1Y8RB 1CULC 2J4FA 3RJ9A 2UUBB 4DCNA 421PA 5G1OA 3V6LA 2FEOA 2Y2UA 3NJ4A 3PWSA 4ZVNA 3RAGA 4M1SA 3ZWAA 3TI7A 1OD6A 3MG9A 4RA9A 5K3CA 4B09A 5I3ZA 4AO7A 2UU9B 5G02A 4N76A 1XP8A 2ZPAA 5CB4A 3EQ6A 2Q3EA 1VL2A 4Q0MA 1AC5A 3WYFA 4HNRA 1DEAA 1KVQA 2XF2A 3FPHA 3GDHA 2HHLA 1CQPA 1E1DA 2WB2A 4Z7OB 3IEKA 4HEHA 3RYFB 1ENOA 4AJPA 2VDOB 3EGOA 2VRCA 2H16A 4DUGA 4Q4HB 3EIUA 3NXSA 3IR6A 2BPOA 2J9ZB 4IHAA 5JNUA 3KBBA 4RY9A 1I5RA 4TKLA 4X93A 3D4IA 1XTKA 3RNLA 4QGFA 5JH7B 1SXJC 2R6CA 3IT1A 4V1CA 1EH5A 5IJWA 3ZJYA 1RHQA 2WWVD 3PPVA 2A5YB 1UPBA 3AVOA 2V7WA 1YB7A 3CLRC 3QKSA 5F1PA 2YVUA 3EC2A 1XRRA 1VSBA 3ZLTA 3MWJA 3OQMA 2ZT6A 4CHGA 2W2NA 5IABA 2UXBB 4YRFA 4NL4H 4A5OA 1JB9A 4QWWA 1XL0A 1R0LA 3F3SA 3PXGA 2JI9A 4PFQA 3ZIAA 4QVKA 1DQRA 1QFJA 1RLMA 3HJNA 2WNIA 4LY0A 4YGXB 2NXJA 3ZXYA 1FFWA 4M99A 2GPAA 3E9CA 3R24A 5EE3A 1OH5A 2I91A 4U2EA 1Y7HA 3GPBA 3CUEF 4O59O 3TS1A 3RRXA 4H7EA 4X91A 1TE2A 1DV2A 3DC2A 4LJYA 3HP1A 1RWNA 3SNKA 2YJ3A 3RR2A 1VPTA 1MT0A 1MDFA 1U0LA 1WMDA 2YHAA 3AJDA 5GGXA 1B6RA 3GDOA 3K72B 3PTLA 3UTCA 1QH8B 2IPOA 3B85A 4K6OA 4R2HA 1JAIA 4L3VA 4R9SA 2IDJA 1KYQA 4WNAB 2X9VA 1XMOB 1GAJA 3FNFA 3NHMA 3ON5A 1YMVA 4DLKA 2FDCA 4JV5B 1XTIA 4IQGA 3VR5D 4C0AC 5A7FA 3BWMA 2G72A 1H9AA 1TCAA 3F8TA 1QP7A 5DNUA 3IIKA 4UAUA 1N2IA 2VYNA 4F60A 1XTJA 2HGSA 2AOUB 2LIVA 3NORA 3HU5A 4KE9A 5E1DA 3STVA 2MINB 1XZNA 2QV7A 5ECYA 2WICA 3NBQA 1ZIYA 2ODPA 3GWZA 1RS0A 4ID9A 2ENWA 5DMXA 1VL8A 1EDDA 3RTEA 2WWFA 3PQCA 3CNQS 5FWNA 4IHJF 4OXYA 2P9GA 3K6RA 1F2VA 4D8WA 1TIBA 3B3AA 3VKUA 1I2MA 3ZE9A 3HPRA 1FYDA 1LDYA 1MOPA 2EFDB 2XWBF 2Z5GA 1WOYA 3FCAA 4UAJA 1UWLA 1JR3A 5IAGA 3AM3A 3HYRA 1MNAA 4NZZA 2RAVA 2Q5QA 3I01A 4QKQA 2VHJA 4OYRA 5GMOA 3A4IA 3F7MA 5TF4A 1RI2A 1CQWA 1N1MA 1ZVJA 1PJAA 4J7AA 2GZSA 4ECAA 3ZCXA 5I7FA 1AXEA 1N3YA 1SRRA 1RJ9B 1DRVA 4ZCMA 4OHBA 3AV0B 1HQKA 1YBAA 4BVHA 5JRZA 2ZYRA 4M1OA 1KE1A 5IJ9B 5AI5A 3AI1A 5T64A 3B60A 5LQRA 2IHUA 4B3GA 1PK7A 3JY6A 4IIGA 4EB6A 5D5HA 2XGOA 3ZQJA 4Z51A 3T61A 1PNRA 1PG2A 5ESDA 2WYIA 5DYWA 3T9EA 3BK7A 4X64B 2XMRA 2Y1LA 2FPSA 4G5RA 1PLKA 3DM5A 1DCFA 1U0GA 3O4FA 2B61A 4XXHA 2QQGA 4X84A 4KQHA 5DBIA 5K3AA 1BQEA 3RIHA 2IOHA 2PA0A 2XCIA 1B74A 2YJNA 3D0QA 3QVMA 1C9YA 4RV4A 4E33A 4OLAA 4LYAA 4MTLA 2VHTA 2IZOA 5EJ9A 1UM9A 3EVGA 3TVYA 1WPQA 4AYXA 2B78A 3TR5A 5JBIA 2GZAA 3NI2A 3CISA 3IIEA 3RC9A 5CXXA 1TF5A 5DE3A 3ZI4A 4RTQA 2J0VA 2H1SA 1KZYC 5BRNA 4WK6A 1Z6AA 1KA9H 3NTOA 5I7WA 3AWDA 3IP3A 5LWQA 1NNUA 3KJEA 3HZOA 3FH0A 2CK3A 5KOJA 3FBWA 1WDWB 5C31A 4D2IA 1H22A 2PSHA 3IT2A 1E79D 3O2JA 3GT4A 3R76A 2NXWA 2WD7A 2FB9A 3BFVA 5B1HA 1EXVA 4AQ7A 1BMQA 4PSKA 4BYMA 4JI2B 1V5EA 1CTQA 3HDGA 1KBZA 4YH1A 4R3NA 1O94A 1QORA 2BBOA 1SCUA 3IGFA 1YC2A 2NVOA 4WAUA 2PKXA 1ESDA 1DJNA 1ZL0A 3OZVA 4G56A 1QFXA 4F92B 1YDFA 1HLPA 2AI3A 1KMIY 3EA0A 4KQ1A 1XWWA 2QS9A 4MWOA 4Z9XA 1D2CA 4GF5A 2ZVJA 3UXEA 4IRXA 1JFSA 2ZBPA 3LP5A 3WDLA 3FTFA 3R3SA 1COWD 4RHXA 2RKWA 4Q02A 4WE3A 4XSHA 2O7RA 4BWVA 1TO1E 3HMKA 1E9CA 5BN5B 5CMLA 4TXNA 1T2AA 1V35A 4HNVA 1GSAA 4KWCA 1GV1A 3R3JA 1JXOA 2FETA 3U81A 2CHVA 2WABA 3LFHA 2FCAA 3FWKA 2E4ZA 3GQVA 1Q7EA 1W9HA 2CDBA 4W5JA 3CBQA 4C5CA 4QUAA 1LRJA 4RQUA 3AHFA 1SJ9A 3UICA 3GLFA 3TM4A 2W4QA 2RBKA 2TRSB 2NUPB 3WJ1A 4YCLA 1R66A 1RKBA 2B9VA 4CKZA 1SC3A 1OLXA 5L51A 2NZVG 1H0HA 4EH1A 3U7HB 1T0IA 1YBHA 3P2JA 1EB9A 3W6UA 4H3HB 4DBVO 3RBAA 2C84A 3WJAA 2CSXA 1JZTA 4QO8A 2XMQA 3K31A 4JLNA 4BEJA 3U44A 5FCDA 3DBVO 2BI4A 3G0DA 5FBWB 2CDRA 3CEJA 3O8QA 2TMKA 3E9EA 3T5MA 2K4MA 2VZEA 1G7RA 1EVEA 3MCVA 1Z5PA 4FNMA 1NMEA 4PBSA 2WTUA 3LZDA 1QIKA 4FFRA 1RYBA 2ISCA 2RI0A 3ADCA 3U7GA 5K3OA 1GCGA 2QD2A 3PS9A 1SCBA 2V3VA 2AFHA 3ZNOA 3UKOA 2I76A 4Z5XA 1DRUA 2PCLA 2YY5A 2HEIA 4BO0A 3NONA 2QRGA 3OTQA 3QI2A 3AEQA 3TOZA 4DTIA 1NVFA 3GMSA 4ZOAA 1MW8X 1HBJA 1UKZA 3MCZA 4DV0B 3O8CA 2P9YA 2UVPA 2F43A 5CLJA 1RCUA 3GR6A 1SHZA 4C6SA 3NHLA 2XX3A 4IKOA 1SQFA 3KUDA 3P9YA 1N5OX 3GRVA 4GDFA 4DA7A 4E5NA 5HCNA 1LRLA 4ZC8A 1W73A 2RHRA 3U4CA 4OIMA 1JIXA 4AYWA 3NHJA 1BO6A 2J31A 2NTEA 3OFNA 3QVOA 2YMMA 4HX9A 2XB8A 5BR1A 5JU6A 4P4TA 2JIOA 5J5AA 3A4YA 2PGNA 2PSJA 3A27A 3K5IA 1VL1A 4P22A 1MV5A 1AT1A 2BBWA 4FS8A 1TTTA 4KQ6A 3CONA 1TLLA 1M66A 4BFUA 2C7RA 2W5UA 1NLFA 5TVGA 2CNWD 1FLNA 1II8A 2DX7A 1DKUA 2EJTA 1PO7A 2IXTA 3G0OA 2ZUSA 5DHFA 3UJDA 4CYMA 5IMSA 2XRZA 1HPLA 1T8UA 2A0YA 1TJ3A 4YAJA 3TLMA 1Y0BA 1UKCA 5LD2B 2OECA 1U2DC 4PC7A 4N8SA 1UWCA 3S2SA 5DO9A 1PJ8A 1NBIA 1SULA 3MD0A 5IG2A 4ZOLA 4F9EA 1NRWA 1KHHA 2ORVA 2PKRA 2ZI9A 3EUAA 2XWQA 3H5NA 3DNFA 1ZD4A 5JCOA 5HWSA 1X80B 4NYMQ 5I8PA 1CVLA 5JS8A 1BCRB 2WIKA 4GQAA 1K4KA 3U7EB 4BOYA 2ODBA 5JDIC 3AX6A 4UBLA 2GJ8A 1J70A 5L40A 1Z2PX 2R84A 4H0CA 3T5DA 3FVWA 5EUMA 2ADOA 2WQZA 3A1SA 3BPSA 3CH6A 3HPQA 4QBFA 4LWQA 1W49A 5B3LA 5CG1A 3T3EA 2ZVPX 4IQ8A 4Z4FA 4M53A 2FLVA 2DVMA 2GASA 2Q5EA 2Y4OA 2DTDA 3CX6A 4EWLA 3CRRA 2PZAA 1DWOA 3V9PA 4KAAA 3FR7A 4QRIA 3WP0A 5B7NA 3F67A 3QPWA 4NFLA 5LXTA 2PMCA 3SXJA 5KC8A 4QIHA 2CXOA 4JXXA 3CZQA 1KDYA 2X6TA 3ISTA 3JAWB 3LUPA 2XVYA 2QW8A 1CNMA 3R1IA 3K0CA 3SYRA 2JAWA 3OY2A 4O2BF 2R4QA 3QGMA 1UAGA 1ZS9A 3DHEA 3NVAA 1YTLA 2CFIA 1YS7A 2FW0A 3B3QA 4RGQA 4KNWA 4L9WA 3LIIA 3UT5B 4CUZA 5J2TB 1U2PA 1QO7A 1SBQA 2FPLA 4J1QA 4YTEA 1DO0A 2VDPB 2FW1A 4O8CA 5E7QA 2CBZA 2QG6A 3KYCB 2B94A 3IS3A 3WYNA 4ZI2A 3UPTA 2FPGA 2P2NA 2C5AA 3GLHE 3QKRA 4DNQA 4DSTA 3AJAA 2ONYA 3IQGX 3NC1C 1OIWA 2VTDA 3QBVA 3TTXA 4WZBB 5EJ6A 3COYA 2BR5A 2NUTB 3JTMA 1VECA 2CY0A 4B5LA 1A2BA 5LP6A 2D2VA 2O0LA 2P11A 3PDIA 1X7ZB 1N7GA 4FYWA 3RS5A 5B57C 4U9UA 3EDOA 2OBFA 4QTXA 4HXFB 2ZANA 4GQBA 4G5FA 1A8QA 3C48A 3MRXA 4O2AB 5JSYA 4CUJA 1BS1A 3NOQA 1ZM9A 1I6WA 4GLBA 4MGEA 5J47A 5MN5A 2B1IA 3OZAA 5CTJA 3CX8A 3SQOA 2Q1SA 1HETA 1AKTA 1Q6ZA 1LSUA 2L19A 3HCWA 3HDJA 1K3UB 2OCKA 3KKEA 3T3MB 4AJEA 3HI4A 2BDEA 4OH1A 3F73A 4C6TA 5CXUA 2DQ4A 4NULA 1FUUA 3Q2KA 2BM9A 1M10A 3DMGA 1R0XA 5CLQA 5NULA 3AVVA 3HRHA 5E95A 2ZYWX 4TYWA 1K66A 1A4IA 1JFRA 1OLSB 3TQSA 5AM3A 1A8PA 1Y6FA 2XMDA 2LR0A 4YIHA 3SF8B 4UHKA 3FMPB 1EZ1A 2QDXA 2I6UA 3MM4A 3SKXA 1QQBA 2WLTA 3B2NA 4FGUA 4ND6A 2XUQA 4ENWA 1E2MA 1YDHA 4JC8A 2EBHX 1LJLA 1VHQA 1CY7A 3P9QA 1T43A 2AQIA 1RI4A 2KX7A 3ZW7A 1ZK3A 3IEIA 3KR9A 3PX3A 4AKEA 4DQVA 4JC0A 3QUSA 4Z4HA 3KQLA 5M3BA 3P9ZA 5JMPA 2NYUA 1FDUA 2ZAGA 3E0QA 4PVCA 2FW8A 2AWOA 5KZMB 1L5WA 2FDXA 3GWGA 4NCNA 4B3MB 4QXAA 2EARA 4YJ3B 3R23A 3VOBA 3T41A 4INAA 5LYJA 2ZSBA 4R7TA 4L3WA 5JVDA 4IDFA 3DKIA 4D56A 2QUBA 1ACLA 1U8YA 1NMSA 2DUJA 2VPQA 3I42A 1Z2CA 3HB7A 1RFLA 2QUJA 3RIEA 5BUZA 2GZ1A 2I4RA 1H5QA 1MFZA 5HZKA 1MO6A 4KIFA 1TMOA 1E89A 1XN1A 7GPBA 1I5OA 2N47A 2XAUA 2IS1A 1O6BA 1UXIA 3DE1X 4Z99A 5EIBC 3WZMA 1U3VA 1SOWA 3VR4A 2CKDA 4INOA 5F3RA 3LT5A 3VH3A 3GOHA 3N76A 5JAPA 4RA6B 3GEEA 4CODB 3GI1A 5KYYB 5K5EA 4DLVA 2OL4A 2PQ2A 2V0NA 3IAAA 4N4AA 5HZHA 1OAOC 4XTCS 4EY3A 2GQ0A 2WIBA 4LJ9A 4B3JA 3QITA 3I9FA 1LLQA 2OQ2A 1UBSB 2QTZA 3I2JA 2LCFA 2NVUB 1ECCA 1MIOB 3E15A 3KJIA 2BE7A 5DLQC 1XTTA 1G2IA 2CVQA 2VZ8A 4OK5A 1E69A 2MCFA 4H1WA 1JJIA 2XQKA 1QZTA 2GBLA 5JDCC 1RQNA 3W1EA 5AHWA 2QBYB 1V3QE 1A9QA 4IG4A 4YB8A 4EHFA 1PFWA 2C4KA 2H5IA 2O7VA 4DE5A 4PYIA 1N8KA 4W8HA 1AKVA 4EJ0A 5E0KB 4EF5A 4YRBA 3THYA 1RPTA 2PMBA 3TFOA 4YC7A 2GD6A 1JQKA 2XTJA 3GV0A 4QLAA 1NVVQ 2CLEB 2JLWA 4ZPXA 2A14A 5ECGC 3EVTA 5IU6A 5K99A 3S2UA 5L53A 1KERA 1LPMA 3V9AA 1SHJA 5EUQB 4NARA 2XVXA 4U2CA 1XZCA 5LC1A 4OK3A 4FU0A 3FJOA 2IHKA 4PCAA 3SC2A 1NBWB 2V0CA 1IEVA 3OPYI 3IP7A 4EKDA 3N39C 1E7QA 1KI6A 1B16A 1ZOPA 3EXHA 3G5MA 3QK7A 1D2NA 2PBLA 4Z4IA 1RJFA 4E2FA 1LPSA 1SIWA 2FSHA 4UXIA 1NYRA 4WOCA 5IBPA 5BSRA 5K8LA 4LFAB 2JAPA 3EYAA 3K9NA 4QPPA 4P4NA 1YZTA 3D4BA 1USGA 4HQNA 1N8SA 1URPA 4R31A 2R1ZA 3MWLA 4JQCA 5EPUA 3MJ4A 1ZA2A 1VPWA 3GJ6A 3HCFA 3KVVA 2AZ4A 3LX6A 5IMBA 5LIPA 1YASA 3KFLA 3U0BA 3P2MA 5F7OA 1KI3A 1P17A 2C5HA 1AF7A 5FR1A 1L7PA 1V4NA 2CGEA 2YZ2A 2GILA 4YMVA 3DW3X 2AHRA 1P0MA 5BORA 2K2QB 1ODSA 1UBJS 4PYOA 3TBKA 3TD2A 3C2QA 3K0KA 4Z3KA 1IJBA 1Z0UA 2RJNA 3DFUA 3O03A 5KKCA 1VSUA 5C8XA 1RWOA 5IM5A 3EG5A 3TZQA 3RRZA 2DUUA 4A5SA 3C4QA 4XARA 3C87A 3G8AA 1Z4IA 1RHRA 3E82A 1FQWA 1LC3A 3IUJA 3JPYA 3ASVA 5MN6A 4OMCA 5CDHA 4NICA 3C6BA 2J85A 4X3CA 4DPKA 4ZCTA 1E0SA 3O8RA 2DEUA 3GD7A 2C2GA 4YUVA 3ZY5A 4ZVSA 3L77A 1L5LA 2QVYX 2CXXA 4FYMA 1SCAA 8ADHA 3L93A 4C4RA 1N6IA 1Y8QB 4U7TB 3VO8A 2DSTA 4WK0B 1QC5A 3HVHA 4JMLA 4QAJA 4KH1A 1PZNA 5F2OA 1MQSA 3VYVA 1UXHA 5H59A 4JN6B 4L73A 3I6YA 3TK1A 2O8DA 1XAHA 1ZOIA 3GC6A 4Z0NA 3VYSB 3KE8A 4FHEA 2OGZA 3GNQA 5KYTA 3JWPA 1W4CA 5IKEA 3X2FA 1DARA 2DETA 1WX1A 4CMJA 2XMPA 3Q3CA 4S3MA 2BFEA 2XUDA 5C35A 1GSHA 4RH3A 2V7BA 1M8JA 2NPIA 3LXRA 4I4TB 1TAHA 2H7CA 3UXHA 3VR3A 4UOEA 5MGNA 1J8DA 4EKIA 3DP9A 3U1BA 3GP8A 2EKQA 3O9ZA 2HU8A 4HDSA 1X13A 1W2GA 2OG2A 1Z9BA 4PAWA 1AB6A 1QIDA 4JYZA 1V9SA 1UMDB 2VJMA 3RV3A 2PUVA 2GLXA 5LOVA 4IEEA 4H6XA 1CE8A 2H2DA 1RI3A 4UHHA 4B6OA 2FJ0A 3HKCB 1M9NA 1OXMA 1SUDA 3QX8A 5FL7A 1JEQA 4YT4A 5AVSA 3KKMA 2CLMB 4Q03A 3A9TA 1GNRA 2WKQA 3Q6MA 4WA8A 2IH5A 2Q0XA 4C5AA 1J0EA 2IW1A 1P19A 1VJ0A 1AHIA 1LLFA 1PS0A 2EW8A 4MGKR 3MFQA 4UU0A 2NO4A 4HGPA 2JJYA 2PT5A 1CRLA 2ZWMA 5EZQA 4G1CA 4QUHA 4EVIA 2C92A 2OWEA 1E7YA 2ZSEA 2O2ZA 3LK6A 3LKZA 3OAAA 4NJMB 5CD9A 4HQLA 2HTEA 3TEFA 4PF1A 2R6GA 1DAKA 2BGTA 1ZIOA 3IJEB 3BTVA 3AB8A 4GLOA 5BT9A 2NV2B 4UM9D 3CVXA 4QZVA 5T5QA 4R8VA 5ALGA 5LUBA 2P75A 2ATXA 2DYKA 2WMYA 1N2HA 1YHZA 3PQFA 2AR7A 2Y6VA 3SZ3A 1SMKA 1JQDA 2OZKA 2Y9PB 3U3KA 1SKMA 5CJ2A 4TYMA 1KE2A 1A88A 1TQ2A 2FSFA 1UWVA 3RV4A 4HGZA 4MQ4A 4TLLB 1YV9A 5AICA 2ODAA 4BNIA 3VAYA 4MGHA 3LY8A 2VKTA 3WS7A 1S02A 1B8NA 2J9GA 2Z2ZA 1E0DA 2I3BA 1AGRA 3COWA 1W96A 3TLJA 1KYWA 1TK2A 3Q6IA 1GZ6A 1KH3A 4M0MA 4ZOCA 4DPMA 3BXFA 2HM7A 2TMGA 1UK9A 3M82A 4IW3B 2XD9A 3TTVA 1DCKA 1OGIA 1A8HA 2A9FA 4E88A 1O0CA 4UTVA 3OT1A 5EINA 5CA0B 1JYFA 1JEOA 1O95D 1U7XA 2XKAA 2IELA 1JVSA 3LIPA 5AKEA 5G40A 1REQB 3G68A 1QO9A 1XTRA 4GBED 4N3BA 3NM4A 2R44A 3QE9Y 1WCYA 3EDMA 4J1NA 1OB5A 3O75A 1NE7A 4K9RA 3ZEAA 3QE3A 3G8DA 3FF4A 1H8EA 2ZROA 2BMFA 1C4OA 4R2JA 3BWEA 3UJNA 4F84A 1NW8A 4MPJA 1NDQA 2ZUDA 5DASA 3V1TC 4EYGA 1HFEL 4FNAA 4NZ9A 4ON9A 1JGTA 2KQUA 3C1AA 4PEVA 3LFUA 4KI0A 3EW7A 1LX7A 2O5VA 3L8ZA 4MV3A 2VRWA 5LZ7A 2CE2X 2YINC 3S1LA 3KPYA 3BZUA 3JYNA 4IY1A 1Y9DA 4PANA 3TDKA 2W6MA 4MUHA 3N28A 1WP9A 4LZOA 4BO1A 1P0CA 3W5VA 2O8CA 4WCVA 2JL1A 4OQMA 1Z4NA 4TMXA 3O2NA 1KFBB 1GZHB 4P0QB 1EP2B 1VPVA 4HEJA 2E5FA 2W4IA 4IMRA 2BEWB 2JLUA 3KUKA 1TOAA 1L4BA 5CAEA 2XB9A 1TAGA 1P0IA 3NRCA 3OM0A 4OQZA 4EGSA 3AEYA 1QQ7A 3ADKA 3QKUA 1U31A 2BD0A 3E0XA 3PHCA 4FT2A 5KWSA 2Z4TA 1C8KA 1UAAA 3UTDA 1OT5A 1IH8A 5F78A 3KSBC 3CWCA 1BMDA 4U3JB 4F5WA 1J2TA 4V24A 2GWHA 2OOKA 1BJRE 2IFTA 3EXFB 3O1IC 5K0NA 4W82A 3HLYA 2RGWA 3OEED 4YAIA 1RWWA 4NU5A 1JRLA 3B82A 1F20A 5HEKA 4LOHA 4B4VA 2JCVA 3O7WA 4ARZA 1KAHA 4OA5A 1DRJA 1L8LA 2ID4A 2EKBA 3QI7A 4GEKA 2ARKA 2YVQA 4I99A 3OLWA 3S2ZA 4BB6A 4BMXA 1UZAA 4FP9A 4B7XA 3JQ9C 4HFNA 1L4KA 3BIFA 2QTLA 3TFWA 3LS2A 2ZDQA 3INGA 4ARSA 5M04A 2C82A 5KTKA 2HLDA 3C3PA 4L4RA 7ABPA 4EGFA 2FZKA 2RCYA 4EKEA 3DBLB 1E2JA 2GNPA 2J3DA 3IKJA 4E13A 5CBKA 1YU6A 4PSAA 4ESVA 5CVEA 3OWXA 1C7IA 2QVCA 4CCWA 1UT8A 2O3TA 3DEFA 4UUAA 2YWCA 4J29A 1A76A 1C1XB 4X41A 1MVOA 2CNKA 1MRZA 3HUUA 3IAS1 2WPNA 1NVDA 3R44A 5I7OA 4D8YA 4TL6A 1T4GA 3F46A 4RJTA 1EX7A 2EW1A 3CC8A 3D8TA 1GXSA 1P62B 2BJWA 2FKAA 1G7SA 3SQLA 4YQZA 2BKVA 5EKTA 2WVGA 3AUJB 1VA5A 4EMTA 9ATCA 1C4KA 4OV6B 2HHCA 1ZGBA 3UC5A 4Z7NB 1N2OA 3PKJA 3K1ZA 1PNOA 1CFJA 1AG9A 3PPYA 1WUYA 1HZJA 1DOHA 1RIIA 1FFAA 4D74A 1VSTA 4TYPA 4BEBA 1BDIA 3LOPA 2E37A 1SUBA 1Z33A 4RPJA 1QBKC 2ACKA 3WXBA 1Y1SA 3H1PA 5JRDS 4WCFB 3QV1A 4W4TA 1QE5A 4YWJA 5AHRA 3KVYA 3T9AA 4P98A 4AY4A 4FYJA 3U9TA 4D97A 3QX3A 4NBUA 5K3FB 2JAQA 3SIPA 4DVJA 2O1SA 4GI2A 4ZYYA 1J0CA 3A4VA 1M1YA 1YNOA 3AXSA 4Q3LA 1F4PA 4U7PB 1QJCA 3FKJA 2RHJA 3HCPA 1LPOA 4WLVA 1F38A 2B8NA 2X2OA 4RPIA 4YP7A 3AVTA 2QN1A 3RTDA 4RDHA 2JIQA 1ADJA 1NAHA 1XQXA 2VHYA 1JP7A 1CRZA 2WHPB 4KQGA 1L5YA 1KR5A 4LGVA 4G24A 3ZWMA 4E12A 2DLNA 2BGIA 4ZVPA 2VCYA 4Y6PA 2H7XA 3RIYA 1G2PA 2XZTA 4HATA 3UMCA 3GGGA 2YYSA 3E53A 1Y80A 1QQ6A 3JQGB 2IEZA 3O8LA 1SU7A 4B6EA 3IESA 1R4AA 1XLVA 2WR8A 4IWYA 4PSUA 4W63A 3L6EA 4LECA 5KPJA 1DFGA 3ZXSA 3BCUA 1EFTA 1XKXA 1QYRA 2I8LA 1I2DA 2XCSB 2BR3A 4RTKA 4G9GA 1N5JA 4P36A 1AQUA 4N47A 3ZN2A 1R3UA 1Q2XA 3OPQA 3Q2IA 2IXGA 3M4JA 4IV8A 4JLDA 1N3BA 4MHOA 2XA9A 1E1KA 1UIMA 2R751 2FOIA 3SOZA 3WYDA 5IWCA 4RSRA 3F9IA 3FNHA 3C74A 1HFJA 3P0EA 2IGBA 4W1RA 6REQA 3ADOA 2B21A 1NW7A 3TNLA 3EOAI 1ZPDA 3KEGA 4WBXC 3VNAA 1ZU5A 4NZYA 4XGNA 2XNCA 2GHIA 3R6LA 1ZD8A 2Q2WA 3C6XA 4WINA 5ED4A 4L0MA 3VDQA 1PFYA 1WD7A 4Q9NA 3KWFA 3KE9A 4LE2A 2XGJA 2ANCA 2IPNA 3GA5A 1K8YB 3BICA 1OC2A 1PKXA 1ETUA 1PL6A 1SKAA 3GVIA 4DG9A 6Q21A 1DE0A 1KZ7B 5JROA 2O59A 3AHJA 1TJYA 4R7ZA 2JIZA 3OURA 4IDCA 1B8OA 4FHDA 1N5IA 4GLLA 1B00A 5EHGA 1ZD5A 2J07A 1BXGB 2G76A 4AO6A 4X1IB 3FWPA 3ZW8A 6GPBA 2C7BA 1DBRA 1K92A 4JC5A 4XLTA 5AXDA 1WMBA 2ID8A 4E30A 1QU2A 5B1YA 5K2OA 2H3HA 4HRAA 5KVSA 3ZEIA 1QH0A 1QWSA 3B9QA 4EEXA 4R1SA 3AJRA 2FN4A 3K2QA 3KV1A 3TQRA 1L0BA 3X43A 4J3JA 1YR6A 3BIXA 4HS9A 3L02A 2UYHA 1NNLA 1Z07A 3FCOA 5CUQA 5CT6A 4EY6A 2AJBA 3DDNA 2XI4A 1Z6PA 1ML3A 2CMDA 3WRYA 1ESMA 4I5DA 5FFFA 3KTFA 1PX2A 4FLEA 1L4HA 1X94A 2IOFA 3OJLA 4A8PA 1S9DA 1OUMA 2VP9A 3T1TA 2O1XA 1B42A 2HZ7A 2EHDA 4NU8X 1DEOA 3UUGA 1QYCA 1VLHA 4OMFG 5BV2P 3IP6A 1B2LA 1C0PA 1CY2A 2FJUA 3TG8A 2GBIA 2WTXA 5DSTA 5HOEA 3RJTA 1E3IA 1JU3A 2NO7A 2H2AA 1RLJA 3SHWA 2AE2A 4CL2A 2J6BA 3R7AA 3OPYA 3WAJA 3ZHTA 4XX0A 2BFNA 3TLCA 1RAGA 5DBGA 4KXXA 1POWA 4Y1RA 2GH1A 2YV2A 4R51A 3BJMA 3JXEA 4L22A 4KXQA 4ZOLF 2AXNA 4MGIR 4DQLA 1R15A 1JQ5A 3OIYA 2BEUA 1EUCB 3H3FA 7REQB 3WQQA 1SD2A 1B3BA 4U1RA 2NXCA 3ODPA 4WMLA 4EO9A 1JMYA 3D2CA 4MB6A 4Y9SA 4O8ZA 3V1NA 3ZNQA 1DKPA 3ZUGA 4B33A 2JZCA 2IYOA 2G4VA 4LF7B 2Q1WA 3DS8A 4TTVA 5EE9A 3IERA 1OKKD 1R6AA 3WGOA 1GVNB 1US8B 4FC7A 3DMFA 2BTQA 5FUBA 4EA6A 1H2FA 5KNCD 3LE8A 1KJ8A 3MMZA 5AVTA 1SEVA 3NHAA 1JLRA 1XD2B 2PLNA 5IF3A 4J4HA 3PFGA 3NM6B 5LXTF 2DFVA 4DTCA 3FNGA 4O4HA 2C78A 2J67A 2WLSA 3CJQA 1YQQA 3NAZA 4B2LA 5A6SA 4JI0B 4OK6A 4FFOA 1DPGA 2IIBA 3MXOA 3I9OA 1AUXA 2EV9A 1AIPA 1NBMA 1QRRA 1TEHA 3CRQA 3NOOA 2BFCB 4S2EA 5ALFA 1R27A 2YNMD 2G40A 2VAMA 2C3UA 3MRTA 5JY1A 1L7MA 1D3AA 3PNKA 2D2IA 4I36A 4LTDA 1Z8HA 5JLAA 4F4UA 2YIVX 5GINE 3SEFA 1G8YA 3GHYA 1ZESA 4O4IA 1JL3A 1HO3A 1RJDA 3IEUA 8GPBA 2H1OA 1PZFA 2BP7A 4CR8A 1NT4A 1EUZA 2ILTA 1ZCAA 4GR5A 1QHHA 5C34B 4DDKA 1EB8A 2D3WA 4YUXA 1X2EA 3D9QX 4BX8A 2J4CA 2C5LA 2YQZA 5LP6F 2JW5A 5E9JA 4WFKA 4MUIA 1VFPA 1BWRA 3KWLA 1C8LA 3MJCA 2QQFA 4QJ4A 5TQ2A 1Q95A 2AX3A 2AYXA 3HWX1 3OM8A 3MCWA 4RTJA 2CJPA 1C9DB 3BH6A 3B6ZA 1B0UA 1XZIA 2PYZA 3CZ9A 1WCXA 1H6DA 1SFRA 4GZLA 1WMFA 2EBUA 1JFFA 4FOLA 2YFQA 1VKNA 2M2IA 4IILA 4H7JA 2HN9A 5FPQA 1DO2A 4FYYA 4HN4B 1VB3A 1YR2A 3JQ6A 1XA0A 1BGWA 1ENPA 1E9EA 1JLLB 4PSVA 4S1NA 1QUFA 2IVFA 4UUBA 3UAOA 5C18A 3PUYA 1XRMA 2X40A 5JBQA 1VI2A 2YY6A 3KUXA 1WB6A 2YVAA 3TUJC 3UK0A 1MX9A 4G89A 3S8MA 3Q1KA 2VSNA 5YASA 2GF2A 3SJAA 3HO6A 2GDZA 4DCTA 2ZM6B 1CR4A 1SVSA 1TFUA 4EATA 1OWOA 3TE7A 4OQNA 3BIJA 5A5DA 4EGCB 1LY1A 4WSOA 5JNRA 2Y1WA 3GGSA 1LI4A 1QYWA 3G3EA 4EG1A 5F23A 1SO8A 1KMCA 1LXCA 1X70A 4L15A 4N12A 1CBUA 1GZDA 2ZJYA 4LXIA 3IILA 5E1BA 4LRSB 1KZHA 2XXAB 1GGHA 3RTCA 2IZ7A 3E27A 5LYJF 5JVDF 1E18A 5CDYA 3WV5A 5EIXA 4JUAA 2IYZA 1LLUA 3BF7A 4NCIA 3BRQA 1MO4A 3BYZA 5C3UA 1VJCA 3TB4A 2X2FA 1C80A 5C7LO 2I8AA 4QOGA 3BE5A 4FGJA 2IXDA 3T7SA 2HBRA 2PX0A 5LA6A 3JWGA 3OQVA 2R1UA 4Q18A 3RRMA 1FXSA 1VLMA 1N25A 1O97D 1EDOA 4CDRA 1M5RA 4G0MA 4HJXA 3WBKA 1RRPA 3PC3A 4REQB 1XEXB 4L5YA 3ZWXA 4L9AA 2NO6A 1KK0A 1LPNA 3ROZA 2C2OA 1ZCZA 3WZLA 4CTOA 1TT7A 2VRCD 4J1TC 2OR3A 4ZAGA 4DUGD 4YRJA 2C42A 1GZSA 4BZQA 1IATA 4BCBA 3C5HA 2HLHA 1YE5A 3GA7A 5DTMA 3G1UA 1CPYA 1GU7A 1E1QA 4IRMA 3BIOA 1SUAA 1XJCA 4QASA 3ZWCA 5AUPB 1L4UA 5I7HA 2B5VA 4MWCA 1KI2A 4REOA 4MW6A 4NLLA 4X94A 5ELLA 1V1JA 3N0TA 5IT4A 1YZFA 3MGBA 2GB4A 4MUFA 3BE4A 4OHKA 3FZYA 3NBYC 2O54A 2QMEA 4TRMA 1ZRMA 1NXWA 4JKIA 3ZIAD 1CY6A 1A7JA 3MWFA 2QT0A 3B51X 1HSOA 5DPMA 4BMYA 4DDWA 4NX2A 5KSYA 5EIEA 5AJXA 3W0LB 4WUTA 1YA8A 3PFBA 3GAMA 3Q41A 3UGQA 4YI5A 3W6ZA 3NV7A 1XXHE 5IKMA 4DLXA 1RRFA 3G13A 4KN6A 1PV1A 3FDFA 3RCBA 2O57A 4HXEB 5I7SA 2OV8A 4P4SB 3RSQA 5JCPA 3EVBA 1U2TA 4U7WA 5GJVC 3KKOA 3ZHSA 4H3VA 1UEXC 5BR7A 3OEYA 1U8CB 4ZANA 4OUDA 3WLTA 2B1RA 2J41A 4HQFA 2GN0A 4FZVA 1VIDA 4K9PA 2VYND 4CV2A 3ENKA 3LDHA 4E46A 2WG0A 1G4HA 3DE3X 3LBIA 4AIIA 1TXGA 3PL5A 1Z08A 2ZXEA 4XGQA 2VK4A 3V42A 3QTBA 4NV3A 1NSFA 1Q7RA 3DZJA 4XWGA 5IK2A 3RRBA 1AUOA 2IYXA 4I8XA 3TLYA 4JASB 1I1OA 4G8DA 3DBHB 1G3UA 4YJHA 2AEFA 4PVDA 1JAYA 2O8FB 1JR3D 2WTBA 4MEJA 3TTSA 3BJZA 3P8ZA 5CFMA 2X23A 4RMHA 5AM2A 2ZWIA 4M49A 2FZWA 2XCRB 1Q6YA 3E4CA 3SJ7A 2GUWA 2JEOA 1DG9A 1RU3A 3CPSA 3ZU4A 2X2PA 3ONNA 5DNEA 2ZRBA 4MVJA 4B8WA 2DWPA 3FMOB 1TGYA 1XDBA 3D02A 1S2OA 4I7EA 4ASUD 4UPEA 4QPCA 2W2OA 4MQEA 4A8HA 1AK1A 4PG4A 4CMKA 2VSQA 2PKQP 4HRXA 4E6PA 1EA7A 4PLCA 4LXXA 2XMCA 4AC9A 5KYXB 3QFTA 3GU3A 2QTHA 4ZU3A 3DAPA 3GIWA 1CX9B 1BX3A 3ZOZA 1ZH0A 2HI0A 1KYZA 2AEMA 3JAKB 3RK4A 2IYQA 4UE6A 1KIMA 2G71A 4PC2A 3E22B 2HX1A 3SZGA 3BD8A 2P79A 1C81A 2O2SA 5MDHA 5HUJA 3KJXA 1FNSA 3L8MA 3KG2A 4O5AA 1TD1A 1S2LA 1DHRA 3F1KA 4WESA 5AOAA 4L7VA 3AO0B 1R18A 4DQKA 1M2JA 2H48A 4YMIA 1V8FA 3KSZO 4U6SA 1FTNA 4BJ3A 4BLOA 4W1QA 5LOVF 1KEWA 1VL0A 2CK3D 3G0IA 3LBYA 4P7KA 4A8TA 3IO5A 4DIMA 2GM5A 3SC4A 4D4LA 5EP2A 3CXRA 4IEFB 4DLLA 3ZUPA 4EABA 1CUZA 2D7DA 3DVAA 4HXGA 4JLMA 1XZQA 5THQA 3T1QA 4UJ3A 4B35A 1O94D 1N2GA 4CBVA 4A15A 2ORYA 4M7OA 4POAA 1N5RA 3DWFA 3IQXA 3VDRA 4CUKA 4DG8A 2R11A 5LMUB 5LZ8A 3TINA 3AESB 2MJLA 3BTOA 4P38A 3ZJVA 4RK4A 2XIJA 1M83A 1QIJA 1OI2A 1P0QA 4EZEA 4CI0B 2REQA 3FYHA 1W59A 1NSYA 1TYBE 3EARA 4N7RA 3S1AA 5JQGA 2EF0A 3BWXA 1TO2E 3L2OB 1KMHB 1VHLA 1X7HA 2P7IA 3QQ5A 1GQYA 1F9AA 3VX4A 4XOIA 4OFWA 2PWZA 4MQBA 4DCMA 1E5DA 4C7OA 4NJEB 2J5RA 3M9XA 3HKDB 1ZKMA 3B8EA 5TX7A 3VPDA 5JQWA 2XYVA 4EW6A 1CLUA 3KQMA 4Y2VA 3T3OA 4E4TA 1MC4A 3AF0A 1M0SA 3EHDA 3L1JA 4FR2A 1M3SA 4HLUA 4OXQA 5LJIA 1P6XA 3IJRA 4REMA 5CDFA 1A95A 1W36D 3DHYA 3C0KA 3PPIA 1PBTA 4QT0A 3FF1A 3Q15C 4DEVA 3BD7A 1BN7A 2QN3A 4R3UC 1A97A 1ZCBA 1WW2A 2R00C 3C4JA 3ILSA 2V3CC 4K9SA 1I4WA 1KZ6A 3QFFA 3A37A 3UM9A 3WNCA 1I8TA 4IVPA 2JAHA 4CFYA 3MJHA 3FFBA 2CVOA 5K0BA 1T35A 1VLLA 4PBRA 2CN1A 2VDLB 2ZDHA 2VCHA 3ICCA 3GUVA 5KQGA 3VHXB 1P0PA 5E4TA 3D0RA 3FN4A 5HTKA 1SU4A 1GL9B 3E18A 3EGWA 4FFVA 4ZOBA 1ZOSA 3IMCA 4EITA 1ULTA 1Y4UA 5DHPA 3I8SA 4AROA 1SBTA 3RU9A 2C99A 4X60A 1KOJA 1ZLXA 2ETVA 2AR9A 2RAFA 1SHKA 5D3MB 3IKTA 4TMWA 1GG8A 4F2WA 1U0NA 4RGBA 3A58B 4O1MA 4ZAYA 1ULUA 2OENG 2FZ5A 2LRHA 5K3BA 2ONJA 2HDWA 1GCAA 1MP0A 1VA4A 1LLDA 1MX5A 2G9RA 3CEPB 2BL4A 2IEAA 4KP7A 4G37A 2RHTA 3ROTA 1HL7A 5IXYA 1QSGA 4GYKA 4TROA 2D59A 3OFND 5EPOA 4ZJUA 4JKOA 4N5HX 2WAAA 4GFDA 4KI7A 4BLRA 2IBTA 3AG6A 1U1CA 3K05A 2WDZA 4JI1B 4Q15A 3OM9A 1OFGA 4QREA 1S1CA 3SZOA 1KOLA 4IQ0A 5JHHB 4RH1A 3D54D 3FFWA 1EQ2A 2Z2JA 3H9JA 4XDZA 5EZYB 2R4UA 5BV8A 2Z5LA 3ABRB 1PT8A 3BAZA 3KELA 3LQFA 2QF7A 5L6LB 2MYTA 2I78A 3C98A 1AZTA 3X44A 1VHTA 1XCBA 5D3ZA 2NUBA 1K2VN 4U4AA 4QDZA 2PGIA 3LC2O 4A6XA 1PD1A 5EJFA 4EUSA 5ADHA 1SXQA 2UXCB 3TGWA 2FRXA 1NZFA 3E7DA 4PXSA 4XZ3A 3FOWA 4HDKB 4D3YA 5JO0A 5KUTA 1KY3A 2IY8A 1VOTA 3BMCA 4OHPA 3GH1A 4HAUA 1EFHA 4MULA 1GSIA 3VOAA 3JZDA 1Y89A 3RT1A 3C41J 1DC6A 1IQPA 2OP1A 2ZRKA 4CLDA 4DV1B 2ZRCA 4B4KA 3DOUA 4EDHA 1VMDA 2E3JA 1J9GA 2ZAYA 4MS3A 2VBIA 3OIFA 3FB4A 4HRVA 3FOCA 2YXNA 4QG7A 3PD1A 2D2XA 4UQLA 3RW9A 2CWWA 4HLQB 4IJQA 1X14A 1IY9A 4RVNA 4J0QA 4URUR 4UTZA 5JPDA 3VNVA 2Q9CA 2PRYA 3KKKA 3DVSX 1HZZA 5KMGA 3BJRA 2BFBA 2IDZA 1L3BA 3QLUA 3S81A 1IXRC 3B1ZA 5AXBA 3TVDA 3X1KA 3A11A 1L7AA 3QHQA 3QUBA 3RQSA 3C85A 2D4HA 2H5JA 4L0DA 2ODNA 1G8KA 1L5SA 3ONFA 4MYUA 3A6PC 2EX0A 4HSGA 1BRTA 3KT6A 3O84A 5SICE 4L4SA 4MS4A 2FX3A 3HUTA 1TU0A 4JB0A 1N6RA 1VJRA 3KR2A 2PGXA 5FOUA 3TRFA 4C0HA 4ZYLA 4UDNA 3U3ZA 1CVRA 5HS4A 5LDHA 1ODFA 1IRIA 2EP8A 2QVLA 3JYHA 4MNTA 5AIBA 3UFBA 4CM9A 1HDXA 2YXBA 4NESA 9MHTA 1U3UA 2ZXUA 2Y0EA 3KX2A 2ZIXB 2HA2A 2HRBA 2FGKA 3P9IA 2VPPA 2IITA 4ZQBA 1FPMA 2ENUA 3C3YA 3BOSA 3CVWA 2LDBA 4KR3A 2I9PA 2GA9A 1XI2A 3AJ8A 2IY7A 5KREA 5H81A 5HF9A 3GFQA 3QMVA 3AJ9A 1CEEA 3IXLA 1Q1GA 4Q7JB 1M1UA 2GZDA 4QUGA 5FD8A 1P4SA 3MOIA 1SY7A 3CT6A 3L1VA 4BGIA 2ODTX 5JAHA 1QDUA 5DHRA 3K0AB 1XKTA 2DH6A 3CH5A 4I55A 4KQFA 3DPUA 5DB4A 3AG5A 4MYTA 5ENDA 3T7KA 3PCRB 4PGFA 4YJFA 3ZVRA 2PQ6A 3ORQA 2YYAA 4PNEA 3IQIX 4TS4A 2PPVA 1GZ5A 3DF7A 4IYRA 2PS1A 2JFYA 2MSLA 4BATA 3FE2A 1P9RA 1JJVA 2EW2A 3JQ8B 1G1AA 4R0NA 4RO0A 3TRJA 1OWPA 3CX3A 2IBMA 4DXHA 3TQTA 1RMQA 4J9VA 3ZDDA 1X1AA 1BEUB 2XYPA 1Q17A 1NVBA 2AYZA 1ICEA 3KTAB 4GWLA 4KFSA 1W75A 3R7LA 4CG1A 5LIRA 2GYWA 3OMWA 1GAWA 1K68A 3U39A 3DL7A 3GVPA 2J0UB 4MWTA 4RK0A 3ZHOA 1P9LA 1IDOA 3GJQA 2X0NA 3I2FA 4DSUA 1MEOA 1EBFA 4C05A 1CEYA 4DLYA 3ENWA 3EZ9A 4EENA 3NIDB 2CUTA 5U9CA 5CTAA 2DU8A 4TT3A 4YV7A 5FI3A 4CL3A 1E2EA 2ZE7A 1DFHA 3T7TA 1Q3HA 5BVHA 1FX0B 2V65A 1CB7A 2HRQA 2OXCA 2ZJ2A 4AT1A 2A7QA 3RYIA 3O0DA 1LEHA 2EWVA 5K0GA 1M74A 1VYHA 4ND8B 2E4YA 2WTAA 3T0IA 1P4GA 4ZRMA 4IGAA 1GUAA 3OQHA 4OG2A 4CKBB 1JDPA 5DH9A 2WWXA 5DEIA 1E0JA 2AXEA 2AF4C 1T1JA 3ECSA 3HXKA 5JSQA 1QMPA 1JEJA 1DMRA 1MVNA 1NP7A 1QH1B 2VP6A 3DLCA 1G4UR 5ITZB 1XLWA 3KAKA 5HIIA 3RFCA 1F2DA 3OLQA 2C2MA 3DB2A 3IHWA 3WIVA 4CL8A 3VR4D 5J2UF 2QR3A 4B44A 4RDIA 3SJBA 2Y8EA 4PLYA 1SXJA 2VP2A 2WU4A 1TEZA 1VE6A 1USUA 4KE6A 1X39A 3WNZA 2JJ1A 1GDTA 1YK0A 2EFCB 3E2PA 2A1TS 4GPBA 1FA9A 4QAQA 1P6QA 1ZVKA 5HKOA 1JWLA 2R7AA 5COQA 3HHEA 6LDHA 1VMKA 1YMUA 2O0JA 4HUQA 4KWHA 5DU2A 8MHTA 3BB4A 4IX9A 1IIRA 4OH7A 3T7CA 5IWAB 4R0MA 5BPFA 5FR2A 2V7TA 2PKQO 3OZIA 4NYIR 1T5HX 1QFYA 4FVTA 4ZMSA 4GOLD 5BUSA 1KJQA 1RXCA 4IZIA 4MMXB 1KHTA 1GGVA 1L7VC 4RW0A 4UHDA 4WXMA 1XE3A 2QRMA 3QMMA 3RS9A 3SBOA 1TB4A 1ZH2A 4CIBA 3RF7A 1UP7A 2B4QA 2E0IA 3WYCA 4DDMA 5CFQA 2HA7A 1GQRA 3OTWA 3GARA 4YT8A 1QR6A 3F6YA 5EHXA 5TMBA 3P45A 3ITNA 3JZIA 2E4XA 4B7UA 1G5QA 4BB9A 4CN8A 5C1OA 4TXLA 3EXG1 3GVXA 1HNNA 2CJWA 1MW9X 1VFNA 4N9QA 4Y2UA 3WJ7A 1JKFA 4DSNA 2GA8A 5BWCA 3QYJA 5FIUA 4QXMA 2GGSA 3KB8A 3LDGA 2DPYA 5GONB 4WZBE 3RU7A 4CL0A 1RXWA 3UMJA 1P7CA 3NNNA 2X9NA 2I34A 1MA3A 1Y4SA 1XDDA 3DD1A 4LNHA 4NBKA 5FTKA 4RKEA 4BS9A 3NC0C 1DU4A 3DT9A 4G0QA 5GY7A 1G20B 4N7JA 1LBTA 1V16A 3BSYA 3AR2A 4H1UA 5JAIA 3RSCA 2NNLD 3K70B 2OCXA 1XRPA 5HIKA 2NAPA 3LPAA 3SX0A 4RSHA 3RJZA 1JPJA 4F6RA 4F9TA 1GADO 1Y5LA 1N0WA 4AWAA 5WRFA 2H00A 3RUPA 3HB1A 4O4HF 2EJUA 2G63A 4EOGA 5A4MS 1JHUA 3H7IA 4IJ6A 4O2RA 4I46A 3D59A 3EDYA 3SR3A 4X1YB 2FY8A 3ESXA 2PJRA 3S3TA 5H9VA 2BHTA 4UTXA 4BO2A 2V8OA 1Y3CE 5F5XA 4G36A 1W1WA 2ATCA 4L2IA 4W5WA 1ULHA 2OAP1 4HB0A 4AECA 1HRKA 4HTFA 3O94A 1QGED 2IKSA 3LSTA 3RC7A 2JD2A 4R68A 5KNCH 3KSUA 1YFJA 4XR9A 1SQ5A 3KQTA 5H3CA 5KNBA 2QAGB 5JXWA 5AK4A 1JF8A 5EMJA 5CDTA 2EJVA 4EY7A 4Q1CA 3ABQB 2B8JA 2Q3MA 5AOVA 4PO8A 4RPCA 2ZBGA 3K4QA 1T3SA 1RI5A 1SVKA 3LUJA 4B47A 4EGJA 2C7PA 1KU0A 1F6DA 3NEAA 2PANA 5LQSA 4ZOEA 4EFDA 3K8OE 1ODCA 1R16A 3DUWA 1U7UA 3JRNA 4E2WA 3ZD9A 1BW9B 1FRVA 2PL9A 5L6MB 4YDQA 4B76A 1DZIA 3A1NA 3IAM1 2NUAB 3WK6A 1Q0TA 3LVBA 1Z5UA 4PX9A 4WOJA 5CCEA 2ABWA 3GDGA 4INJA 3A6FA 1DBWA 4FW8A 3IV9A 1T36B 3AK4A 4TZ0A 2ZJ3A 2FN9A 2AG8A 2RHCA 4K6CA 5AJYA 3VR3D 1AMOA 2IHVA 3EUFA 4KR0A 5CFZA 4LJKA 1JHPA 1SCKA 4HWSA 5D51S 3AUUA 5BYBA 5TC4A 2M6KA 1MTZA 4IIXA 2WUEA 2IP2A 4TUYB 3ANNA 1W581 3KAQA 1CIVA 4J7XA 4R4JA 4M0PA 1C7JA 2PTGA 5DM4A 4F4JA 2PUHA 3PQ4A 3EIOA 5D6NA 4PHFA 5FL7D 2ANBA 2AEJA 3RSSA 3JQFC 1B3RA 2IYTA 1LDNA 1WBJB 5J63A 4QEDA 4ARAA 4DY6A 4F6LA 2J3IA 4M0KA 5DOVA 4ES6A 4BQIA 4QULA 1SBZA 1A9OA 1LH0A 3H9CA 4L76A 3W2GA 2RAPA 4MQFA 3AIKA 3D4NA 1OWNA 4FFSA 3TXXA 2GZ2A 1L5GB 1PS9A 2VT7A 3MPOA 5T4EA 5DP2A 1AHPA 1KI9A 1NI5A 1Q0QA 2A88A 3PA8A 2QLMA 4O2BB 3V4VB 3CLTC 3HKEB 4RV5A 3OAAD 4G67A 2IU0A 4BTLA 1M6NA 3UG7A 1QVZA 1R00A 5KCMA 2KBFA 2OV2A 5A3VA 3T15A 4H9GA 5JZ9A 3KYDA 2V98A 4J0JA 2NZUG 4ZT6A 4BWGA 5BY2A 1NW3A 2AT1A 1JQEA 5HPYB 2B20A 1T2FA 2FYTA 3C5CA 3FZEA 3KOUA 2QVZX 4ZAFA 5LA6F 2V6IA 3ND8A 2B8WA 4I5EA 4LAFA 1HH4A 4CV3A 3Q12A 3DAGA 2VZ0A 2G5GX 3QWBA 2ZWOA 5TPWA 2OZLA 1ACMA 3DZKA 5D7BA 3ZWQA 4ALIA 3USES 2Q8PA 5TS3A 2WB4A 5I9BA 4E07A 2G6TA 2ZRGA 2B8TA 1SOMA 2YFHA 3SWWA 3D7KA 4UZEA 2YJ6A 4KR9A 3K73O 3GZNA 4FONA 1M2GA 1NF9A 3EK2A 4TQAA 4YCJA 2C4VA 5ER6A 3QY0A 4IVQA 5JG7A 3KKLA 5EWJA 4Q1AA 3HEMA 4CXMA 5ERGB 4WNYA 1JQJC 2X8LA 4M9SA 4IEIA 4ZN6A 5EN4A 1WA5A 2GPYA 3IBSA 3FNRA 4B4OA 5JARA 3A4NA 3GDWA 2ZI3A 4Z0TA 1OREA 5KJ1A 1R4NB 3QLEA 3D6FA 1O1YA 2SHKA 1U4NA 2ZETA 1QB7A 1FUIA 1L5HA 2JJ2A 1I1QB 4WY5A 1WCWA 3AF4A 1KSFX 2GTHA 4HAIA 1L1QA 3RC2A 1QBGA 4Q00A 1ADBA 1H8ED 1N6NA 3CZCA 3LDFA 4F5ZA 1ECFA 2XYQA 3ZDXB 1JIIA 3H2YA 3NBUA 3B6IA 4ZARA 3HXMA 4WLUA 1BTOA 4J0KA 4RM3A 5ABPA 5GJBA 1ZH4A 2WKRA 3WLOA 2RI1A 1RADA 5F4ZA 3Q9SA 3OOEA 2GNOA 3WV4A 5FI1B 4L8VA 1C9JA 2RBGA 2PKWA 2YWXA 1IU9A 4A4DA 5CFLA 4XGKA 1X7YB 2JGDA 1VGVA 1EFCA 3GJ4A 1XQYA 3EBLA 4KWIA 4TKMA 2C7QA 1ORRA 2BGJA 3SHFA 3T9BA 1XN4A 2O2CA 4NNPA 4C7MA 3RVRA 4BX0A 1QFSA 1YA4A 1UJ5A 3TIVA 1CQJB 3AHHA 3N8GA 4E2YA 4OHUA 1DAIA 3ZZNA 3SDSA 2RE8A 4CMAA 1XYGA 1W44A 5TS2A 3AQ4A 4AY6A 4YREA 4OD0A 2J9FB 1Y6GA 3I3OA 4Z9AA 4M1ZA 5DMHA 2H7YA 3WQBA 1W25A 1CS4C 4M55A 1O2DA 4TPKA 2W58A 1IHPA 1U2DA 3HBFA 5EHZA 4DBLE 4D6XA 3BXXA 1WXFA 4G63A 4MWZA 2HHJA 4DA9A 1WS6A 1KEEB 2GN4A 1BE8A 4ZOQI 2W93A 2D00A 4LHZA 5IDYA 2QV0A 3H1GA 3RWMB 1TYAE 4K6MA 3HB5X 1K5DA 1RFGE 1S4QA 5LBIA 4ZKEA 4PX5A 2ZIAA 1AS2A 3IP1A 4DA6A 1S6YA 1M2OA 3KQKA 2GN1A 5JDIA 2WG1A 3T5TA 2VK2A 4KB5A 4PFJA 1B0AA 2OBYA 4BWFB 5T6BA 1LDEA 1GRCA 1EX1A 5BVGA 2QTTA 2RKBA 3TIGA 3EGIA 1ZSYA 2HLDD 4Q4AB 4MVJF 4IFIA 3ND6A 2W22A 1ULSA 3SJZA 1C5KA 2BMEA 3CZPA 3R5FA 3E61A 2C8KA 2FP3A 3NT4A 3CPEA 1A4RA 1J23A 1P60A 1PK9A 3MFYA 3P9KA 4CQNA 2FPMA 2G5TA 3HMQA 1E6MA 2RGCA 3EFEA 2PDAA 1L5NA 1F1JA 3KR0A 3WSWA 5L4NA 5H3LA 4GPEA 1P61B 3R0IA 3D6VA 4EX7A 3UENA 4AMGA 1ZUHA 1PGJA 1N2CB 2XZPA 4YO7A 1VYTA 2PX2A 3L1IA 2Z4RA 5BOSA 1NV9A 4K6HA 2J3LA 2DPMA 3TNYA 4ZC1A 2P67A 1FL9A 1RBQA 1JSCA 2FA9A 2QX9A 2X77A 1W1IA 2Y9MB 4HAWA 3ZWVA 4FSXA 4ZI7A 4OUKX 3IBCA 2FVYA 2D1QA 1UBEA 2X5XA 5HNKA 4CMIB 1U5CA 3HEAA 3ANMA 4YDRA 3EXIB 3WNBA 2SBTA 4PY2A 3UPUA 3EWNA 4FBGA 1QP4A 2VDRB 3HU3A 3HA5A 4BXOB 1AM4D 3VAZA 3H4TA 4YFYA 4UAGA 2R1TB 1KKLA 1QHGA 1XCJA 2R85A 3EVEA 4Z9YA 3WGIA 3P19A 4GBGA 1FFXB 1ZINA 5FTMA 5HCUA 4XWOA 2FTKE 4LYHA 2IP4A 1F0NA 4MIYA 3S0JA 1TKRA 2OHJA 4MTCA 4RORA 4EPWA 3HB0A 5DGXA 2RFLA 3CNEA 3C3DA 4HZUB 5KVVA 4MR7B 1V4BA 2HU5A 1RBYA 2A94A 5K09A 3H2KA 2E4WA 4X20B 3EGDA 4QDXA 1SD1A 1XWIA 1QB8A 1W5EA 4NZOA 3A06A 3BMOA 4R2IA 1DWUA 1JVBA 1E3JA 4UDXX 2YZNA 3NVMB 5JQGF 1P2FA 1MLDA 4MARA 5GQSA 3SGLA 3HU2A 3COJA 1BYIA 2PU5A 1D07A 1RLOA 2IHYA 4IOMA 5GAJA 1E3SA 4CT5A 2C0PA 4Y6GB 4BFYA 2RH4A 4J2HA 2WJGA 3M1YA 1ZUWA 4ZQIA 1Q1ZA 4I9NA 1EE1A 3BGVA 4L5CA 4LPKA 4C6RA 1QFZA 3V3KA 3JARA 1KI1A 4IFEA 4ED9A 2CXUA 1CW2B 1E77A 1DKQA 1PGNA 2J8ZA 3ONWA 3LTEA 3VO2A 3VV2A 1N1EA 3DF9A 5D85A 4G0UA 1L7XA 3E9NA 2V8BA 1IEXA 4FWTA 2EDCA 1XNJA 3TBFA 4F3NA 1JR2A 3NT5A 3WYEA 4P3YA 1CZHA 3DXFA 3M6VA 4WEOA 4C0WA 4ZALA 4IFTA 2FSVC 2WJHA 3Q7EA 5AKHA 3AETB 4JENA 3B7GA 3PEVA 3WIDA 3BTUA 4JWTA 5IVIA 2I0FA 2Q4DA 1M1NA 3H1EA 4XLLA 4NHOA 3VNRA 5AVRA 2V03A 2XD4A 2X15A 1E3LA 1VZ2A 4XJSA 1VG9B 3PP8A 1RRVA 1NKTA 3EC7A 2FZLA 1AK9A 3N0XA 2JIZD 3C3CA 4J4BA 4ENUA 5HE9A 3NIGB 1NW4A 4Y1EA 4Y6SA 1YQEA 4JLBA 2C96A 3W5DA 4KRGA 4Q34A 2Q5HA 4X1KA 5AQEA 1L8QA 1JTVA 1QE3A 2GRJA 5F3WB 2D3TA 1HC7A 2QN7A 3O6VA 4YMSA 3AKEA 3WZ2A 5AUNB 4K26A 4MP3A 1DT5A 4K9MA 3LPLA 4BNNA 3CBGA 3MT7A 3GGOA 3D81A 1FXUA 5JUWA 4HTAA 4AULA 3KXKA 4D92A 2O2JA 3AH8A 4MKRA 3CF6R 3O4RA 1OAOA 2WF7A 1T29A 1M8GA 2NTJA 3GMIA 3A14A 1E1RD 3KC2A 4X8MA 2FG7C 3O82A 4JVMA 3MW8A 5E3IA 5G0VA 4BNDA 2OAEA 4D8TA 2F4NA 3MELA 5EA2A 1WXHA 4DRXA 2OCBA 4LXTA 3REQB 2ZTSA 4IDOA 3P4XA 4RZQA 5K3SA 4DJ5X 5F4BA 1U7PA 5J5CA 1H6BA 3PYLA 3VZPA 4B6JA 1J0BA 1SQGA 3JW8A 2VUUA 1ZNZA 4FMCF 3TXAA 1GCIA 1UCFA 1RAEA 5JDCA 1QGUA 4RA9B 1OFIA 3B53X 3U62A 1JILA 2J7KA 4I1SA 4NEGA 2XZLA 4EZBA 2K7ZA 4EEKA 5FA8A 5CCXA 1BAPA 1J33A 1VE3A 1JYSA 3VJLA 2Z57A 3H6HA 5CB4B 5IULC 5D1HA 3GAFA 3I1JA 4OOFA 4A2WA 3NDPA 1K5GA 1U0EA 4MAMA 1V8DA 2UZ1A 3O4GA 3WL3A 2VHZA 2VTVA 2WE8A 4OQEA 2Q62A 2E6KA 3AVQA 4DJFC 2YHIB 1DBPA 3A1FA 3AERB 3TIXB 5BQPA 4A03A 1PW5A 3FYDA 4BIIA 3S44A 1M6WA 2ZUCA 2HV9A 3ZCVA 1KY5A 4FI3C 1SXGA 1DFIA 4YWHA 1N2JA 1JBKA 2Q8NA 3U7RA 2NP6A 4M9XA 1Z3CA 3AFIA 3DFZA 3HG7A 3PR3A 4U00A 2Q3DA 1JIQA 1PD0A 2D5IA 2YYZA 4IZ6A 4P3KA 5KPDA 2H57A 1MZPA 1FU8A 2HA6A 1TJ4A 4ZKDA 1Z12A 2IVZA 3AIOA 3I2YX 5BW8A 3AM1A 2VJKA 5F64A 4JI8B 2JASA 3A7DA 4AKSA 4LV8B 3EFHA 3FDIA 4ZCLA 5C8YA 3L01A 4FIZA 4J2OA 4YRRA 3OTHA 5F51A 4ZIRA 3KKQA 1M0WA 4LY6A 2HF9A 2WFLA 4MYHA 3T06B 4KYIB 3FTPA 1P9OA 4L4XA 3VR1A 1Z5OA 3AB3A 3EQ7A 1G2QA 5HBRA 5IJZA 3F4KA 3L41A 1JIJA 3WQHA 2VHEA 3SJCA 1W5FA 3M0EA 4H7PA 3U4HA 4J0IA 4XVUA 3G82C 3GRKA 3L0ZA 2AXQA 5EIHA 2IHJA 1ZJWA 1R64A 1L5OA 1NBMD 1UADA 3B5EA 4DBLC 3OJOA 3Q7TA 1Y82A 1LC0A 1TM2A 2A1UB 2XMGA 3DCNA 5LMCA 1S9HA 1V2HE 3ASZA 1VMEA 2QXUA 3TI9A 3WLIA 1XPJA 2AJDA 2NMVA 2H6EA 2CKMA 1ZR4A 2G88A 2R6DA 1VGQA 3BTSA 3BS4A 2C5FA 4J6FA 3W8RA 1FUEA 1KVTA 2IUYA 4FGWA 4Y98A 2C3YA 4R1MA 2KM1A 1K2WA 3ROXA 3UMVA 3UWPA 5BSHA 1P39A 1Z4KA 2AOWA 1Q50A 2AJCA 2P40A 4HWGA 5JJIA 3PUIA 5DISB 1WSWA 5AT1A 1KI7A 4H59A 4IOLA 3H42B 4AJ2A 2WWRA 4J0FA 3T5AA 1TUIA 4FYKA 3KOMA 3M6IA 3HKBA 1YR3A 2R7LA 5AJUA 5KWEA 3O47A 4MMZB 3LW7A 2WJJA 3KD3A 1GUZA 2D13A 1NVXQ 4D6PA 3WJ2A 3UOAB 4ZREA 1ZGGA 2BMDA 2H8KA 4E1VA 1N32B 4FOPA 3T12A 4MUNA 4YLGA 3ZD8A 1YZKA 4CKXA 3VU9B 3DH0A 4WJZA 2FUNB 3HV0A 4W6QA 3Q9NA 1E2HA 2WTMA 5FOXA 2ACVA 1Y3DE 2KBEA 4C89A 2P9BA 1T0HB 2HIHA 4NBSA 3T54A 4DR6B 4Y1FA 2PQ0A 5CNMA 1CUHA 3GJTA 4OKSA 4Q4JA 2OBMA 5LBTA 1KFEB 4I1UA 3VR6A 3ZHZA 2XADA 3LBAA 2ZRFA 4OO3A 1E9AA 2YHSA 2QT1A 3I05A 5DTIA 2D6FA 1TTQB 3UH0A 5EE5B 2IL1A 4KDRA 2WK1A 1AXRA 3AV3A 3ZS8A 4HMOA 2COKA 3M7IA 1LPBB 3I30X 1OFUX 4LJSA 5L8VA 4RYLA 3CLUD 2FN8A 4PU0A 3ROEA 4CKEB 2Q29A 2ZBEA 3H65A 3B8HA 3GLHA 5CBPA 3HZRA 4HT3B 4LEIA 2Z4SA 2DR2A 2KPOA 3PWZA 5TSDA 4BIMA 4OP1A 4YUYA 5LP1A 1T10A 3OQNA 3DTYA 3L4KA 3JATB 4HN9A 3IAEA 3PICA 1DELA 4HDRB 4XUEA 2X0FA 3GUUA 5IKPA 2NACA 3V2IA 4D02A 2C61A 5KKNB 1TZ2A 3FXAA 4L74A 1JDVA 3JD0A 1ZL2A 2DFLA 1V47A 1A50B 1KSJA 1TK3A 3DOOA 1RWQA 3V6MA 2QTCA 5K0SA 1VG1A 2ZPUA 2WSSA 3FSJX 1KQPA 2ETXA 1Y1PA 4Y2YA 5F35A 1CDEA 1U81A 4KO4S 4CF6A 1YA6A 4IDPA 2B0CA 1T9GS 2WUWE 2WD7B 2Q7XA 3GOQA 2B98A 3ND7A 4GXNA 3EHEA 1T0PA 4JUCA 1MORA 5EP4A 7YASA 3NASA 4RFSB 4CJXA 3E3LA 4DZTA 1ORIA 3K92A 5HX7A 2Q9UA 5ALVA 2WYUA 2PH7A 3S2YA 4EG4A 2IHZA 2H4FA 4K6GA 2FH5B 3WIBA 3ZCUA 3FDZB 1T8SA 3NNDA 4A16A 2QQEA 2XVAA 3RVNA 2Q27A 3RVQA 3WRXC 3CF4G 3G49A 3U3DA 3UHOA 4BUJA 1R9GA 1KXJA 5A4DA 4PPNA 1DG1G 3LGXA 2ZSJA 5FEMA 4W7HA 4MPRA 3WTCA 4DR7B 5MHTA 1B6GA 3HZHA 3OX4A 2QSJA 1D2RA 1WSAA 2FUKA 3PJGA 1E1QD 4D9NA 3B5IA 5BT8A 1DCTA 3ID6C 3H5LA 4YAGA 1S0UA 2NZWA 2OHFA 4MA4A 3FI0A 5AI6A 4MYSA 2OTCA 4CQLA 4IIVA 4PW0A 4PZLA 1CLEA 3HO8A 3LDUA 3K5HA 4GP7A 3UUEA 3CEHA 3MWEA 3UMGA 1LDBA 2IQIA 4AY5A 2CXSA 4FCWA 1AGXA 3GLFB 3GEPA 2J0SA 4ALNA 4GL4A 3D0OA 1THGA 1OLXB 2QTGA 2UV8A 3DVRX 3MT0A 3QVGA 2VFAA 4RDCA 1W36B 3KQPA 5JJKA 5F1OA 4IO0A 1X1BA 1EVLA 2PL3A 2ZJOA 3E3NA 3IDOA 4ILKA 2HBQA 3M1IA 4YRPA 1EVIA 4OL9A 1X7WA 1NE2A 1W4AA 3H11A 4RVFA 5EZSA 3VRHA 1U2RA 4DV7B 3GLIA 2DLCX 3DNMA 5J58A 4XFDA 5G4KB 4UNSA 5JC8A 2J3JA 4XH9B 5BYJA 3UAVA 1SIOA 2DF8A 4F06A 2R7MA 1QDEA 4PTLA 5JD6A 3OFVA 4W5NA 3UN1A 4O2LA 3B5JA 5DTJA 3ETLA 3HCDA 4Y7CA 1ORVA 4YQYA 5G0UA 4F4FA 3NTVA 3AGPA 2IPXA 5H4HA 5JATA 5JYCA 3VTZA 1ELOA 5J4KA 3V5NA 5LKAA 4FGKA 1YTUA 1T8PA 2Z9BA 3JQAB 1CY8A 1VL5A 3BIWA 2NAFA 4GRIA 2EWMA 2ZTLA 4FINA 1HF3A 2HJRA 2F6RA 1JKJA 1JDZA 2CLHB 2F3PA 3V8QA 1KEPA 1NJ6A 3MUFA 5E4FA 3U80A 1VRCA 5DCLA 2VT2A 2Q5OA 4LRWA 1OHHA 5ADWA 4HL6A 4B6QA 4DB2A 2WT8A 3UGKA 3CF4A 5IK2D 4MSUA 1QM5A 3H8JA 3JX9A 2DFPA 2GAIA 3DVQX 3JQ9A 4MWBA 1MPXA 2QRUA 1CUSA 3L8DA 2HF2A 2SNIE 4PZCA 5KSWB 5JS2A 1PZGA 3Q0TA 5ITVA 1IQRA 2WNSA 4KO1S 5K8JB 2WT9A 1CRWG 1WZCA 2A1IA 3N2EA 2BFMA 5JIBA 4WACA 1V7ZA 2WQ6A 1TYDE 2AFRA 1SVOA 2CSUA 2ECOA 1GHTA 2NSLA 2RC5A 2HQOA 2VEOA 1JDJA 3UAWA 2QTWB 3M9WA 3D6UA 3ONEA 4IV0A 4L4YA 3RANA 4B75A 1ORHA 1P5HA 1I0LA 3PVCA 3PXUA 5HR5A 3JZAA 3DE0X 3N2KA 5LVAA 4JMPA 1QCZA 1LTQA 3MS2A 2ZYIA 3KOXA 1KZGB 3PNMA 4FWBA 3SBEA 1SB8A 2DWCA 1A69A 2UZ4A 1JJFA 1T3LA 3RYTC 3G79A 2GFIA 3BRSA 4L27A 2OK8A 4KDEA 2P6RA 1F2UA 4OXKA 4QUKA 4XYEA 4QDJA 1JV2B 3AUTA 3ESQA 4V0SA 1J1ZA 2QN9A 4MJLA 5ITWA 2Q3BA 3TB6A 3V8RA 2FQWA 4ZOLB 4EQZA 1SM4A 4LG1A 4BVLA 5LQCA 3DKRA 3C39A 3DPIA 4TOIA 3GRFA 5FJJA 4ZP1A 3IA2A 1RWBA 4NENA 4WLOA 2A0XA 3TZBA 2C97A 1EKXA 1LZLA 1VDMA 2LZ0A 4NYJR 4PR3A 3SSMA 4CLOB 5ALEA 1DAFA 5C5DA 1P2UA 1WP4A 4COOA 2W6IA 5JRJA 5CCBA 3SYLA 4FMBB 4OI0A 1XVUA 2HC9A 2VPIA 2GHQA 5I5GA 3T7EA 4DC0A 3IKVA 1JLHA 1R0SA 1A7AA 2IYWA 4FKZA 3WHKA 1OZ0A 3I23A 3GQBA 3LCRA 5A04A 3E7WA 3FFTA 3QWHA 4KKVA 4IZOA 4TTPA 4EKNB 1INLA 2ST1A 1V37A 4JBHA 4BUZA 4OKNA 5EGNA 4C7XA 1Q1BA 3ZWYA