1SIOA

Structure of kumamolisin-as complexed with a covalently-bound inhibitor, acipf
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
356
structure length
356
Chain Sequence
AAPTAYTPLDVAQAYQFPEGLDGQGQCIAIIELGGGYDEASLAQYFASLGVPAPQVVSVSVDGASNQPTGDPSGPDGEVELDIEVAGALAPGAKFAVYFAPNTDAGFLDAITTAIHDPTLKPSVVSISWGGPEDSWTSAAIAAMNRAFLDAAALGVTVLAAAGDSGSTDGEQDGLYHVDFPAASPYVLACGGTRLVASGGRIAQETVWNDGPDGGATGGGVSRIFPLPAWQEHANVPPSANPGASSGRGVPDLAGNADPATGYEVVIDGEATVIGGTSAVAPLFAALVARINQKLGKAVGYLNPTLYQLPADVFHDITEGNNDIANRAQIYQAGPGWDPCTGLGSPIGVRLLQALL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic and biochemical investigations of kumamolisin-As, a serine-carboxyl peptidase with collagenase activity
pubmed doi rcsb
source organism Alicyclobacillus sendaiensis
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords kumamolisin-As
total genus 109
structure length 356
sequence length 356
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1sioA00
1PTKA 1PEKE 3WHIA 5AVKA 3EE6A 1SCNE 1OT5A 3L1KA 3DWEX 2SECE 5FBZA 4C3UA 1NDQA 1ST3A 3Q5GA 4KB5A 1WMDA 2Z2ZA 5B1EA 1SVNA 1GTG1 1TECE 1TMGE 1TO1E 1SCJA 3HJRA 1IAVA 1S01A 1LW6E 1SUCA 1WMEA 2Z2YA 1SIOA 3GCXA 3I37X 3LPCA 5FFNA 3VYVA 3DE0X 1THMA 1TM3E 3D43A 1SUEA 4MZDA 1WMFA 2P4EA 4LVOA 3DE5X 1YU6A 3I30X 1T1IA 3LPDA 5AQEA 4BWGA 1SIBE 2ZRQA 1SIUA 3DVRX 5ARBA 1T1GA 1NLUA 3AJ8A 3DW3X 1AH2A 1GT91 2PKCA 1BFKA 2GKOA 1WVMA 2Z56A 3DW1X 4HVLA 1R64A 4AKSA 2X8JB 3I34X 3VTAA 1XF1A 5JXGA 3VHQA 1SH7A 2W2NA 3T41A 1AQNA 1A2QA 1AU9A 1OYVA 1SBTA 3LXUX 4FONA 5ARDA 4CFZA 2E1PA 4DZTA 5SICE 1TM5E 4GI3A 4M1ZA 1JEAA 3QTLA 1WSDA 3DVSX 2ZWPA 1BE6A 1PFGA 5K7SA 3QFHA 3TI9A 4Z2AA 1NDUA 1OYOA 1YJBA 4OMDA 5ARCA 2Z30A 3SICE 1C9JA 1Y33E 1YJAA 2PYZA 3DDZX 3PTLA 3ZXYA 2PRKA 1ZVKA 1KE1A 3A3OA 4H6WA 3CO0S 4ZARA 1SBNE 1SUAA 4HX2A 4WOCA 1YJCA 1UBNA 2PWAA 4H6VA 1GA4A 2HPZA 1TM4E 1KDYA 2ZWOA 4DWWA 3OSZA 5FAXA 1TO2E 1GTL1 1AK9A 1BJRE 1SCDA 1Y34E 3GCWA 3GT3A 4H6XA 3AJ9A 4RYDA 4CFYA 1BE8A 5AMXA 1Y4DE 1Q5PA 2W2OA 1BH6A 2Z57A 3QMPA 1SCBA 4J94A 1Y9ZA 3SQOA 1GNVA 1SCAA 1GA1A 1P8JA 1SPBS 3DE2X 1AV7A 2ID8A 4CG0A 5AVJA 1EA7A 1Y3BE 1DBIA 1V6CA 1SN7A 2TECE 1DUIA 2XTJA 3DYBA 4KG7A 4KPGA 4OV6B 3F7MA 2WV7A 1SBHA 3VV2A 1EGQA 1MPTA 1GCIA 2X8JA 3EDYA 2PQ2A 1KDVA 1SBCA 2DP4E 2ST1A 3DE7X 3BPSA 3CNQS 2PWBA 2WWTA 3D9QX 3P5BA 1S02A 1AF4A 1V5IA 2WUVA 3AFGA 3GT4A 2IY9A 3I2YX 1KE2A 3TI7A 4B5LA 1TK2A 3A3NA 2W2PA 3ZXXA 5JXJA 5JXHA 5JXIA 4NE9A 3BX1A 1R6VA 3WQBA 2ID4A 4C3VA 1C9MA 3F49S 5I9SA 1Y3DE 1SUBA 2DUJA 1Y1KE 2G4VA 2SICE 2WUWE 2XRMA 3LPAA 1MEEA 2SNIE 1ZVJA 1BFUA 1GA6A 2B6NA 4I0WB 4K8RB 3TECE 1Y4AE 3DVQX 1Y48E 1SUPA 3EIFA 4NMXB 1TM1E 3UNXA 4OMCA 2DQKA 1C3LA 1CSEE 1PJ8A 2QTWB 3F7OA 4JP8A 3DE3X 1Y3CE 1C9NA 1GTJ1 3BGOS 3WIUA 4AKTA 2SBTA 4WOBA 3DE6X 5JMOA 3PRKE 1HT3A 1GNSA 3Q40A 1CNMA 1P7VA 1R0RE 1S2NA 1IC6A 3DE4X 1VSBA 3WIVA 4YN3A 2Z58A 1ST2A 2PMWB 1AVTA 2HD4A 2V8BA 3A3PA 3H42B 5B1DA 1KDZA 3VV3A 1SBIA 1TM7E 4DJ5X 3VSBA 4NE7A 2IXTA 4ZOQI 1T1EA 2W2MA 1P7WA 1SUDA 2Z2XA 4LVNA 5CW1A 2W2QA 1Y3FE 1SELA 3DE1X
chains in the Genus database with same CATH superfamily
3AWIA 3EFOB 4BP9A 1SCNE 5I9NA 4H1TA 3EZLA 3ITDA 4Q37A 1X7XA 1RHKA 4KXWA 3H86A 3TR5A 3HU1A 1QCYA 4KE6A 1GAJA 2QYHA 3TCKA 5JSUA 2M32A 3MGBA 3AT1A 1NLYA 2XUZA 3W8DA 2UZAA 1E5XA 3IBCA 1IAVA 2W43A 4X91A 2BISA 3LPMA 3CCFA 2J46A 4MQLA 5JNWA 3KCNA 1QHFA 1YR3A 4KK3A 1P6QA 1VCMA 2IYOA 5EIFA 1S9DA 4UPVA 1W30A 4BWGA 4E14A 4EJ2A 2ZXUA 4OVKA 4L3OA 4AP5A 1DT3A 2IHBA 3THYB 2C4VA 4Q39A 3IP6A 2GLTA 3KALA 4QPDA 3GOHA 2QTNA 3FLEA 4HGZA 3SIRA 2H0QA 4EY4A 3H7IA 3HADA 3R44A 3WLKX 3ESCA 1FFBA 1ZI9A 4L9RA 2AI3A 2OOKA 3UJCA 1XAGA 4DDTA 2PTGA 3TOZA 2J5KA 3RAEC 4S12A 4EJSA 1U2PA 4NABA 2V9CA 4ZVNA 3RW9A 4E7OA 4Q4HA 1W52X 3O8DA 1U8EA 2COEA 1PJTA 2HDWA 1EFHA 2OAEA 4X1IA 3RIEA 2F1OA 4G1EB 4AROA 5LMCA 2OVBA 2XLCA 4ARVA 3RS8A 2QQ0A 4HVTA 3DZGA 2RIRA 3AF6A 4HDSA 1YACA 1UOQA 4JOQA 3ZYZA 1YRWA 4XB2A 3EXEA 2AEEA 3E3LA 5CX1B 1Z6AA 2FSVC 2WOJA 1UDXA 1M2VB 4NOKA 2XODA 2XV1A 1MNQA 3IHWA 4QUAA 3NRBA 1T0BA 1W47A 4AJJA 4C7OB 2UYYA 1JHMA 1I3OA 1GL9B 1YULA 4RQBA 4AJ2A 2QZPA 1Y4DE 5IXJA 4OLHA 3C8UA 3V8BA 4DILA 4ZCIA 1A2KC 2E4ZA 2J32A 3OE7A 1GPH1 4A8JB 1B7GO 1CUJA 1F17A 1ZLYA 2O2JA 3IUPA 3CCCA 4INZA 4KPGA 1NSYA 2FE1A 3F4BA 4CFSA 4W5JA 1QK5A 4YV7A 2ISSD 1XZCA 3X2SA 4N8SA 2EVWX 4YI5A 5AVYA 3G89A 4MV8A 3U80A 1NURA 4NCJA 1FDTA 3AJRA 4LRSB 2IEZA 1GPMA 4REQA 1FY2A 4AW9A 5HMLA 2PUAA 5K3BA 1NZDA 1QV6A 1ETHA 1HF3A 1U3FA 3OZGA 4CM1A 1FVOA 3EQ8A 3UV7A 1YXMA 1N5MA 5FBLB 4OXRA 3LX5A 1E1QA 4N0QA 3PRJA 3NDJA 2O7QA 1QC5B 2SNIE 5KTMA 2YJZA 1L5HB 4E32A 5IXSA 3RAFC 1T9AA 3ZLTA 1FYVA 3DPUA 2ZEJA 4IRXA 1UZUA 3VKGA 1VA4A 2R25B 3DE3X 5BNFA 5C1DA 1NJ6A 5CDYA 3GFFA 4JI7B 2Q27A 1DINA 3RF7A 5I5EA 5IW8A 1DKRA 2FUEA 2NSJA 5BMVB 3AGPA 1CR1A 4FHZA 3T3GA 3VOBA 1AK2A 2Q9UA 4Q3EA 1LQUA 2CNBA 5L3ZA 1CCWA 2CBGA 1G60A 3WAGA 4D8YA 4BU1A 2ZJBA 4GRDA 3IAM1 1PGOA 4HH4A 1R4NB 2BE7A 3Q6NA 2ONKA 4BVLA 2Z2XA 4MQ4A 2CLSA 2WAXA 3WIEA 3H99A 5JJCA 4YA6A 5K8UA 3O83A 5TGDA 1H65A 2QMHA 3AEUA 3C1AA 1DWQA 1K27A 1NYTA 1DIBA 2A3RA 2KWIA 1OT5A 1WCV1 2PT5A 3EB9A 3EYAA 3FYHA 3GD7A 2FHPA 2WTAA 1MC4A 5CG1A 1XJ0A 1NBME 2PUVA 1PW5A 3EC1A 3VDXA 1KF0A 4L7VA 4X20B 3K6RA 5LMNB 3OLCX 4TT3D 2WVHA 2I1LA 5COAA 4F4DA 4MZDA 3M81A 2C3YA 1AQ6A 1SVOA 4AJOA 1OYWA 1Y5RA 1OBVA 1AOXA 5LBUA 4BFXA 4D4GA 2E4UA 1U8YA 3ONVA 3DZIA 4NCIA 4UU7A 3RPEA 4BX8A 1HR0B 4W5NA 3HR8A 4PLWA 4JSTA 4BNJA 3UMMA 5LZ4A 3R9XB 4IY1A 3ELBA 4YR9A 1A2QA 3VU9A 5DBIA 4KDCA 3HCFA 1XO1A 4KLZA 1W0JD 3ZGVA 2PM8A 3F5DA 3AIIA 4KVZA 1WULS 1XTKA 3F7NA 4A6EA 4B32A 4XSVA 1UPUA 1E3WA 1KVSA 2RGBA 3L6OO 5DP1A 2ZULA 5KWSA 3OKFA 1Q83A 4I55F 4Q1VA 4F91B 4YGXB 1KI4A 1MOPA 3NIGB 4PS1A 3ASYA 4JT9A 4OATA 2Z2KA 1J09A 3JD3A 3RU9A 4CF3A 1QIFA 3FKJA 2NTYC 4BQSA 3NGXA 1EVIA 4D57A 2GFIA 2W6IA 5L4SA 4YUZA 4H6XA 4M21A 3KDSE 4IMJB 4RKRA 1LC0A 2YY6A 4CT0A 4DN6A 1LV8A 2DG2A 2R7LA 3DOOA 1TF7A 5CJ2A 1XNJA 3RLFA 3VOSA 3VAYA 4L57A 3ZD6A 2FEOA 1OC4A 4LTNA 4OV6B 3BTUA 2UU9B 3UMBA 1IZYA 2FVXA 1O57A 2QYTA 3PFIA 2R97A 3GHYA 1M33A 1HORA 4D43A 2XNDD 4HDRB 2HF7A 5EKTA 2VAXA 1SOAA 1XIVA 3AG5A 1UIMA 4Q3KA 4Q05A 3GCDA 3C3WA 4G1FA 1L4YA 4M1EA 3EY9A 1AXEA 3LC0A 4L6AA 1K3UB 2P69A 1NW5A 3JYNA 4MHOA 4GKKB 3KTOA 2QTVB 4BJ3A 2IK8A 3BX1A 3C7KA 4DLKA 3BAZA 5EJ6A 1WDTA 2VPIA 3PFFA 1WXGA 5IUJC 3VNSA 3B12A 3H4IA 3DMRA 3UJHA 5HIJA 1I3CA 4CKBB 2QSUA 1T4BA 2JJ2A 1FS5A 1L3IA 1OBFO 1USVA 2VHYA 3ENWA 4Y6RA 5G1OA 3UXHA 1OW3B 4F84A 5KU7A 5DYWA 2IBMA 1ULZA 3SBXA 3PT5A 5ALZA 2AR0A 1JFTA 4OB7A 4BFWA 4N3NA 5EWMA 1DUVG 4OI0A 4DLTA 1V7CA 1R3DA 2QQFA 3L8MA 4MQFB 5DKFA 3KQSA 4ROSA 5AJHA 1O97C 2KM1A 2ACWA 3V00A 1CJCA 4RX1A 3ZDEA 2AUMA 4XYGA 2YV2A 1RABA 2ZBRA 1HC7A 3HI6A 4FN4A 4HDQB 3ZI0A 1IEXA 1EDEA 1RAIA 2DJ5A 2Z9BA 1B41A 4TKVA 1DOAA 4RJLA 5LOVB 1RDFA 2BFDB 4YRIA 1UJCA 4LVNA 1QH1B 2EC5A 2QG4A 2W2QA 1AURA 3TTTA 3U31A 4R83A 4YREA 5THKA 1ULSA 1X0XA 4L3WA 4NPHA 2Q5OA 3UIEA 1C3OB 3H0KA 4L95C 4OO3A 3E2IA 3F78A 1LFAA 4LWZA 5FUMA 1BFDA 1ZIPA 4Q3NA 4OQMA 3RS5A 1VA5A 2CMHA 4BB5A 5JSZB 4DABA 1VZ2A 1FDRA 1T2CA 3LRTA 2JLZA 1JLMA 2JFQA 5HJ5A 1UBCA 1YGPA 2V7EA 3L5KA 4AUMA 3IMKA 2EBWA 1MIOA 1OV4A 3KBBA 1QB7A 3WXBA 3BRQA 3FRHA 3FNGA 4C2TA 5DM1A 1JV2B 4IIXA 4FK8A 5D01A 1WR8A 3UICA 4F04A 2PA3A 1ESCA 3NEYA 1L7QA 4I6EA 3CKLA 2AS0A 4TRRA 2G09A 1M67A 2WA2A 1T8RA 2FZ4A 3HRIA 4U7PB 3Q0TA 2V0NA 3IAM6 3OURA 4KQXA 2G70A 3G2MA 1RQ2A 2D8MA 3HFGA 4IIUA 3E3AA 2J30A 5KYUB 2VHWA 3B9BA 4BQPA 3ES9A 3EX7C 5K7SA 1UDRA 3MMXA 4UW9A 4QBTA 3ER9A 4ZPJA 3RAPR 4EMTA 1RWXA 5IYZB 4I4TF 4BMSA 3AEKA 2FFRA 3FYDA 5A5EA 4HDKA 1FMLA 4Q18A 5JXWA 2AJCA 2OB1A 3QMWA 4QWWA 4RBNA 1FLAA 1D7OA 5HBGA 3DQQA 5ENVA 3TLJA 4HH3C 3WGMA 4BYGA 1YFLA 4BGVA 2D7DA 3PVCA 1KMIY 5A06A 1DZ3A 1GNLA 3P2MA 4G0NA 3VKWA 1ZY2A 1OWLA 1TYBE 3HP1A 4ZI5A 1HL3A 3S99A 2WKSA 3EFBA 2HV9A 3I42A 1ZMOA 2A9PA 1EJBA 1RQ7A 4O4LB 1JKIA 1E6UA 1FVXA 2OSVA 4PBSA 5CYFA 2YBEA 4FMDF 1NOJA 3EPLA 4UVIA 3IDAA 4AZ0A 5BN3B 3V3KA 2H8GA 3MWDA 3NVDA 3PHBE 4N0EA 4EWLA 2I6QA 3DWIA 2WYWA 3LM8A 4HADA 4MEJA 4WBNA 4RE6A 4D5GA 3LDFA 5HZKA 1GSAA 3RJ9A 2FMTA 2OV1A 4GE0A 4QYMA 4US0R 1ONOA 2IEBA 1MGOA 1FRZA 3GRFA 3MYYA 2YN4A 4MRRA 3I0ZA 4NE9A 3UMJA 2HRQA 2H1WA 4LXTA 1AGXA 1J97A 4KJZA 3SQNA 2ZKLA 4E70A 2R6HA 4UVHA 4WBXC 1Y7PA 4K9PA 4W9NC 4LF4B 1OXUA 4N6NA 4OI4A 1JVBA 1MEEA 2ZUUA 4ROTA 3ZCXA 1HSZA 1YBHA 3GJ0A 1V3TA 3U3MA 1NA5A 3B53X 1TEVA 3TAHA 4WN9A 4AUNA 3ZR4B 4DHWA 3KL4A 1P80A 1B3BA 1GOTA 1WNTA 3RRXA 3S44A 1NM5C 2QAJA 4XGRA 5DW3A 5C3MA 4JI2B 1TUBB 1UFRA 4Z3KA 1U1DA 1NAIA 2CVZA 5LDGA 3ZE0B 2ZAOA 3DE6X 4ZVKA 2W98A 4OHZA 3ORQA 2B7LA 3R24A 4FYKA 3WK9A 3DHEA 1T5SA 3HDHA 1S1MA 3H9CA 1NVBA 1LRKA 2EFYA 3A3KA 4HQKA 4HI0E 4ATNA 2QXYA 4E7PA 3AOEC 1DDIA 3BK7A 4K88A 1GAEO 3UV3A 1QG4A 1V8FA 5BVGA 3WY9A 1I6WA 1DG3A 1HZZA 1PT5A 4R1PA 1U8AA 3G2HA 1CRWG 3DKKA 1JMKC 2O2SA 4FGKA 1ZKDA 1MMFB 3RSQA 1E0JA 4D99A 3FM9A 1YK1A 1T2VA 2D00A 2DQZA 5B5SA 3FF4A 4JBHA 2A67A 4F2HA 4HPJB 3USZA 4PV7A 4DGSA 1IIBA 5CGZA 3KFVA 4O0LA 1FXUA 1RXWA 1EK0A 1XLWA 5PGMA 1SVSA 4RPCA 13PKA 2KI5A 1SR8A 2UAGA 3ID6C 4S1WA 1L7BA 5C7OO 1LPSA 2LIVA 2EP5A 3LHKA 2PMFA 4TUYB 1O4VA 5JFGA 2WJIA 1KAQA 3EXIB 3CZ9A 1SZJG 4QEZA 5B57C 4EENA 2QAGC 5JAPA 5C8YA 2PU7A 2PT9A 1M76A 2KMLA 3QKIA 2KW5A 3SLGA 3ZK8A 4Q1BA 1ZJWA 2R6JA 5E38A 3SX4A 1T8WA 3MJEA 1Y9DA 2AE1A 5EE5B 2GXQA 2TS1A 1P17A 4JBYA 2BRUC 3FYTA 3SQDA 4BNDB 1YQQA 3F8TA 2PSEA 3BA1A 3EQ6A 3GQBB 3OP1A 1U7TA 4QFBA 4BRZA 4C5CA 5C8YB 4RMJA 1NG1A 3EZ7A 2XR1A 3L8EA 3CLKA 5AM0A 4CLHA 1XV5A 1QFYA 2FCRA 4LQCA 1RMQA 5K51A 4JL5A 1EP9A 3MXTA 2JIRA 1N9ZA 4P35A 1KWGA 5TQJA 4EA8A 5JDIC 1KZYC 1TAUA 2JI6A 3PPYA 2WW8A 2CXHA 1U9YA 2IJGX 3EQ9A 4F5EA 1MC1A 3N2IA 5IEJA 2AX4A 3CZAA 1M1XB 3D1LA 2RGAA 4GM1A 1YTLA 3OZEA 3ZDRA 1IONA 5ILOA 1MAWA 4PFQA 5FHQA 4XRGA 4H60A 1A8IA 1SXPA 1JEQB 1VHWA 3LKDA 4PZZA 2GH1A 3GCWA 3ONEA 4XOUA 2IUFA 3B7WA 1IZ9A 4QTXA 4B85A 1LBIA 1XEFA 3TD6A 3ZXUB 3VKHA 4KZKA 2PS3A 1VJ0A 2VL7A 3DB2A 3GFSA 4G63A 1XQYA 4R41A 4XJXA 3ZJ5A 1Y3BE 4LGCA 4C0BA 5JZ9A 1SRRA 1NN5A 3AF5A 5KIAA 1NUHA 1UH5A 1Z6QA 1IXRC 3Q11A 4G2NA 4G8CA 5JZVA 1UM9A 1EM8A 3GLIE 2PEYA 1QQBA 4OX9B 1B0AA 2A7QA 3IDFA 4KE7A 3IV9A 4D3DA 2A78A 2F8SA 3GN2A 1M1NB 4F3NA 2WT9A 2WHPB 2OO5A 4MUMA 3G88A 5AXBA 1K6EA 2Q4DA 3AXTA 3S6JA 4QFDA 4OXIA 5GQSA 2YFYA 2EZ4A 4PG6A 5EVJA 1S8AA 5LB2A 2C2XA 5CG2A 2G28A 5IF9A 5KCMA 4CF5A 3OQMA 3CG4A 1GA6A 3ODPA 1LTKA 2GK6A 4MWCA 4L22A 4X63A 4OMUA 1PFUA 1RKBA 2P62A 4DQ0A 5JASA 1A2OA 2X9GA 1IOWA 1QF9A 4LI3X 4TKMA 1PT9A 3JWPA 2RE8A 2P4UA 3LUFA 4QO8A 3VKVA 1JSLA 1WF3A 1YI1A 1TQ6A 4LXYA 2BEKA 3K8YA 3WKDA 1OHHD 1JJFA 1RMTA 3GELA 2XGGA 3VNVA 1AT1A 4Z54A 1U2ZA 1GM5A 1G16A 5H4GA 3D7RA 1M0EA 3GDGA 4EJ0A 2I6FA 1PX2A 1JXQA 4JKYA 3CVUA 1JIIA 1ODLA 1Z5WA 4YFYA 4D6XA 4W7IA 3CN7A 1B23P 1TM7E 4BGDA 2C8JA 4AY6A 5FUYA 3UQYS 2V9PA 1HTBA 3SM9A 1UPTA 3SC3A 1F5SA 1VPEA 1I32A 1AKNA 2DFDA 3P9QA 1E3LA 3M89A 4XEHA 1J9GA 1B26A 1RC1A 4YJ3F 1TT7A 2O0KA 4KI7A 5AK3A 5DCUA 4B44A 4BP1A 1XLTC 4AZ3B 1BOOA 1WXIA 2ZANA 1OZ0A 4H0CA 2E1RA 4JU9A 3WO0A 5FBZA 2JARA 2QORA 3U3KA 3HJAA 6LDHA 1ZK2A 1Z4OA 2G71A 1WMDA 2HK7A 2VT6A 2WNSA 2ZRCA 3C5HA 3IFSA 3NHUA 5EESA 4B35A 4BRWA 1M7HA 4BE4A 3L1UA 2OO7A 2ZAIA 2IITA 3IMGA 3OEHA 5CA0A 5CP8A 3LP6A 2PJDA 5KNDD 1XP8A 4B3CA 4Y2SA 4E5UA 3UOGA 4Q01A 4V0OA 4RM2A 2GNAA 1OOEA 2XNCA 2G0TA 3TPZA 1L5FA 4KXQA 4MR7B 4DTIA 5FH9A 5ICSA 1FS6A 4DSNA 5FNVB 1BFKA 4D4LA 1SEVA 2DLDA 3IAAA 1KR5A 2H0RA 5BSFA 3FD8A 1ZH6A 3F4LA 4PCVA 5FQOA 2GLUA 1YQTA 4TLEA 3VO1A 4CEHA 1NUUA 2R8OA 3W9YA 1W581 1IZ8A 1QO0A 2AC7A 4A0QA 1JFLA 4ZAWA 2C97A 3U16A 3UMGA 1JTEA 4YJFB 1R18A 1R6AA 5K8TA 1ULTA 3CHYA 3M1AA 4M9CA 1PWHA 1TUIA 2WHRA 3LQYA 3TJRA 3KT0A 3PHIA 4JWTA 3E7DA 4RZSA 3SLRA 2A5JA 4WX2B 5KCZA 2J0UA 2X22A 4B9EA 2QAIA 1ZL0A 4NWIA 3OA2A 1H1DA 4XLLA 3RB8A 3W8EA 4UFPA 2PUFA 3L7JA 4BNVA 2AXNA 4ENSA 3CVWA 8OHMA 3MJSA 1W48A 2H4YA 3GRCA 1MX5A 3ZLUA 4CDMA 1SB8A 3E8XA 4D74A 3UWKA 4A36A 4IVRA 1W2GA 3IAS6 5EGSA 3PGMA 4EABA 2FWMX 1JAXA 4DDUA 3FHLA 4IIJF 4IQFA 3CX4A 3RRZA 2J9RA 1ETUA 4TTVA 1H42A 1HLFA 3CSSA 1E2LA 1XK6A 2A1UB 4LWPA 5ESWA 4DTCA 5LM3A 3W4KA 1SOMA 1P4GA 2QTAA 1YMUA 3IDZA 1XTUA 5IS2A 1FW6A 4FUQA 3CO5A 3UBMA 2LIPA 1T3LA 3N76A 4IUCS 2B9VA 3I6QA 2WIKA 4HQOA 5CJPA 1IMJA 1CK4A 2O7RA 3AJAA 3LWBA 1TA4A 1C30A 1YQUA 4OHBA 3BK1A 3RF6A 3VR4A 3WQBA 2C29D 3MWEB 2Y0DA 1JKMA 3S29A 2COKA 3OIWA 4IKEA 3MJDA 1UZAA 3NEPX 4RDCA 4I6JA 3B6EA 3THWB 3OQPA 4GR9A 1NQVA 2R1TA 2Q6IA 4GYWA 3U13A 5D2CA 3W5AA 1QF6A 1PJLA 2NTVA 5B1SA 3VOTA 2JAXA 4OSEA 2GZ3A 2P9QA 1L1FA 1T1JA 3H16A 1SZPA 1WW2A 3BXOA 4J9VA 1PP4A 3W6ZA 4WN3A 1QWOA 1XUOA 1PSZA 3LA6A 3RO7A 3ZIAD 2OBLA 3M9WA 1HT3A 2W6QA 1E9EA 3UUGA 1V1JA 1X7XB 1S3FA 3A1FA 2P9FA 2GESA 3BF7A 1E63A 4GMFA 3UW3A 1NFFA 2J0VA 1EHIA 4F9GA 4RXUA 1UJBA 5KC9A 3B1JA 3MYRA 1FDIA 2F59A 3BH6A 1Q7EA 3EXG1 3C6BA 2UUOA 2FZVA 1P7WA 4JB2A 2FMIA 3OU6A 4PBRA 1Z07A 1V1MA 1YHZA 3GUZA 3N70A 1UBMS 3Q9SA 5DWDA 3ZNNA 4H1VA 3GNQA 3RIGA 1VRWA 2D2VA 4EVQA 4B83A 4OSPA 1OXSC 4UVGA 4AMUA 1UF9A 2IW1A 2LRHA 2XQGA 3DZCA 4FYJA 1NW7A 3F6BX 5CLGA 2I2CA 5AM4A 2ZRAA 1Y6QA 4UFOA 3G5TA 4NDAA 2XJ9A 2H1CA 3DAPA 3ISJA 3SBEA 3TLCA 4GPBA 4JBWA 2LCQA 5HP4A 1TUEA 1WTCA 2AN3A 1CB0A 2VUIB 4OGKA 4EYOA 4V3CA 5C51B 1NVAA 3NAGA 1GSOA 3EPRA 1GL6A 4F4JA 5DYGA 4WCVA 4EAAA 1YCHA 1I2DA 2BFFA 3LX8A 4OOFA 2QVYX 4KQEA 2PLAA 2WG1A 4BWVA 1K08A 3MVEA 4FFOA 1GFWA 3AY3A 4OFWA 3HXMA 3WKBA 4FR5A 1RC0A 2I1VB 2UYOA 3S0JA 1JDBC 2NVWA 4AJHA 3P20A 3KVYA 3ZE7A 4BLQA 3L77A 2Y1XA 3W4JA 3JQGB 4QU0A 5AXCA 5CAEB 3RKRA 2YQZA 4Q47A 4BGEA 1CRPA 4HATA 1PJQA 4AKEA 4BLSA 3GLGB 5E7IA 4TRNA 5ALWA 3UK2A 2QMZA 5B37A 1JJIA 3J7TA 3SR0A 5B1IA 2CDAA 5ALNA 4QPNA 4EGFA 3QHAA 1UKCA 2F8MA 1C80A 1OYOA 2NUAA 1D2HA 2O9JA 1SKQA 1Y3HA 3KVOA 4BVKA 2P2ZA 1F2VA 5IN5A 1AO3A 1U1GA 1XRLA 2HUNA 4DMUB 1SBYA 5EJ8A 5KYXA 1NBIA 1ZVMA 5TQ0B 4MMZB 2WJPA 3CH4B 5FNVF 4CE6A 3PA6A 5ALIA 5A5VA 1ZGCA 3M5CA 5D6NA 3SE0A 1TCCA 3H84A 2L42A 3SMQA 1HDGO 5GPBA 4ZZIA 1KVQA 3VJRA 1E3JA 4PG5A 3EQZA 5TPZA 1J2RA 4TRMA 4UAJA 5CFOA 2QSJA 2HQBA 2JHGA 5D6OA 5AKHA 3V2GA 4FM9A 4ZGGA 4NYIR 1IBMB 4H1UA 5A04A 4IO0A 3Q8LA 4ZEXA 2PXCA 3ZU5A 5JNVA 1YQDA 2YFQA 5NULA 2MSNA 5LOVA 4CF6A 3OD1A 5BR4A 2O3QA 2H4JA 5EIEA 4XD7A 5E3JA 1DFIA 3ZI7A 1D6SA 5JALA 1XR3A 1SMKA 5DHFA 2R2AA 2Z2JA 4N8DA 2GAJA 2E5FA 2P7HA 2WV9A 4WUVA 3X1XA 2XRMA 3JARB 1U7DA 1QRSA 2GASA 5JRZA 3CA8A 4HG2A 1P33A 2IEDA 4AI6A 3M2PA 3P9CA 1A4XA 1RLJA 1WETA 3BJZA 2WQZA 3F7OA 1C9EA 2BM8A 4G26A 4AC9A 4Y9UA 4I1OA 3T0IA 3GJTA 3K9GA 5LR6A 2NP7A 4KYVA 4Z53A 2IA5A 1FDWA 3ONWA 1KAOA 4HFJA 5HA5A 3QVUA 1A9PA 2GPNA 4KPUB 3USCS 1KL7A 4P0PB 2BY4A 1CEQA 2BM9A 4KQ9A 4HB2A 2MSCB 4G9EA 4X84A 4LFBB 2H59A 1JEYB 1LZLA 3NBKA 4QSHA 1EWKA 3I6YA 3RSFA 3FVTA 1VYTA 1GN9A 1X1RA 2Q3MA 2PRYA 3NBZC 5E8JA 1Z4KA 4FWTA 4UZEA 3C43A 4BFSA 1E5QA 1Y6ZA 2Q41A 1H1TA 3H97A 3TIIA 1BEEA 1N6KA 2JNWA 5K0TA 1DTWA 2C54A 1PJ4A 2CCKA 2V7VA 5SYAA 3DPSA 2ZIAA 1QYIA 1Y0BA 1QFMA 3E8SA 1F6WA 4G1UC 4G5HA 5HPYB 1W25A 3QVVA 1USWA 2I4LA 2ISCA 3QXGA 3OLVA 4N3GA 4PYLA 3TINA 5H9WA 4TV9B 3SC2B 1KDOA 5HTOA 4NEQA 2PKXA 3NYIA 2PE5A 1ZCFA 4K9DA 3FYUC 3ZBTA 1MIHA 1MT0A 5LWQA 2WAMA 2NO5A 4G5XA 2JKYA 3TSCA 3D6NB 4J0QA 3DDWA 3WYDA 3HCBA 4E94A 1Z4JA 1GJRA 3CZ4A 1LB1B 3CRQA 2ODAA 2QXTA 3X3HA 2JFWA 4RZ3A 3KKPA 2PS9A 2ZTMA 1II8B 1MO4A 3LQQA 3LZ6A 4OHXA 3UMYA 4Q34A 3R7NA 1D04A 4CM4A 3ER8A 2HQOA 1SH7A 3DV9A 1M8PA 2OCAA 1QK3A 5JDCC 1OTYA 2CXRA 3KB2A 3GAAA 3N8KA 3OOWA 1OB5A 3BE6A 3ME5A 2HMTA 3ZW7A 2IQ5A 2RARA 4RESA 5EKSA 5DWQA 4YJ2B 1SU7A 1PJAA 1ODKA 1W29A 4QKQA 2NT4A 1ZITA 3FGZA 3K96A 4JIMA 4QBKA 1BVUA 1RQXA 4QHSA 3RIYA 2B1GA 2HA2A 3WLIA 1NJ1A 3TM5A 4CIAA 1X80A 1IWPB 3QG5A 3LYAA 1AY0A 3VZQA 1AB6A 2QYSA 1YJCA 3KLPX 5LQDA 1WCYA 2XIJA 4LE2A 2R0QC 4MA5A 5HF9A 4L8VA 4NCBA 2H4FA 1NVFA 4N01A 2IW3A 3B5EA 2FUCA 3WWZA 5CIYA 3DLPX 1J0CA 2DHDA 1PU2A 3DHVA 3QMVA 2CMGA 4TLLB 1A95A 3QUCA 5ITZA 4D79A 3PJRA 2E4YA 3DBLB 4TTQA 4NAUA 4ALLA 4DA7A 2ZJAA 4ZVVA 1H2YA 4ZCTA 5IVHA 1WJGA 2EQBA 3EARA 4Y9SA 4BB9A 4YHHB 1XRPA 1PFVA 3IAS1 3VAZA 3LCCA 4M0DA 1KSJA 1NMSA 4MWSA 2RAVA 1UDAA 2JK1A 3I6ZA 2OQVA 4TT3A 1G7SA 3IULA 1UC4B 1U2TA 4UJ3A 5JMTA 2VJDA 2VUUA 3NNSA 4Q3OA 4Q7EA 3S2FA 4F1KA 2KHZA 2EJUA 2LD4A 2Y6UA 3MELA 3DONA 3Q8XB 1IUKA 4OJKA 5B3AA 3UK0A 2BONA 1CFZA 1M2HA 2QE7A 1ZCBA 3TFOA 1ADYA 1R4ZA 4C7VA 3V2UA 5FWXB 4ALKA 1XAJA 1HLDA 1Z9BA 5BRNA 3ZGZA 4GVLA 1J99A 2WABA 4LYYA 3RNOA 4WOPA 5JMOA 2Q5HA 1DXQA 5EC8A 5DNYB 3DLBA 5DM0A 3CEHA 5DVZA 1PG0A 1ZSVA 2P9ZA 4QJ4A 3RSHA 4AZWA 2W8BB 2QNBA 2R1VB 1UMDA 1GCAA 5JBNA 5K8VA 2OFWA 1B73A 2PD4A 2PBLA 4ED9A 3VTZA 3R0ZA 1GGFA 4KXLA 5KTPA 3DTYA 2GKSA 4RZUA 2NVOA 1GV0A 5IKEA 2C61A 4TV9F 1UWVA 1VSBA 2DUNA 2FPMA 3Q12A 3L7LA 6NULA 4BLUA 4M89A 1MQ9A 1Y6GA 2YVAA 4UBJA 2GLXA 4G8JA 3MCTA 4Y9RA 5IX8A 3UA3A 1G9XA 4BB0A 1X86B 3K2IA 4U39A 4IMRA 3PYLA 2NSYA 3E7PA 4K81B 1Q17A 2AR9A 2IE0A 1QVRA 2C4MA 3HCAA 2F9LA 2ZFUA 1NKSA 3B1YA 3GLUA 5KJCA 1TMGE 2RHOA 2FUKA 4GPD1 4UMVA 1G6Q1 3MBKA 2COUA 3C7CB 3R5XA 1IY8A 2G5TA 1SOWA 3O90A 4ITUA 4BMZA 3Q72A 3H1GA 4AWBA 5I9TA 1FX0A 2QU7A 4Q03A 5BORA 4RY0A 4J0CA 2C2HA 1E5TA 2JKVA 2W0SA 2WSMA 2WUGA 3DEZA 3ZHUA 4CNQA 4CDGA 4JY7A 5LQAA 2PBFA 2Z04A 1T6ZA 4IXNA 1R0KA 2ZUTA 5LC1A 3EOBI 1MG5A 4KOEC 3LCVB 1XBTA 1NHGA 2MYNA 2OM6A 3VR1A 1CUDA 3WWOA 1E1RA 3U6BA 2J3IA 1OJLA 3BJEA 4XXHA 2WHPA 3T6KA 4P4UA 4DADA 1O6CA 1P60A 2F9FA 1JBKA 5KSOA 5KYWB 2BGJA 3NXKA 3QFHA 3E3NA 3G2OA 4MGIR 3VHXB 1E7RA 2BGLA 3OLZA 4YP6A 3QHPA 1UBGA 3Q7IA 2GEKA 2IXBA 4JVOA 2XPCA 2WRZA 3R75A 1RYNA 1UK9A 4ER3A 4J7CA 3ASZA 3C8MA 2P8JA 3ESAA 4MV6A 3E82A 3O93A 4JXKA 2JRCA 1BDBA 2EYUA 4PYKA 1CEXA 2HRDA 1JQ5A 4JI8B 1GADO 5IK2D 1PKEA 2IF2A 3VH1A 3B9PA 3QBJA 2H06A 1X7HA 3EEQA 3S2YA 1ZK1A 4JUIA 4Q48A 3EDOA 4FE3A 1D2EA 1XJQA 2JZNA 4AUEA 4YRGA 2FP4B 5CTAA 1F1JA 3DDUA 5KNDA 1YA8A 1OREA 2VFAA 3A1TA 3NFRA 1A9XB 3OZUA 4CNBA 3QI7A 3F90A 5GMOA 5A3QA 1ZH4A 5HMMA 4KYIB 1B8VA 3TLBA 2OENG 3U7IA 2G17A 2F3PA 4M2LA 3ZK9A 4BU0A 4HTFB 5LIRA 1JA1A 4BFYA 1U6JA 2P3QA 4B73A 4EGSA 5KB3A 3DVLA 1M0TA 1Y81A 1BROA 2D1YA 3FCSB 4Y2PA 5F78A 3MT9A 1T6XA 3U4IA 4ZCSA 3TRIA 1QS0B 4QGAA 2W6MA 2IIPA 1I0LA 3GUUA 5KKNB 1IHDA 4PLTA 4K3VA 5ALXA 5GY7A 3ZVKA 3B3JA 4M22A 3FMIA 1XRJA 1FOEB 3GPIA 3R8XA 3N8IA 4RVNA 2D8AA 4J1TC 1GEGA 1XWWA 2W2LD 3OWHA 5KYVA 1EH5A 2NGRA 4CIVA 2HRRA 2VJBA 1OAOC 2GTIA 1RAAA 1C7JA 1Y4SA 1IXZA 3KLMX 1GZ4A 2R4QA 3GRPA 3INNA 3SS8A 4RVSA 1UPXA 1HK7A 5K0FA 1BHO1 3CVXA 2O7SA 2ZIFA 1QQ7A 4QLAA 4E07A 2IKQA 2FZKA 2G72A 4HMQA 2HU7A 2Q5JA 4HPXB 5HQJA 1E79A 1FVHA 3GN1A 3PITA 3DD5A 3HKEB 4KNYA 1QVZA 2GCIA 1VXOA 3ASUA 2O8BB 3H2GA 3EZ2A 3QLUA 3IR6A 4PC2A 3AW8A 3FWHA 4MVJD 1WA5A 2F62A 2ZIWB 4B40A 5CA1A 4U9UA 5LJLA 2Q4EA 5JQGB 3L1KA 2ZDGA 4TSKA 1ST3A 3H9EO 3M8KA 2Y6VA 2QHXA 4NHEA 3N6XA 4NDNE 5G4LA 3GCXA 1LJUA 4IZHA 4YXWA 2O7VA 2IQIA 2ZWAA 3HKBA 4M0UA 3OEEA 5FULA 2PN1A 3CUEF 1FSSA 5IASA 1CLEA 3VISA 2BN4A 4MV7A 1J4AA 2Q4RA 3ETGA 2C0QA 2AN9A 4N3CA 3NT2A 2YW9A 4M0MA 2EQAA 1E2MA 2J08A 2VKQA 3EH1A 2H16A 3MD9A 2EU8A 2DBVO 4F38A 1B8OA 1D5WA 2IC5A 2FK8A 3V7YA 3FPHA 1EIWA 1I94B 2C2YA 5LLTA 1XF1A 4NJOA 4M0EA 1IY0A 4AF8A 3A06A 3NPAA 4FEAA 5EMNA 2KQUA 3ASVA 4GI2A 1LSSA 2NACA 1ZINA 4YJHA 5B6JA 2D0PB 3OFKA 4IHQA 1GTSA 4G89A 3JU3A 5EZ6B 2L82A 2VCYA 1PO7A 1X2BA 4X62B 2BTQA 4MCJA 5BW5A 3Q8KA 1C41A 4KN8A 1NSFA 1WZNA 3TS1A 1I01A 3E1GA 4RY9A 5J9FA 4XD2A 1CUVA 3MWJA 2P4SA 3ZHZA 4KRYA 2VLBA 3ACDA 1GA4A 3BWEA 2Q8QA 4O08A 1IOLA 2G9QA 2X76A 3A32A 3KAPA 1FP7A 2KSQA 4YUVA 3SBDA 3ZC3A 4OHPA 4A3SA 1KS9A 3LGXA 1V2HE 1EFTA 5GIOE 1P1KA 4B3HA 4C7KA 1GSHA 5DSZA 2GRJA 5AT1A 4AIIA 1DX9A 3OQJA 4MR8B 4D0LB 1O8CA 5DLQC 1M0SA 2ZT5A 4DA4A 2C9YA 2AG0A 1GUAA 1UFVA 1YZYA 3BF8A 2A0YA 2E6KA 3WQSB 5K0BA 1DS6A 1MJHA 4L08A 4QJBA 1YUNA 3RFXA 4IDQA 3UENA 4HNVA 2J9YB 4HJRA 1XZIA 3IMCA 5HQ3B 2LDBA 2C7PA 5I7SA 1V5IA 5I7HA 1XMOB 2J6CA 2IH4A 4V0RA 4K6OA 1TM2A 2F43A 1T36B 4KQGA 3UXEA 3WB0A 1ZM3A 5DJ5A 2P9EA 5ABPA 5I4KA 4Z0PA 3FRIA 2QD1A 3CJTA 1Y3DE 4GWLA 2DUJA 4AG6A 4DIKA 3BERA 3DH0A 3JASA 3GJYA 4ZVUA 3A9RA 2Q5QA 3G85A 2PFGA 4YYEA 4BPRA 1YE3A 3GLSA 4KI0A 4EI8A 2VF5X 4IIGA 4QXRA 1MAAA 5IKXA 3KKMA 1VMAA 2QI9C 1OGJA 3K9QO 3LUKA 3P0JA 3L8CA 5LB4A 2HI0A 2B83A 2QM3A 5CB6A 4QUEA 2Q2VA 4QYXA 1JJVA 2GZSA 2YXBA 5TQ2B 3ROEA 3RVKA 1XTBA 2GYVA 3BWXA 3G7UA 4YNBA 4MI3A 3EY4A 4WCFC 1N5JA 5IT9A 3AUAA 4P3YA 3FAKA 3C85A 1R50A 3OZXA 5F9HA 4GYJA 4Y2RA 1XFAA 2XMDA 2OEPA 2IWRA 4EDHA 2WKWA 4BJ1A 3ZVMA 1B2RA 4I9UA 1O9BA 4FUTA 4AJEA 3SC6A 1JHAA 3U9LA 1F12A 4E6EA 3DCIA 1Y8ZA 2J0QA 1CRQA 4R84A 4N0DA 4TXHA 4ZDJA 2Z4SA 5AVKA 1FU4A 4JI5B 1CUGA 4F2DA 4XSHA 4CQLB 4CWAA 3A2LA 1I1HA 1MX3A 3A6DA 4TMKA 3TOVA 5DGTA 4Q9LA 3NCHA 1W1IA 3AC0A 3C3BA 4QXOA 1K8QA 1OH7A 4RSRA 3ZHYA 2I55A 3CZQA 3L07A 3WV4A 3PTAA 3GJ3A 2ZVJA 4MUXA 4P08A 3IDQA 1LI4A 2WNIA 3WNQA 3COZA 1Q0SA 4ML3A 3B20A 1VB5A 2VDRB 2JFNA 4BKPA 1PK8A 4BE9A 4ZPXA 5KX5A 1C5KA 1N2XA 1M1ZA 1TW2A 1X74A 1UKZA 4QDOA 5HFAA 1OBCA 5AM2A 3Q6MA 2ALJA 3OICA 3ZJ4A 3NTLA 3I34X 1CIVA 2G06A 4LY3A 4QVGA 2HCJB 4ZOBA 3IAXA 1SBTA 1HDZA 4OAPA 1UKYA 1FBTA 3EHEA 3GEMA 4MXDA 4CKCA 3G0GA 4I4TA 4M53A 3L7OA 4CLRB 2QVXX 3COYA 3MCUA 2XMGA 3DYIA 1K5GA 1L7AA 3LDAA 4MMYB 4V38A 4YGYA 3QBVA 1IWBB 2QG6A 5FPYA 3RKSA 1XN4A 4LYGA 4J0EA 2QL5A 2VVTA 4ADSG 5CFMA 4RVCA 2PO5A 4OHFA 5E9WA 1V9CA 5JHGB 3VJMA 4ME6A 3UCEA 1E58A 1NJSA 2RI1A 4MB6A 3WRXC 5HTKA 3GFVA 1MRNA 3OQHA 3PPXA 4UREA 3TIGA 2VQFB 1YFJA 1TM4E 4PM4A 4DLWA 4DWWA 3IV7A 5FTKA 4QNRA 1LSUA 3W8NA 5HCUA 5LIPA 2JLUA 4MYSA 3HV0A 1OFGA 1OZAA 4QBGB 4TMFA 4MRMA 3CSDA 1Y8QA 3DF7A 5CB4A 3EVEA 1HYQA 5KHAA 4LECA 4P33A 4QOIA 3ZNQA 1Q3TA 2JHCA 2GPWA 2Q8NA 4TWIA 4YT2A 4RMGA 2AFIB 1SUWA 1E2PA 1K4YA 3JYPA 3NI2A 4GZMA 1DIHA 1PGQA 3NKLA 2XB2A 5A2QA 4QT0A 3DEFA 4F11A 4WZAA 1R8SA 4K6GA 2QTLA 1JG1A 3KC2A 3V9PA 1L4FA 2R60A 4Z8XA 3UWDA 5IAAA 5KYGA 1U1IA 4AN0A 3DL4A 3MJCA 3CZPA 4CETA 3M4ZA 4J9UE 1AMNA 5EERA 3C70A 3KJFA 1J21A 1IBKB 3IRUA 2G1KA 5KTOA 2EBHX 1N6RA 3KUKA 4G2TA 4JLKA 4BQFA 4BQRA 1YR1A 2ORVA 4EUFA 1KEZA 4E13A 3TRFA 2Y99A 4WNYA 3ZWVA 1U0SY 1HLPA 2I3GA 4YASA 3NDBB 3T7TA 1RI1A 1U6IA 1AUPA 5JJBA 1OI3A 1YF3A 4H1HA 1XVTA 3W79A 5DMXA 2I2AA 3IH5A 3E48A 4NYJQ 2Q0HA 2QW1A 4HT3B 2H4ZA 1NY6A 1OX5A 1OGIA 4HGPA 4TMWA 3TZBA 1L7NA 2VHZA 3HB4X 4QM6A 4L15A 2IUTA 3F6PA 3RM3A 4L8GA 1YDHA 2FPGA 3TL6A 3JAMA 2RB5A 3Q3VA 3DWGA 3NBFA 1I3KA 3ZCPA 4ZDKA 2FH5B 4CEJB 4XX0A 3ZY3A 4O4IA 4E08A 1QRUA 4MYUA 1TJYA 1UPAA 1ZXLA 3RASA 3AMVA 1G8YA 4DMCA 1JRLA 2V9ZA 4JN6B 3TLAA 3B36A 3FUTA 4B7XA 3IBGA 4X90A 3RRNA 2EXXA 3CKMA 1BYIA 4IGIA 5GTDA 3ZV5A 3AU9A 5L8VA 2F1IA 4M7RA 1SM4A 4CM9A 5IZCA 3ZBUA 5KQGA 1DBRA 1BN7A 1J24A 4MQ5A 2UVPA 4FI3C 3T7RA 1NQOA 3DYVA 1RSZA 4QJ5A 1KY3A 1GNQA 4X65B 1SUCA 4J1QA 1DV1A 1JQJC 1RLIA 1Z5UA 1M2JA 5ADVA 5GZ3A 1GU7A 4IHAA 1X8XA 2D5AA 1ZJ6A 5COQA 4AY2A 2F3SA 4X3CA 4XWAA 4REOA 3LHIA 5I3CA 1W8IA 2ZRQA 1J70A 4F1WA 1SIUA 3RFFA 1ULUA 1UBUS 2CKMA 3SZOA 4MVCA 4R7GA 2KLBA 1N2CA 1LTHR 2EWVA 4MEAA 1Y8RB 4MUNA 4JQSA 4OFBA 2C9ZA 1C4XA 2QMUA 4MVWA 3HXTA 5EZYB 2E21A 5CW2A 2HU5A 3PRHA 1VZ3A 4O4HA 1GHTA 2PX3A 1OAKA 3DV0A 2G5PA 2P9BA 3CYFA 4B3XA 4P3XA 3B13B 4ZICA 5AUNB 4HDSB 2AUNA 4W1RA 4LMRA 4EB6B 4DLPA 4O2RA 3RYHB 1SVKA 5IP5A 5FPQA 1JSRA 2HDNB 4N8EA 4AMVA 1FMCA 4LE1A 2CL0X 1SC6A 2I22A 4H6WA 1H2BA 2AKYA 2C59A 2FR0A 3FDIA 4MS3B 2JHFA 3BD9A 3N07A 5EMMA 5IABA 5A3VA 5DZSA 4Q82A 2QTGA 2GHQA 4U2GA 2DKFA 2K7ZA 3AR9A 4U9IS 1YZUA 1DZIA 2YS6A 3TTXA 3RGGA 1TADA 1L1QA 5T64A 1W36B 4JA2A 4Q4AB 2LCFA 1NLZA 1DBWA 1PEYA 4LF8B 2NAPA 4I5FA 3VX3A 2PSFA 5BNZA 2F1RA 3QEBZ 1X8LA 3EHDA 4MWTA 5T4HA 1ZXBA 3O0TA 3EXHA 3FWPA 2R11A 3G9QA 4RFSB 4UDNA 1LVUA 1UFOA 5C1OA 1R8QA 4QLOA 4QDZA 2AKEA 5CDGA 4HOYA 3C3EA 4H7DA 5AVSA 3R0JA 4COOA 4QDTA 1WP4A 3CPEA 1XMVA 3KOWA 3R6LA 4CQNA 4KX3A 2IZZA 2VTVA 4CMKA 4RS3A 2OQRA 4KPUA 1NBMD 3TMYA 2C2GA 2NNLD 1I4EB 2G07A 4LYEA 5BSHA 1KYZA 4DLBA 2AR7A 4XB6B 1H1LA 1CJUC 1KXZA 3RANA 2IS6A 5EHQA 3KSBC 4PHFA 5KPDA 1N2SA 4A6DA 4WY8A 1E2NA 2AT1A 1K7EB 4NX2A 4Q19A 1W73A 2LPMA 4OYLA 2ZCVA 1M7GA 1U3VA 2ZG6A 5I7UA 3IBSA 3II6X 3LY9A 3VC3A 5C5DA 3N53A 4UCQA 3NM5A 4YECA 5AK5A 4IPTA 4KQHA 5K0EA 2GFQA 4UTOA 1YBFA 2REQB 4YQZA 1L7MA 1CUEA 2O3TA 4TZTA 2PUHA 4G86A 3MLAA 4RUKA 1C0IA 2BFBA 4YRQA 3W04A 3DR3A 1L5WA 3EUFA 4NFLA 5CFRA 4R16A 4R1SA 5JNSA 1PS9A 1YIDA 2XMPA 1ZW6A 4RO0A 1E9FA 5DLYA 5KAMA 1DC5A 1E18A 1K2WA 4QXPA 2HFJA 1RC8A 5DHAA 5EQDA 2KBFA 4BY9E 2AFHB 4LZAA 3VHXA 3QX9A 5JAZA 4JLPA 2B5VA 4REMA 1QHIA 3I45A 4WK4B 3QWBA 1A8PA 3P0FA 4FFRA 4WJLA 2IOHA 3AEXA 3PG5A 5IBRA 3LLUA 4Z4GA 5F4BA 1SIOA 3AI7A 1BS2A 2DKOA 4D1YA 1L4MA 2D7CA 2ZZMA 4KLAA 3AP2A 2R9VA 3ET4A 2XT6A 3LRPA 4EUHA 1PVDA 4F96A 4YX9A 3CVVA 1HDRA 2GXUA 3QELA 3UJDA 2I3DA 2JGIA 1PD1A 5ALEA 2A0FA 3ZZMA 3NHSA 2CMDA 2OG2A 4E5MA 5TF0A 1GTMA 4UOZA 4XE5A 2YWFA 4RK5A 2XMZA 1N77A 2IHYA 3UK6A 2O2CA 4M7OA 1GG5A 2H2FA 1Y1RA 3DUFA 3T8YA 3UY4A 4MUBA 1U1CA 4FU0A 4C7BA 3ND8A 4FMPA 3VSCA 4NBWA 1B2LA 3EASA 1CP2A 3U4QA 3WL3A 2D2FA 5A5FA 3LK6A 2F48A 8AT1A 1WXDA 2A84A 5TJHA 2HNAA 2ZTUA 3VZSA 4IILA 1Z75A 4X45A 3BWBA 4C7XA 4CKBA 3FMPB 3AQIA 3KUDA 4EPTA 3ECCA 5BSKA 2QVGA 4H6VA 4UHKA 5HNKA 1IXYA 2CV1A 1KY5A 3IOCA 2NU9B 2A9RA 5FJJA 4E1VA 4BBPA 2FUG1 1TJ5A 3RUHA 2N75A 5F1OA 5HKOA 3TUZC 2JA1A 1PL6A 1R6DA 2N1MA 4ZJPA 1E2HA 4JJ7A 2Y71A 1EUDB 3WGJA 1ACJA 3TM4A 3G82C 1GZVA 2H9AA 3DMYA 5DX1A 3GGJA 4LNHA 1PEDA 3SX2A 3GRUA 3UCXA 3GNLA 1U3DA 3E27A 5ER9A 3RUEA 2ROQA 5BR7A 5C4MA 1SG9A 3AIKA 3UJ9A 5DBOA 3UTDA 1ZNXA 1QIDA 1I7LA 1JS1X 2YXDA 2W4MA 2YY7A 1E6LA 2D5LA 2WWTA 3GBPA 4AS2A 1XA0A 2WG0A 2Q6TA 2X9VA 1IFXA 1P1FA 1YB2A 1A27A 3N39C 1F51E 2ZJ3A 1HURA 4F9TA 4PBTA 1XJ5A 1R6VA 2XHZA 2BPOA 3O4JA 4K9MA 1CB7A 2JGNA 1ZS9A 4D80A 4P32A 4WGFA 2SICE 1GGKA 2WOOA 2SKDA 3A0UA 4IJ6A 1U3TA 5HW0A 4LDRA 5G4KA 4KSYA 3GFOA 3E0XA 2HMAA 1CS0B 1JG7A 4TS3A 1ILEA 2PLWA 3FWNA 1AZSC 1G5TA 1HRKA 2J3KA 4IQ4A 4OHOA 4HP8A 2VHXA 1RYBA 2BR3A 2CFCA 4MUIA 1WBBA 2IZ7A 3J7AC 1FNBA 2P1DA 1LPNA 2XCSB 3BYZA 4I36A 2A4MA 1YDMA 5DNEA 3DKIA 4QQ8A 5BQOA 4ZZ3A 4Q93A 2EW8A 3SWWA 3KVRA 4LDZA 5KNLA 3EIXA 3MTJA 4CMJA 4KV7A 5BP7A 4BP8A 2JIMA 2ORIA 3BGWA 3CUKA 4PU0A 3WWDA 3ZEAA 2YL2A 3GLHA 1U99A 4YJHB 3R2JA 3ZE1B 10MHA 2OHHA 3V8PA 4GT1A 2BFNA 5DX0A 1H3NA 2OAP1 1I8TA 3VZBA 2VDPB 4XPZA 3ZVRA 1RPTA 4OREX 3R9WA 4EG3A 2IY8A 1J49A 1ECGA 3WS7A 5CCBA 3IESA 1SQSA 1GTG1 2G76A 2OV8A 2P3OA 4NENB 4PWYA 4XARA 4CU5A 4YUXA 2QLMA 2V96A 1NRXA 4Z1MD 3PLNA 3IT3A 5HXAA 2BRUA 1G2OA 3E5RA 1B0UA 2PSJA 3LDUA 3NRCA 1JQLB 3H2BA 4EF5A 4U9HS 1EFVA 2C9DA 3T9EA 621PA 4F4CA 2FA9A 1A2BA 4FBGA 2J5XA 1ZX1A 3UW1A 1R5BA 3Q4GA 1ZIYA 3QH4A 2GXSA 4NNJA 4R81A 1E2IA 3RTBA 1KWKA 2O19A 1W5BA 2YNMC 4KE9A 2E49A 3K35A 1M3SA 2JIBA 3G5UA 4I7EA 2ZVQX 1R10A 2HSEA 1O5TA 1NXPA 2D59A 3OC0A 4F5DA 1FLVA 3DZHA 4KFSA 2VK1A 1BCRB 3VRHA 3FPLA 4ZHQF 5JMPA 3OLXA 1Z7EA 3IOYA 1MBZA 4P4TA 4DPKA 1JQDA 3AEKB 5IAGA 2Z30A 4K46A 1EEHA 5IG2A 2RD2A 1ZN7A 1E7SA 3O2JA 2CF6A 5FPKA 1XTQA 1E2DA 5BW8A 2EV9A 1BEZA 2X0DA 1OX4A 2O4CA 2E37A 5EEHA 1VLZA 3F6EX 1U9JA 3RRJA 3WNZA 4D97A 2DXIA 4FIDA 1VLJA 3Q2KA 3SEFA 3ZOKA 1LVHA 2I6GA 3F6RA 3I3OA 1UBFA 3ZYCA 3BJRA 2AYYA 2CGEA 5CCEA 1FQOA 3PX2A 4YMHA 4OYHA 1JLSA 1FYWA 2ZOSA 1JR3D 3K92A 3ICCA 1WY7A 4YRDA 1X7ZB 2EOAA 4FDVA 5F4ZA 1C9YA 4B5LA 3C74A 3KJEA 3VJLA 3OM0A 2WG2A 1IWOA 2QX8A 3Q87B 5E0KB 5B4VA 1HM5A 2IYUA 2SKCA 2ZI5A 3NZEA 3OX2A 3R0IA 4QGHA 5H81A 3T3PB 3AF4A 1WQ4A 5K3FA 3ZBQA 3CGGA 5EHZA 3AEQB 3VTFA 2ZWIA 2IH2A 2DFVA 2ONZA 4RD3A 4UVDA 3ZLVA 3OY2A 1EJ6A 1QPBA 1G2PA 4CG2A 1UWLA 2BWJA 3OZWA 1FQJA 1XQ1A 3KEOA 3C3CA 3LNTA 3QEKA 3WQHA 3GJ4A 1T0HB 3WDMA 3T3IA 1P18A 3HEMA 2NQ8A 2NUTB 4CTJA 4TS1A 1V3QE 2O2EA 2QLBA 1US8B 1W85B 4ZA2A 4R2KA 1CT9A 1N0UA 2WINI 3UUFA 4AN4A 2ZB8A 3D6JA 1Q7GA 5JV5A 4EEXA 2JLSA 4TUYA 2GS9A 3C4JA 5B1YA 1THZA 3SPXA 4Z9YA 2EJCA 4NCAA 2AOUB 1XZJA 4J2OA 5ICGA 4HNQA 4I1VA 4WD3A 1HPLA 5EIBD 4L8YA 2Y1CA 4F92B 3UTCA 1WIWA 3IP7A 1DCMA 1PLLA 4ZEWA 2H54A 1HDCA 2VK8A 3HY6A 2ZPUA 3WHLA 2F3UA 2I33A 4ENRA 2VPXA 3DS8A 4UCWA 4JQZA 2CHEA 2WR8A 2JIQA 3H5AA 5EP1A 5IKOA 2G1AA 4ZTBA 4C7JA 2HM7A 2CXPA 4PLVA 2IXTA 2RG1A 3FCOA 5ALDA 4AURA 4TTJA 2MJLA 4MYCA 1CY1A 1E1YA 3CW2A 4IH9A 121PA 4HGOA 4BNTA 3JZDA 1Q1BA 3GOQA 2FSPA 5H02A 3JQRA 2VQDA 3PC2A 3V8VA 4J49A 4FGZA 1D1SA 3E1SA 2QTCA 1OFUA 1KSFX 4YT4A 1R15A 4XYEA 3LUPA 3EZYA 4WV3A 5T4BA 3EXIA 1W34A 1W59A 2Z9DA 3AHIA 1V8BA 1EVZA 1EGVB 5DW0A 1N57A 1RJFA 1ND5A 1DRKA 1OH5A 1CQZA 1IB6A 1PR0A 2FG7C 3U26A 4OIMA 1T1GA 4Q7KA 2BTQB 1M1YB 2CSUA 2VJMA 1GT91 3VM6A 2QROA 3QG1A 1TU0A 3WMEA 2BM1A 2VT7A 3BRCA 1GFSA 3U5TA 1ZSYA 2WEKA 1XZGA 1AB5A 2NTJA 3AR8A 1FMTA 4HDKB 1QAMA 4MI1A 4P9NA 1A7KA 4BP3A 2W2NA 4M1TA 1EM8B 2GFHA 1IOVA 3EBLA 5A1JA 1NF8A 3CUUA 4YRMA 1ZN8A 4HN9A 1SHTX 3GLIA 3W7AA 2IP1A 4JFAA 3DZ8A 3QTLA 3CVYA 2ZRIA 1YB7A 1WSDA 3F6YA 4WNAA 3U4AA 3A6JA 3WVNA 1X70A 2DLCX 1BXRA 4LI0A 3CX7A 1K8ZB 3C6ZA 4E15A 2REXB 4Q1DA 1Z16A 1ZVKA 1PNVA 5FORA 3VYUB 5JVDA 5MFZA 1WHTB 3HWWA 3RC9A 1K6JA 3L7DA 4LWOA 4X44A 5M7EA 1KIFA 2YWXA 2SCUB 2WVJA 1NLFA 3IEUA 4YUWA 3JATB 3KKZA 5MFPA 2ZVPX 5H82A 3WC4A 2NQ2C 3EWAA 1JYEA 4PPYA 5FADA 1E8DA 2PKEA 3LO8A 1T0UA 4KO3S 4LK2A 4OTZA 3W5VA 3C4QA 4K03A 1JHDA 4FMDB 1AUVA 1BKDR 3ZWWA 1DBIA 1JHPA 1Q1NA 1P0QA 2IODA 3E9NA 4TMYA 1NNI1 3UMVA 1P3JA 1ORWA 1N92A 1BDJA 1ISMA 1U2QA 2YWDA 3KZCA 1XZAA 3WLPA 5E6UB 4UTZA 4C9BA 1SKUA 3MXOA 2RK3A 1F4LA 3L7CA 3VYWA 2CK3A 3P7MA 3EJ6A 3LVQE 3FBTA 4Q1FA 3PWZA 2DOKA 2R84A 1SHZA 2ZE7A 3EA0A 3GC6A 4L72A 2EZ8A 2J7PD 5E1OA 4DBZA 1KDPA 2PZJA 5AJXA 1BH2A 2Z9CA 5IJXA 3OZ7A 4V39A 2Q5EA 2V4UA 1L7PA 3QPVA 3ZDYB 4QYSA 3W2HA 3NNNA 2FFAA 2QRVA 2R68A 2C77A 2P0EA 2Y68A 3TO5A 1XHLA 2XEDA 4EKYA 5LUAA 1W19A 1XTTA 1QFJA 3OETA 4RETA 5FOVA 3UHPA 3D7NA 3UOAB 4M55A 2E2WA 2YZ2A 3TIFA 1ABBA 2NP6A 3HJGA 4L4YA 3V6LA 1M7BA 3BEOA 5K0SA 1O03A 2VHEA 1RI4A 1QM5A 4TV8A 4HWKA 1WWKA 4GLBA 4JKOA 1QO7A 1RZ3A 1OXMA 2D1FA 4TT8A 1XMJA 2Q1XA 3A3PA 2HYDA 2G8LA 2W42A 1UK7A 3LF2A 4PF1A 4N0MA 1KMCA 2IWHA 4RSMA 4ZI7B 2YCLA 4PGHA 3UXYA 1VG8A 2P1RA 1PR1A 1HQYE 2ASVA 2H4XA 4JBLA 3KKLA 1E5DA 1XPJA 1KK2A 4WE3A 5HZGA 3B1VA 2R6DA 1BS1A 5SV2A 5CA1F 1Q95A 3VR5A 4QQFA 5FA5A 3A3YA 4ENQA 1L4UA 2OQ2A 4PG8A 1OC2A 4ESHA 1FNMA 1IE3A 4OCZA 3L92A 3SBOA 4DC0A 5I6DA 3QX3A 1ZIOA 4HAWA 1QZ3A 2B4RO 2HF8A 1QV7A 2QUAA 5FLXA 1JH8A 5KOYA 3HYNA 1X7DA 1X94A 5LKRA 3GEGA 1TXGA 1ACLA 3H7AA 3CJQA 1P9LA 3PC7A 1EVQA 5F7JA 3ESDA 3GROA 1XU9A 2Q9BA 3CY6A 1T3ZA 4MUGA 4EGCB 4OHKA 3LUGA 1P1RA 1R0CA 3U61B 3ZLJA 3MS7A 4R7ZA 3H1EA 4W7HA 4DZTA 5IJWA 1TFUA 2W6ZA 3C6QA 2CMFA 1H94A 4MW9A 3T4UA 2CUNA 4DBVO 4P81A 5CB4B 5GZ1A 1NW9B 1TC1A 4V0LA 4EFMA 3AVVA 4FQ8A 3RUPA 421PA 4K2AA 5JPCA 5ALRA 2H65A 4O59O 4PAWA 1B6GA 2AFIA 4GC9A 4JGBA 1Z3CA 1N5RA 1S2IA 3PIDA 1G21B 1S5PA 5AJYA 3NVAA 4NP6A 3TNYA 3TZEA 3O75A 5HE8A 5CEJA 4W9RA 2EKPA 2O0MA 5J5AA 1SQGA 4PPFA 3H5TA 3HA2A 3KDAA 3STWA 1VE1A 4YROA 5DULA 4RIIA 4MK4A 5DPMA 4DPLA 1Z0IA 3MLEA 3BMQB 4R9RA 1R37A 3I53A 4OUKX 3W2GA 3AESA 3D7SA 3W4IA 4DJDC 4Q7LA 2IPNA 1E2EA 3D8BA 3WGZA 2FPLA 2X86A 5DMHA 4BTEA 5CBPB 1T3TA 5HM8A 1C7QA 3UQZA 4LOKA 2BJWA 4OM7A 4X93A 5LDHA 1HG0A 4MJ7A 2NZYA 4OQFA 3WTCA 2AOWA 2QLLA 1XLTA 3AVQA 3COSA 4GLFA 1UWCA 3CUSA 3B5JA 2B8TA 5B7NA 2EJVA 1YB5A 4NE2A 1K9SA 3SHOA 4C6SA 4IDFA 1PDVA 5JXHA 3NBYC 1H0RA 4B6EA 4Y2HA 1HNNA 5CT6A 3OTHA 4ZVRA 2P68A 1KXJA 2JJ2D 3FETA 5IH3A 3LPAA 4HNHA 5JISA 1ORTA 2RHTA 3CE6A 4MPJA 2HZBA 4ER5A 1DAEA 5IAOA 4XGIA 4BO8A 4LTMA 1MLDA 2VZEA 4BN4A 3G2PA 5HCIA 1KERA 3BZWA 2OCPA 2QD2A 5JS7A 2X8AA 2GI4A 3HG7A 2EJTA 5JZOA 4E4RA 1QX4A 4B7CA 1DQZA 2ICAA 1P2FA 1X9IA 3Q1LA 2ZYSA 4EHKA 5BXYA 1YZHA 3BFKA 4IF6A 3ICEA 4H4CA 4HMOA 2ZQZA 4ILKA 1UOOA 4RU1A 3NM6B 3LYUA 5D3ZA 2HNBA 5TMBA 1SQFA 1X1BA 4GPIB 2P6MA 2Y4OA 4YWJA 7REQA 5L3SA 4ZGBA 4GDFA 1PR2A 1PVOA 4DCVA 2Z3ZA 3DAHA 3UK1A 2CY0A 4O02B 1I4DD 4BAZA 4E2ZA 3P96A 3SZGA 1E2JA 1M54A 5AVOA 2J4DA 2NZVG 3BGIA 4UPEA 4C6RA 1ZVQA 3KJIA 4UUOA 1CDOA 5BQFA 3HU2A 4C29A 3RJTA 5KSYA 3LPCA 3VX4A 4IMPA 3U4MA 3AIMA 1HV8A 1E69A 3WNCA 1TTHA 2RC5A 5AOCA 4X41A 3DE5X 4RZIA 4PPQA 1F0PA 3G8AA 5C35A 5EIXA 4JL8A 4MWGA 4MV3A 1WBDA 1S3GA 2EP8A 2JHPA 3PXEA 1J8YF 1QF7A 4KWCA 5IC6A 6ADHA 1T9DA 4R98A 2DT5A 2IU3A 1J07A 1WVIA 2XBLA 1C14A 2ZYGA 2DJIA 1A9YA 4P5PA 4RKQA 4U5QA 3H2IA 5KX5F 3TG2A 3GLGA 1W93A 2B1IA 4GI7A 2NO4A 1XDBA 2Q49A 2ZBVA 3TLGB 2OZLA 3HUTA 5K6AA 3PQFA 3T5PA 1UJ5A 4K6MA 5K8IA 4D26A 4PNPA 2IHKA 3MB5A 2WKRA 4LF5B 2ZRDA 5FOTA 3Q5EA 2CDRA 2H11A 4OYYA 4Q9IA 1Z22A 4AY4A 1HFEL 5J1SB 2G6BA 4R0VA 1VQ1A 2A1UA 3D7LA 4D4KA 5JT1A 2VCHA 4Z4EA 4BO6A 2FLVA 3JARA 3V4FA 1KJZA 4L74A 5I5GA 3KVNA 1XSEA 2A92A 3FPBA 1AHHA 1OX6A 3LTNC 1VPDA 3KPYA 4DCSA 4IDDA 1BOFA 1V3UA 2CDNA 4YMWA 3A58B 4JYBA 4QFCA 4EITA 3HCOA 1G1MA 3C48A 3ZXIA 5CAEA 1IRIA 2BFEA 1X38A 3EA4A 3A9VA 4L0CA 2HNKA 3MOGA 4KPYA 1WXWA 2P77A 2ILVA 1NXSA 2L17A 4C7MA 1CUWA 3O21A 2AZDA 5K0GA 4KDFA 1K2VN 3CV3A 4MDFA 3L7BA 1NVEA 2H07A 2HEGA 2IYXA 4TLBA 4X1YB 4B87A 5DM70 1TYDE 1HEYA 1YB6A 5FFMA 4C0JA 1P0PA 2GARA 4FNGA 1IPFA 3DHYA 1KI6A 5F1PA 2GJAA 1DWUA 1VB3A 1DTWB 3A6FA 5AHKA 3F49S 1NJ2A 3KB1A 3T5AA 1U9IA 1PK7A 4A73A 1V4NA 5TGZA 4C1BA 1NP6A 4B5KA 1KJQA 2YTZA 5JNLA 3KEQA 1K86A 4MKRA 5GOTA 2GJ9A 4N7MA 2VDLB 5AUOB 1QGOA 1RBMA 3PR3A 4FT4A 3EULA 3LT0A 3HYTA 4G4SP 3D6VA 4IX1A 1QC5A 4JC8A 3WJAA 5HCNA 1KI1A 3PV0A 4EF4A 3WI7A 3T3DA 3HMKA 3MSXA 1CERA 2AFHE 2IYVA 4TWZA 4C89A 3NBQA 1QIMA 3N2LA 2VSQA 4RTNA 2R8YA 1P7YA 2DETA 3C4VA 1C1DB 4Z4IA 1G6KA 4FDMA 3JVVA 3NONA 3ZDFA 2EX0A 5B1DA 1IN8A 2A14A 4JEMA 4Z4HA 1QPZA 4CEIA 4E0BA 3P45A 2ANBA 3H5NA 3PB3A 1T1EA 4QELA 3ESZA 1T6YA 4FYIA 3NYQA 3RROA 5BSUA 1XZMA 3AKEA 2PUDA 4O6VA 4FFWA 3VNAA 1J5EB 3M0EA 4LF9B 3WHIA 2YC2C 1S8NA 4B71A 4ZAVA 3GMDA 2YXNA 4BLTA 5LD2C 1NWHA 1QBKC 1SC9A 3QPWA 3MUNA 1TECE 2HSDA 2BT4A 3LE8A 4JT4A 2DR3A 3C3YA 4LY9A 3A4YA 4YEDA 5JCOA 1XZ8A 5JG7A 2JC3A 5BWOA 4RQAA 4R8RA 4W6ZA 4M86A 4ZALA 1VJCA 4M37A 3UAXA 3WZMA 5ITZB 3N8HA 4X00A 4MOWA 4PSDA 5KJ6A 2DECA 3E22A 4WESA 4TWAA 5FTJA 5JSYA 4D42A 2O2XA 3ELDA 4GC5A 4R6WA 4ABTA 3NHFA 3W3ZB 1Q0PA 3CR8A 1NE7A 3LXMA 3PFHA 4R69A 4U5XA 5CLLA 2BHNA 5F77A 4NRDA 2B4QA 2C5AA 4Q4HB 2FFJA 1LDGA 4FSHA 4RF2A 4M4SA 5EMHA 3KYDA 2QAGB 3SDSA 4A15A 4TTPA 1ZQ9A 4Q4LA 5JY6A 2GPAA 1TM5E 5E1MA 2JAQA 3R3YA 1N2ZA 4MUFA 4YAOA 2FP4A 2UZ1B 4FEYA 5E1BA 4AP9A 1O6FA 3OFSA 2FQXA 2VHTA 4HDMA 4A0GA 1EP1B 1ML3A 2PZEA 1PT8A 2GZ2A 4PC6A 4Y2QA 2WFZA 1P3Y1 5GJVC 4BQQA 5JAMA 3O2NA 4GHWA 1M2VA 1U9IC 5ALTA 3OF3A 1TQ4A 5CVJA 1KPIA 4ES6A 3ILHA 4ERNA 1J56A 3OE7D 3OLYA 4B3RB 1JDUA 3JSAA 3JZFA 2XDWA 4RH0A 3SLKA 2QE6A 2WD7A 4D9GA 3PEYA 2H92A 5FNZA 4BZZA 2HXGA 4XWYA 2EAUA 5D5HA 2QTVA 1MAUA 3KT3A 2VLIA 5AI5A 4C20A 3OD5A 2ZR7A 1KDTA 5E8RA 4IGAA 3QVGB 5U9CA 1G3IA 2NO9A 2X1HA 1JILA 5CIQA 4CKWA 3E2PA 1JEDA 4NJMB 3OTQA 1KMMA 4JLSA 1H4QA 4RLHA 2YRFA 3FROA 3UVEA 3HA7A 4C14A 4M1YA 1KH2A 1ZESA 5D5QA 3VA7A 4L4RA 3T06B 2CXNA 3K4PA 1GL7A 1Q0QA 4KE8A 4RSGA 1G8KA 2PKYX 5BY2A 5I4CA 3EWSA 4KLNA 1TYCA 2ZRPA 4KAXA 5BN4B 4EMUA 3AUSA 4AULA 4PHGA 3D3WA 1GQOA 1Y6RA 1GDTA 3IRVA 4JX9A 5CM8B 1LDEA 1G5HA 2ZBPA 3RS0A 4WADA 4B6FA 1ZBDA 3V1UA 2HH9A 2R1VA 4HUJA 2O3UA 1WDLA 1F6BA 4BJ6A 3P0RA 1DXHA 5SY4A 2QZ9A 2HLDD 4GL4A 3I39X 3EXFB 4A5SA 2WICA 3R7WA 3CH5A 4N9QA 1R5NA 2EW1A 4L3VA 2N42A 5H7XA 4CMHA 3PNVA 4BPBA 2NYRA 1V47A 2GB4A 4ZMRA 2BSAA 1RQGA 5TRTA 2IYFA 3MT7A 1U8CB 3QWHA 1MIOB 3H8JA 5KVSA 1X1AA 2BFCA 2ZSEA 2PS1A 1QZXA 3C3DA 5FOXA 1AG9A 1CC1S 2PWYA 1BWPA 2YINC 2CDCA 4Q3DA 4CTNA 2RGXA 1FP2A 4MA4A 4F71A 3LHSA 3GQVA 1QK4A 4XI9A 2ZPAA 1FU7A 2JGEA 1SULA 1VE3A 2FB9A 2N47A 1I3LA 3I04A 4UNQA 3TTWA 4BUZA 1Q1GA 1QH1A 5J4HA 4DKXA 1EB8A 4EZBA 3IBYA 5TY0A 3PRYA 3QTTA 5LYJA 3W5DA 1YR7A 2H1IA 2LKDA 2HU2A 1R4AA 1G8AA 1Z45A 3G3EA 3HJNA 5CT5A 2OE2A 2P5YA 2V55B 3OJEA 3QEJA 4ZT3A 5I3ZA 4DV2B 3ENNA 4YQFA 1XYYA 3W1EA 4XYMA 4UU1A 1OKKD 1YRYE 3DD1A 4WDQA 4C76A 3N8DA 2IZOA 1QWSA 4Z7OB 1YR2A 1NPYA 4K1LA 3ZIAA 4DR2B 2WF9A 1U02A 4QUGA 4RE5A 3FTFA 2QMOA 3QEMB 3EQ7A 3JZIA 5DTIA 4UMFA 1NOIA 2K2WA 1TNDA 3EIEA 5CB8A 4MV5A 2XNJA 2Z4RA 1MQ8B 3PD1A 3RUFA 5KYNA 3HO6A 2WP0A 1WTAA 2Q2QA 4G1BA 1LLUA 1GUZA 2CD9A 3GMIA 1DDOA 2G40A 3L1JA 4M38A 2HXSA 3DBLA 1CUFA 4JLBA 4QJ3A 1X8KA 2ZUCA 3T5MA 5HUQA 2YWBA 1BSVA 4GWKA 3P5SA 3RHSA 4RTMA 3HFRA 1HETA 4PW0A 2D6FA 4LXUA 5A0TA 5ELXA 4FCCA 1S4QA 1LC3A 1WZIA 1RYYA 4H9GA 4Y1RB 2CSXA 2NO1A 2UKDA 5K3FB 4DCMA 4KQIA 5I7FA 2ZROA 1GVHA 4PRZA 4HD8A 3NBUA 3TXXA 1NQTA 2ERCA 3L0BA 1ZGAA 2VP2A 2XITA 3BXZA 3QMPA 1QH8A 4RULA 1QNLA 3IPXA 4JITA 4N7JA 4D0GA 1YQ9A 1OCEA 3JQCA 2X0JA 1TJ3A 2Q0QA 3O8OB 3GK3A 5LQUA 5L6LB 2AYZA 4MGHA 2Q0SA 4KV9A 2VTBA 4S1PA 3IIEA 1DT5A 2X6QA 3I23A 3IPRA 1FP4B 2BEWB 2X3YA 5JE8A 4DY6A 3TSOA 2YWJA 2RHCA 6GPBA 3A3NA 3K0AA 1BRTA 4EZEA 4E4YA 4JLOA 5BR1A 4MRNA 3B2QA 1XX6A 2ATEA 5SYMA 1YE8A 5C8XA 2YVLA 3QHQA 4ZV7A 1Q57A 4BLOA 3QU9A 3HR4A 2JEYA 4HRVA 4ER0A 1U80A 2VDMB 5JOQA 2GCGA 3FOBA 4JVNA 4K9LA 3AF2A 2M6KA 3SQMA 1VLLA 2WM9B 3KL2A 3NUQA 4M6WB 5KU1A 4MW5A 1DOHA 1N6IA 4G0WA 4ZO9A 5AM5A 5L7YA 2HGZA 4BFCA 4JK3A 3IKTA 2QPTA 1FYFA 1D6JA 1QCDA 1U28A 2J3MA 3K4HA 3S70A 2BF4A 4H3HB 5IU6A 4D0SA 2W11A 4WVFA 3K2EA 1OTXA 3T38A 3WGOA 2W00A 2XXAB 1FXWA 4X8LA 1KYQA 1CZNA 3BILA 3GP3A 2O1XA 4WA8A 3VR3D 4FFDA 2ZQ5A 1Z5OA 3KOOA 1XZEA 2IZ6A 3LCUA 1HDIA 1U2SA 5FOWA 5KOJA 5MHTA 3AR3A 2OM2A 1E96A 5EZSA 1KH1A 4F93B 3CNNA 4ZMBA 3KPUA 2ZW9A 5T7BA 1E4OA 3LVRE 4G85A 3C41J 4M9XA 2XB9A 3GDFA 1Y1SA 4XH9B 3K71B 2HHAA 1L5SA 5I8WA 1WL8A 5HDQA 1EDZA 1R0SA 2A9OA 3RJMA 2YIDA 1WMFA 5DCYA 2PX5A 2AWOA 1YRAA 4B3GA 1V9LA 1UQUA 5AHWA 1DAMA 3PCTA 1QLJA 2YMMA 5JNTA 4EO7A 5J40A 2GKOA 3V4OA 3I4CA 2F55A 1P44A 1VL6A 1T2DA 2FZEA 3I4FA 5DRYA 2CE2X 5JVDB 5G2OA 1GY8A 3D4OA 3LUBA 4ZT4A 1H2WA 1Z0JA 3JQAB 4A27A 2OP1A 3A6KA 1N0WA 3G13A 5JXGA 2B92A 3AUKA 4RMNA 4NNOA 1NRJB 1N2CE 2FSSA 1ZONA 4DLLA 3F6SA 3STTA 4OHVA 1B8NA 2Q28A 1V0JA 4TXMA 1MO3A 3CLUC 3KM0A 3OJLA 4GBJA 4NHOA 1RI3A 3VHLB 2YHIA 4PZEA 2D0IA 2M2IA 1LWNA 1E32A 2C3MA 3QFSA 5EHNA 3J81k 3KWFA 2PGJA 2QLJA 3PXDA 1ZUD1 3K53A 3C14C 3RBXA 3UB4A 4I6GA 1B1CA 1Z4NA 1ZOLA 1NW6A 3GDWA 3VGJA 4K9RA 1Z8NA 1BJRE 2XCUA 2ZATA 2VDUE 4KWIA 5M3BA 3WGIA 1RHJA 3DXFA 1PQPA 2WT4A 3WLQA 4NBUA 1CYDA 1NMZA 3FVVA 3OJ0A 4O4JB 3LUJA 4S2UA 1K9VF 3AUTA 4UFNA 4XZ3A 3ZY6A 3ZWPA 3ZX5A 1QGED 5EKXA 5BQ5A 1KH3A 1UKVY 4NOJA 4G0OA 3WWCA 2FSFA 2QSZA 2GEJA 1YUBA 3QLVC 3U1TA 3N2KA 3H5VA 4RTOA 3TQHA 3QLTA 1C81A 2BUAA 3KSDO 2VPWA 2OCBA 3OZRA 1JFVA 2IHVA 4UQPA 1XFDA 4RKYA 2NXWA 4WKNA 1RBZA 2ACVA 4C5AA 1BX3A 4J0FA 1QP0A 1OT3A 4MROA 3Q41A 1BXZA 1GG9A 5CNMA 2DAPA 3I6MA 2IV7A 4QASA 3T3NA 2OCDA 3GFRA 4MJXA 2ONJA 3QBTA 4CG3A 4JXXA 1Y7IA 3DKVA 4BMVA 2CNWD 4PAQA 3CLSC 1H4TA 2ZGVA 3IURA 2ZREA 4TM8A 5CM2Z 3U19A 2YDYA 3BJMA 1Y4AE 5LMUB 5ESXA 2Z3WA 5C5IA 4FC6A 4XIYA 1KAEA 3JQPA 4FSDA 2W37A 3K0EA 3PP8A 2X2EA 2YW2A 3MTEA 4LRQA 4WKPA 3PVZA 5BSWA 4FD2A 3PFBA 4NYMQ 3G8YA 3VFDA 5JH7A 1ZAYA 4F2PA 3QQ5A 2A0KA 2C8LA 3P32A 4Q3CA 6ABPA 1Z08A 3RSZA 4KMMA 3WA6A 2VCEA 1ODFA 5TIIA 1KDRA 1ST2A 2JASA 2CJPA 3QBEA 1W1WA 3N0VA 3QYPA 4RK0A 3K70D 5C1PA 2FEAA 1I0ZA 1G7RA 4L6CA 3U0BA 5EJ9A 1P19A 4OSOA 5TEWA 2C2BA 4MVJF 2M9MA 4DWJA 4O4IF 2XA1A 1E2KA 5IDWA 2HBRA 1QGUB 3OT5A 4M46A 4EPYA 2OHGA 1CBUA 3U44B 3TVTA 2NXCA 4JEHA 2XCRB 2IHZA 1QDUA 5FTNA 3VNRA 2GSWA 4BO9A 4B7AA 4GOXA 2EJWA 1GNRA 2DFKB 3GJXC 1ZH0A 3ETHA 4R9NA 3PS9A 1QIGA 3BB3A 4MQ6A 4Q7JB 3R77A 5EJ4A 2ASEA 4F45A 2FZ5A 1IXSB 2QIOA 4FP9A 3UB2A 4X8HA 3KV1A 2EDCA 3PJDA 4MVXA 4H27A 2HA4A 4BNDA 3TEJA 3RSLA 3WNDA 3OTOB 4O5AA 1QOPB 4HRYA 5K4AA 2D62A 4LJSA 3N2GB 4OAQA 3IVAA 3KSZO 1CPYA 1KMQA 3OWXA 1UXIA 4I4TB 1RJGA 2Q3DA 3JRXA 3VTKA 4OL0A 2R8XA 1C7EA 5J43A 2PH7A 3MTGA 5K0ZA 3D1VA 3QJYA 1KO4A 2UUBB 3TLYA 3DLAA 3Q7EA 1N78A 4HSGA 3CIOA 2PRIA 2CJYA 2ZZNA 4PZUA 3ONFA 1Y33E 3ESYA 4IFTA 5ALMA 5IC5A 9LDBA 4D92A 1BMQA 5KQSA 4XAQA 2C7VA 4ESVA 3DC2A 3MCVA 2XUHA 3M6WA 4HZGA 4L78A 3THSA 3B5IA 4XW2A 5FUQA 3PENA 4PTYA 2GUWA 5HUHA 3HO1A 4HQ0A 2PBZA 1PKXA 4RYDA 2PUEA 3IE0A 1KKMA 1KO7A 3OCYA 4LYJA 2JJYA 221PA 2YZ7A 5FUVA 4N5LA 5FL7D 1SPBS 2P67A 1YOVB 4GM4A 3SSNA 2JCSA 3STYA 3A04A 1VL5A 2NOAA 3L0PA 4KG7A 4WZBE 4R9SA 5ALPA 3EXAA 2OORC 4IJWA 2ZAMA 3KKKA 5K6TA 1YD7A 2FG6C 2VQSA 2VWHA 4CMAA 3HVHA 3DEJA 1X1EA 2ACEA 1KNQA 4KQCA 4BBZA 1KQPA 2IDJA 3FW1A 3VR2A 2Y8EA 1F0NA 1WU8A 4AG5A 2R47A 4H7FA 4DNOA 5ED4A 3AVUA 1RRCA 3PKIA 4TTRA 1MNAA 3N86A 5KNBA 1BDHA 5FB3A 2GCOB 3WL7A 1SCIA 4DDKA 4LHWA 5HZMA 4ZTUB 2AG6A 4XFKA 3KZXA 4ENPA 1LUAA 3EGIA 2GYUA 3TLEA 3EIFA 1N8KA 2MWMA 4MRVA 1RWOA 2DRIA 1KOJA 5AW0A 1QZUA 5JJ5A 5GJWC 2O3JA 3VAAA 5BR8B 4R40A 4G07A 3H0CA 2PGNA 2GHTA 1SHKA 1CY7A 2XWBF 1A82A 3E03A 3WZ2A 4JUCA 1TTQB 1KZ1A 1P2DA 1N1GA 4RIHA 1VYUA 4TWRA 2Q45A 1D2MA 1PK9A 1WU7A 2XF8A 3EGDA 4H17A 3UJAA 1JLLA 3DGEC 4A5OA 3HUDA 3SHFA 4W5WA 4V0MA 3TDKA 2DH5A 1EQUA 2CL7X 4BQEA 3C5VA 2QWXA 2ZJ4A 5HKBA 5LXTB 1MDFA 1E1CA 1ZN2A 5K3SA 1TZKA 1VBFA 2E5LB 5E6RB 5JARA 1R0BA 3FPCA 5JROA 2QUIA 3CJRA 4B4OA 1VSUA 1UANA 4R0MA 1BMDA 4ZTZB 2ZJ7A 2P6NA 3OQ1A 1VCHA 3C6MA 3ZKAA 4CCWA 1J0AA 3Q7PA 1YONA 5JQGF 3U7FB 4OBWA 2ABWA 2NVBA 2X14A 1XZHA 3HJRA 3VR3A 4I3FA 2WD7B 2BEUB 1P5FA 3JQEA 4JBNA 4FZJA 3TQQA 7ADHA 3SQXA 1EFPA 1V6AA 5BYBA 2DUMA 4BB6A 5C18A 5IUNC 5U4QA 2XGSA 3MRXA 3DVRX 1Z5GA 1ICEA 3TZHA 1JG2A 1S7GA 4EG0A 5CB4F 4J2TA 3NWEA 1KJIA 3SYRA 5SZIA 1CUHA 5JI3E 2AOXA 1M34B 2ZYUX 1D5CA 4HVCA 2X2PA 3I9FA 1ZKMA 3D2LA 3PNPA 4P58A 1T8SA 4R1UA 5CXXA 2PFKA 4ZYVA 2AL7A 2JA2A