1SIOA

Structure of kumamolisin-as complexed with a covalently-bound inhibitor, acipf
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
356
structure length
356
Chain Sequence
b'AAPTAYTPLDVAQAYQFPEGLDGQGQCIAIIELGGGYDEASLAQYFASLGVPAPQVVSVSVDGASNQPTGDPSGPDGEVELDIEVAGALAPGAKFAVYFAPNTDAGFLDAITTAIHDPTLKPSVVSISWGGPEDSWTSAAIAAMNRAFLDAAALGVTVLAAAGDSGSTDGEQDGLYHVDFPAASPYVLACGGTRLVASGGRIAQETVWNDGPDGGATGGGVSRIFPLPAWQEHANVPPSANPGASSGRGVPDLAGNADPATGYEVVIDGEATVIGGTSAVAPLFAALVARINQKLGKAVGYLNPTLYQLPADVFHDITEGNNDIANRAQIYQAGPGWDPCTGLGSPIGVRLLQALL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords kumamolisin-As
molecule tags Hydrolase/hydrolase inhibitor
source organism Alicyclobacillus sendaiensis
publication title Crystallographic and biochemical investigations of kumamolisin-As, a serine-carboxyl peptidase with collagenase activity
pubmed doi rcsb
total genus 109
structure length 356
sequence length 356
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1sioA00
4OMDA 1SELA 3H42B 2QTWB 4ZARA 5JXIA 1GTJ1 2PRKA 4RYDA 5CW1A 2HD4A 4NMXB 1GNVA 1Y3BE 2ST1A 3DVQX 4I0WB 1SBHA 3CO0S 1NDQA 1AQNA 2HPZA 2XTJA 3QFHA 3VYVA 4JP8A 4CFYA 2DP4E 1Y33E 3TI9A 1SH7A 2PKCA 4NE7A 1WMEA 1OT5A 1SCDA 1BE8A 1SN7A 1SBIA 1SUPA 1WMDA 1V6CA 3DE2X 1OYVA 3F49S 3I34X 5I9SA 3TI7A 3T41A 1WVMA 3ZXYA 5B1EA 4AKTA 2X8JB 5JXHA 1GA4A 1YJBA 1GT91 1S01A 1MPTA 1A2QA 1PTKA 1AV7A 3D9QX 2ID4A 1T1GA 5ARDA 1SUBA 3A3OA 1GTL1 1AF4A 3P5BA 3GCXA 1SIUA 4WOCA 2SNIE 1KDVA 2ZRQA 5FFNA 2Z2YA 1R64A 1TM7E 4HX2A 1SIOA 3DE6X 1LW6E 2SICE 3I2YX 1BFKA 2ID8A 3DYBA 1AU9A 1Y3DE 1SVNA 1SCNE 3OSZA 1NDUA 1TM1E 2PWAA 4KPGA 5B1DA 5SICE 2G4VA 2ZWOA 2Z2ZA 3WHIA 1Y1KE 2DQKA 4ZOQI 1AK9A 3I37X 3VSBA 3VV2A 3DE7X 3WQBA 4M1ZA 4DZTA 2Z56A 1JEAA 2WUWE 1CNMA 1TM3E 3EDYA 2Z57A 3GCWA 3CNQS 1SUAA 1SBTA 1DUIA 3BPSA 3GT4A 1XF1A 1T1IA 4C3VA 3DE1X 3QTLA 4LVNA 3VV3A 2P4EA 3EE6A 1C9MA 1PEKE 1SUDA 3HJRA 3LXUX 4K8RB 3AJ9A 4BWGA 5AQEA 3SQOA 5ARBA 1GA6A 1WSDA 3LPDA 1SCJA 1GA1A 5FBZA 1KDYA 1KDZA 4H6XA 4J94A 4WOBA 1EA7A 1SCBA 3DE0X 1SUCA 1S02A 2PQ2A 1GNSA 3SICE 1R0RE 3QMPA 1Y34E 1ZVKA 3VHQA 1DBIA 1R6VA 3DE5X 2PWBA 2XRMA 4KG7A 4YN3A 1SCAA 5K7SA 4DWWA 1THMA 3PTLA 1TECE 5AVKA 3GT3A 1Q5PA 3WIUA 3DVRX 4LVOA 2GKOA 4AKSA 4HVLA 2E1PA 2W2NA 3BGOS 1NLUA 1PJ8A 2IXTA 2ZWPA 4OMCA 2TECE 4Z2AA 3I30X 3DVSX 4DJ5X 5JXGA 4CFZA 5FAXA 3A3PA 2IY9A 3DE4X 4H6WA 1AH2A 3LPCA 1AVTA 2SBTA 3AJ8A 3WIVA 1MEEA 5JXJA 2X8JA 1TM4E 1P8JA 1BJRE 1ST3A 2Z30A 4CG0A 1Y4AE 1UBNA 3AFGA 1P7VA 3Q40A 2B6NA 1Y3CE 4FONA 4H6VA 1YJCA 4B5LA 1GTG1 1EGQA 1C9NA 2PYZA 2Z2XA 3BX1A 2V8BA 2W2QA 1GCIA 1KE2A 1SUEA 1Y48E 3DW3X 5ARCA 5AVJA 2WUVA 3ZXXA 3LPAA 1CSEE 3L1KA 4GI3A 1IAVA 1TK2A 1IC6A 3UNXA 1TMGE 2W2MA 1KE1A 1OYOA 2PMWB 1WMFA 1BE6A 1Y4DE 2WV7A 1C3LA 1VSBA 3EIFA 1YJAA 4OV6B 1SIBE 3D43A 1P7WA 3F7OA 3DDZX 1T1EA 1HT3A 1S2NA 3TECE 4C3UA 1TO1E 2Z58A 3Q5GA 1BH6A 1TO2E 4KB5A 1SBNE 5AMXA 1TM5E 5JMOA 1BFUA 3VTAA 1PFGA 1SBCA 1YU6A 1SPBS 3DE3X 2SECE 2W2OA 3A3NA 2W2PA 3DWEX 4NE9A 3PRKE 1C9JA 1ST2A 1Y9ZA 2WWTA 1Y3FE 3F7MA 3DW1X 4MZDA 2DUJA 1ZVJA 1V5IA
chains in the Genus database with same CATH superfamily
1TVEA 3OJXA 1QTQA 5B36A 2O8DB 4PLVA 1QHSA 1JFVA 2A5FA 3TSCA 3DBRB 4RMHA 4TTRA 1DCFA 1B8PA 1LH0A 1WPXA 3T5BA 1GNVA 3D2LA 4AROA 1NDQA 1JV2B 4AY6A 4YHBA 1B6RA 2EFHB 2W37A 2GK6A 3HB0A 3IAM6 5K8CA 3ZH2A 3F8TA 3FLEA 2WTXA 4I46A 1LBQA 1SC3A 3PXAA 4MVWA 4YREA 5AUNB 3MWGA 1KFEB 2R6JA 1VHJA 2NYRA 5I9SA 4LN1A 5DLPA 5CYGA 1WVMA 4RDXA 4Q16A 3MTGA 1F2UA 4JKOA 4L78A 1R8YA 3ACBA 3PJDA 3VKHA 1YR9A 5ARDA 3EFHA 4GBMA 1IVNA 2RI0A 2VXYA 2D0OB 2ZSEA 3T1YB 4HAIA 2OMEA 1DARA 5DGIA 1KDVA 2OCDA 2PBLA 3PWSA 3E7PA 3WK5A 3GFPA 1NUUA 1T91A 3GZNA 2JCSA 1B26A 2DUNA 4LRSB 2YOGA 3VR3A 5CFQA 3MJCA 3OLYA 4D25A 2XECA 1UPTA 1H9AA 1B15A 1KXZA 1WCXA 1XD8A 3RVMA 1R0SA 4KDFA 1YF3A 4JT8A 2ES4A 4QO7A 1JEAA 4RK1A 1E3SA 4ZAFA 3F0TA 1KS9A 4Q18A 5EP1A 1QP7A 2GYYA 3DHEA 5AKLA 4G07A 1KK3A 1HDGO 2P75A 4GD3Q 2QX9A 4MGKR 3IKTA 1E9AA 4M54A 5E1OA 3WY9A 1HL7A 1YUMA 4AJJA 2LP4Y 3P0FA 3FJOA 3GLFE 2ODPA 4DJEC 4UTVA 2ERCA 3DMHA 1TT5A 1KDYA 4ZYYA 1HYEA 2J46A 2R44A 2XGOA 1SXGA 1LZLA 421PA 4HQFA 4D9BA 4JKIA 1EJ6A 1XYVA 2JAOA 2PKWA 2QG4A 4EB6B 2FWRA 3DE5X 2RGNC 3TR6A 1DDGA 1H2RS 2OV3A 2R1ZA 4GI1A 3URKA 2R0QC 3AB8A 4XD2A 3A9VA 4H60A 4HK4A 2MSNA 2YR0A 4UUNA 2QRZA 5FEUA 2WDPA 4QUJA 4HVLA 5B12A 1PK9A 1JBQA 1WPQA 3RDPA 5J2TB 3QEOA 3CHYA 2JD1A 1A7AA 5BMOA 2JA1A 3RRMA 2GILA 3LPCA 4PYNA 1AVTA 2BMEA 3ULKA 2DR2A 1N5IA 3KLMX 4IXTA 4V0KA 4GI2A 4B32A 3OQIB 3IUSA 4DTIA 3TTYA 2KBEA 4IJVA 4ZV4A 4NJEB 4YP5A 4UXIA 3I76A 4NABA 1SVIA 3PD7A 2I03A 3EXFA 3E53A 4ZI2A 1UFVA 3BZBA 4IDGA 4Q4JA 4X84A 5BQPA 5HVNA 4LC9A 1UT6A 4YUAA 4GKKB 1I1HA 1A96A 4RVUA 3CPSA 4ZQIA 1HEUA 1K66A 4YMIA 5IKOA 4BB6A 2XZOA 3NMUF 2C1XA 2H1LA 2PL9A 1XD2B 4D02A 5KQSA 3SR3A 2LV8A 1NSYA 2YY7A 1X7YB 1Z25A 4PRZA 1EKXA 2BMVA 1C8KA 3L6BA 3WIBA 2IS6A 1BHJA 2PT6A 4J1TC 4Y2SA 2I78A 3O2SB 2JKYA 1Q3HA 2AEJA 2HSGA 1SUWA 1GGVA 4UFPA 5HCUA 1UKZA 3AP3A 3QNUA 1D6MA 1D0SA 3EIXA 4G5GA 1Z6XA 4RZUA 1UEIA 4U2KA 5FYQA 1SZJG 4JOSA 1L5MA 3X3HA 4B7UA 5CDHA 2WM3A 4H7PA 4IVRA 2VP9A 4EW1A 1IY9A 2W11A 1JH8A 2RH8A 4P84A 2GCPA 2BI8A 5GJVC 1QF6A 2H92A 2Q0XA 4HLNA 5F5LA 1XTSA 1IN1A 1Y3IA 3G8YA 1K8YB 2W4MA 3AZOA 2XTJA 2ATVA 2JEOA 1XQ6A 5JYDA 1BS2A 1NJ5A 1Z37A 2BI4A 2FMHA 1NU8A 5C32A 2NU6B 1M1UA 1AD2A 1MC4A 1QUEA 4F46A 4NBWA 2O06A 1DCMA 3I34X 3M9XA 4JQYA 4R0NA 5JTUA 5LMNB 1XT6A 3WNBA 5DOVA 3UAXA 3SXUB 4U2BA 3VPHA 3EIUA 2VZEA 5FPQA 4MUMA 2ZROA 1IDN1 3DV9A 3VTZA 3Q3CA 2I80A 4IIVA 1P6XA 4P34A 4DE5A 5ADUS 2ZEJA 2HN9A 5JASA 4L73A 1MKYA 3E23A 4JBWA 4LRQA 1OREA 1TIBA 3AFHA 4II7A 4B34A 2IEAA 3IEIA 3O4RA 1TZCA 2GBGA 3IEVA 5A9RA 1M5TA 1T5HX 3DVLA 1W94A 3G2HA 5DGDA 3HRKA 5ALYA 1I6MA 5DNUA 1NY6A 3O8NA 2WWRA 4RD6A 1NOKA 2IRWA 1DHRA 3BTOA 4BMPB 2UYHA 4W1QA 4FN4A 4XSVA 3ZY2A 2O1EA 4A7PA 1J2RA 2Z56A 3CEAA 4H3KB 4G24A 1KEKA 4IDNA 2CJPA 4GWLA 5JEEA 1BAPA 1CQXA 1Z8FA 2L19A 4FGJA 1GVNB 1DI0A 1UPXA 3RC3A 1QG0A 3WL7A 1NFQA 2VJKA 1CUXA 5CVUA 4GMDA 3U7JA 1A4UA 1JW9B 3SM3A 5H4HA 4KN5A 4OK5A 1LI4A 3CIOA 3DMYA 2VJPA 4HBGA 3KEGA 4QEKA 4FB4A 1G9TA 5I7UA 3S4YA 4NXMB 3IUQA 2M9MA 4OXNA 1PJBA 3JWEA 2C5BA 1D6JA 2CFTA 3D1VA 3E6AA 4C7OB 1AKVA 1NJ6A 1Q1AA 2QPLA 1RM5A 3IOCA 2VP5A 2XCSB 1KBOA 1XZ8A 4ZOLA 3ESRA 4HCJA 3WWOA 4BFLA 4F2HA 3EWSA 4L85A 4ARAA 1HGXA 2ISSD 3QGMA 4BWVA 1SZCA 1X1RA 2XCUA 1GRNA 4DSAA 1Y4AE 3ZN2A 4HB4A 4LRWA 2X77A 3M6WA 1ZUNA 2O2HA 3G6KA 3LIIA 1X19A 4JHLA 4OREX 4X5OA 5SY9A 3ZWAA 1J6UA 1Y42X 3BIWA 2QN2A 3GEEA 3QELA 4IGKA 5JDIA 3C6MA 4IQGA 2FGJA 2B99A 1IJKA 2YVLA 1YL6A 4D5EA 3ASVA 2GDZA 1PLLA 1RJWA 4QNRA 3PYMA 4XDGA 1D9ZA 4F2DA 4EYKA 4RK4A 5KO2A 1GGFA 4EJFA 3AKDA 1A69A 1XP5A 3D6HA 5DMXA 2ZYHA 3MPOA 2BMAA 3DM9B 3T3EA 2X22A 3GN2A 2RE8A 4MI9A 5JPDA 5DNEA 4O4JF 1UFRA 1TKRA 1FS4A 1F51E 3ETNA 1FTNA 2X7HA 4W9NA 2PGXA 1EDBA 3RKUA 1SWVA 3GYBA 1TVCA 3OT1B 4D4IA 3DFUA 2ZJ7A 3KZMA 5ULLA 4YVFA 5IASA 2IH4A 1DQNA 4R98A 2Q1YA 4GI7A 4ZVMA 3HKEB 2FJ0A 5I51A 1QB8A 2AMVA 1ZKMA 3WP1B 2V8OA 5BO5A 1C8BA 1R9JA 4EEZA 2D62A 2ZKLA 4LOJA 4O29A 2YHBA 1T9AA 2GVNA 4O3FA 4CGZA 4QLAA 1KJNA 2CZCA 4W5WA 4R9UC 2DH5A 1IBLB 3D4OA 2YS7A 3NZEA 3NLLA 4Q7KA 2NSDA 3CQ9A 3IA7A 1ZOSA 4LXUA 3FY4A 3TZ6A 2QUAA 3TGLA 2C8JA 3KOZA 3BMQB 4NE7A 4HG2A 1ARZA 3T7IA 3U7QB 4CM8A 1F4LA 3AVQA 1BXKA 4KPEC 4MS1B 4HSEA 4EYEA 5J3JA 2NO7A 3HYNA 2DTEA 3TR0A 2P9ZA 3I9KA 1ZYUA 4CE6A 3BIFA 3ORYA 3IOBA 5IBRA 2NPIA 3V9PA 5L9AA 2QUHA 3R0QA 3OFND 3W2IA 4IHJA 4BWYA 3G0HA 2ZXEA 1TA9A 1WHTA 2KE5A 3E05A 5IVDA 2J3QA 4JI6B 1KYQA 2BEVA 2CJXA 3IV6A 1N5KA 3TXAA 3WR5A 1Z5PA 1V8DA 4V2IA 3OU2A 2GCOA 3EPRA 4JJZA 3ICCA 4LYFA 4REOA 5KX5F 1YTUA 3IEUA 2B3DA 3AY6A 1YMUA 4NLLA 1OFUA 2P1DA 3FPBA 4GKJB 1WMSA 3CR7A 1QFMA 3VI4B 1AZTA 4KTTE 2XB2A 2IL1A 3WL3A 5K0CA 1MV5A 2QYSA 4I99A 4A9AA 2XF2A 1BEEA 2ECFA 5GM2A 1RYNA 4TWIA 3KTDA 2GXQA 2H1WA 2ZUVA 2NMVA 3AVTA 4TV8F 4JX9A 3LQRA 4X00A 4QPZA 2C97A 2JFYA 4C7MA 2JVIA 3L8GA 5E9QA 4BNIA 1KIAA 4OBEA 2UXCB 2JGDB 1JAZA 3EY9A 1WSWA 5CGQB 1SXJE 3OF5A 2D0PB 3ME5A 2B37A 1YK1A 4V02A 5FUMA 4RESA 1ISMA 1DFIA 1K68A 2FPKA 4KXUA 1CUUA 1ULUA 3IHTA 2BEUA 3PJFA 1BMFA 2XWSA 2GXSA 5BVHB 5I8PA 5JAQA 3CVJA 2ETXA 1OZFA 3EIEA 1SU4A 2XXBA 1P4AA 3DE4X 4LZLA 4RV5A 3UMBA 1QDUA 4K26A 1JXMA 4RMJA 3W9SA 2HMWA 3RD5A 1X7XB 1T9CA 3E3LA 1YO6A 2OHXA 3FPCA 5EZYF 2HTFA 3TRKA 1T5OA 3VHRA 1QWSA 1NQXA 1UBNA 1N6HA 5JCPA 3LY9A 3AXSA 3RF7A 1I3NA 1ZIPA 2FMIA 2ECOA 2IZOA 3ID6C 1OJLA 5LYJB 2X1LA 1C9NA 2QTRA 1PWEA 3BD7A 3V00A 1HR0B 3OCXA 4WQMA 3TF5A 1U7DA 4U02A 2YYSA 3WGMA 1E18A 1KPGA 3LPAA 4IZ6A 5D5QA 1AGYA 4KZKA 4KWIA 1W1UA 4QASA 2ZSKA 1E3WA 1FC0A 2I7CA 2PJUA 2F17A 4Q6WA 3GVCA 4MRMB 1PJ3A 3D43A 2HA4A 4PNEA 4AQ7A 2GYVA 1K98A 1T13A 2VWGA 1PD1A 1XTIA 4BGVA 1C3OB 1EDZA 2B7CA 4GS5A 4KRGA 4EA8A 3COYA 5KHLB 2CSXA 2HRDA 2WYWA 5JMOA 3V2HA 1NE7A 2GF9A 1G3UA 1FYXA 4PO8A 2IYLD 3E3AA 4FHZA 4D3YA 2XH8A 2QTZA 2DPMA 4A1OA 2BKVA 3BE6A 1A2OA 3DD5A 4D9NA 2WSLA 1BGVA 2NT4A 5DBGA 5KKAA 4AT1A 3CH4B 2NQ2C 4RVGA 1UMKA 4ARZB 4DRXB 2JLQA 2QU7A 1UODA 5AW1A 4YDHB 5CW1A 4I3GA 4L4XA 2DB3A 3GOHA 3KC2A 1L5GB 3IMCA 3KQQA 2OR3A 4RFSB 4UQOA 4XWGA 3T1OA 3ZQKA 2C54A 3RODA 3EFOA 2O57A 4QYMA 1STOA 4KMOA 3VI3B 2FE1A 2K87A 5SYMA 4IDFA 1PZGA 4QGFA 2O1XA 5KOYA 3WFZA 1W6RA 4CTKA 2ZG6A 4LYYA 2GPBA 1F7VA 1P1RA 3F3YA 3HYCA 2ET6A 4U0JA 2OORA 3INNA 3JS5A 3O4VA 4JQOA 5A9SA 1EHYA 2WK1A 4JLMA 1ABFA 2B94A 1YHYA 2PN1A 1V39A 4E88A 1NVXQ 4ZAWA 4FDAA 4FW9A 2NSJA 1G3QA 3EULA 4IXDA 3BA6A 4AJEA 3ENWA 1U8FO 2N75A 5HKAA 4CLOA 4PZUA 3DYBA 4D1YA 2CY0A 2IP2A 2A2ZA 2C95A 3ESXA 4XLZA 4D6YA 1LB1B 3EXHC 4WLVA 1CERA 1RPTA 1Y1KE 3NBYC 2PUJA 2W6IA 3PIRA 3PI6A 5H70A 1LLUA 5AW6A 4A2CA 3FZYA 3L1JA 2UYOA 1IU9A 1TC2A 5B2ZA 2HFKA 3A9WA 3R6DA 2WUDA 3N8NA 1FDSA 4RY9A 1GQYA 2VOEA 2VT7A 3EWIA 3IUMA 5MN4A 4RW0A 3VH2A 4I4TA 2D2IA 5G3YA 4PAOA 5EWJB 2F6RA 1M67A 3E0QA 3GRPA 3OZAA 2FLVA 4XXHA 4XVHA 4S24A 5ALMA 5L95A 1RRCA 1FRZA 5FBVB 1JVNA 1V48A 4GDMA 3UFBA 4LF4B 4XIJA 2A3NA 3W5SA 1KGDA 1OF1A 2VSNA 4IHJB 4FEGA 4K6HA 2BM9A 2PZLA 3F2VA 4U9UA 4EUHA 4YRLA 4YN3A 4F72A 3G9TA 4XLTA 1G20A 1QHYA 2X4DA 1M2NA 3MQFA 2EJWA 2OZVA 2IIPA 3THOA 4RF3A 3I0ZA 1YIDA 4A73A 1PV1A 1XIVA 1ZG3A 2YZ2A 4PZLA 4WN9A 5LLDA 5C51B 1DDOA 4G0WA 1H9CA 1MEJA 5K3AA 5LR6A 1GPWB 2FY8A 2PX4A 2XMSA 2CYCA 1H1LA 1W36D 3TD6A 1MO2A 2HDWA 4OHBA 4CWAA 4P5EA 1YQWA 2DBQA 2XJ4A 3EGCA 2R1TA 3GJ3A 4URVR 1W25A 3QOWA 2Q62A 3H5NA 3DEHA 4RNDB 3MVEA 2CHGA 3VPSA 3GJ7A 2V4UA 4FI3C 3EQ2A 1T8TA 1JDNA 2M6SA 3LUKA 4FHEA 4HAUA 1JEOA 2W6CX 1L5HA 3X0DA 1I4DD 1VQ1A 3P1JA 4ID9A 1VL8A 1N7IA 3TKAA 1JZSA 2OTCA 1ZONA 1E9FA 2XCQA 2OBBA 3F97A 1QHNA 3FE2A 3LT2A 1QVZA 2PMWB 2ILVA 4R2IA 1GIAA 3AZPA 3RH0A 5BWNA 1VB3A 5HQ3A 3DCIA 5G1PA 1EVLA 4ZCPA 1WXDA 3GRAA 2B4QA 1V7PC 3JVUA 4N5LA 3U09A 1U3DA 3MAGA 1CLEA 5ECWA 4F85A 5AKEA 4G01B 2Z6QA 4DADA 2HV8A 2QS9A 3AUUA 4DNOA 3IVXA 4L5IA 1ESCA 5HUQA 3KTFA 5JI2E 1Q0RA 1ZICA 1J8VA 3O1LA 2GTPA 2XD4A 1XD9A 4ZKDA 1HT1E 3I9V1 2GCOB 3FUUA 1GZHB 5DWVA 4A92A 2MR6A 2ZXUA 1RBYA 3KKLA 1O1YA 1Q20A 2QMOA 1SPXA 2DH6A 5JJLA 4JYAB 4OHZA 4ZDJA 5LDHA 2WB2A 1RVDA 4ZOLB 4BXOB 1V1MB 1NHWA 3RSZA 4ZPXA 3L07A 4TVBA 1JEJA 3M81A 3QVWA 1GA4A 1K8RA 1LVUA 1UMBB 1S01A 1W6UA 3DF9A 2E4XA 3RCBA 3W3ZB 4JLJA 5I7AA 1VSQA 2NTVA 4MS1A 4ZYXA 5HIIA 3UAVA 2HWWA 1SBYA 1C1XB 3G2MA 2VKTA 3NNDA 3I04A 3V8RA 4EA6A 2IEYA 2P6OA 2ZYGA 1NXWA 2ZRGA 4N01A 5EP2A 3CLHA 4KPGA 4ZJPA 4DCGA 1OR8A 4ALKA 2PGNA 5AR1A 2Z4TA 1H4QA 4NS4A 4WV3A 1IVSA 2XADA 4ZRNA 7GPBA 3H1BA 3AEQB 4HGZA 3AONB 3AF2A 2RHOA 3RSOA 2VBIA 3JQ7B 1ZGHA 2FQ1A 2YOFA 2YVUA 3RU7A 3C4VA 1V9LA 1L5OA 2INGX 2P6NA 5AJHA 1W9MA 2HQ1A 3TLMA 4URXR 1L6RA 4X62B 4D98A 2OXFA 4JJFA 3OIFA 3OJEA 1JIIA 3BMNA 1A9TA 2A14A 2VQSA 4WXPA 5TQ0B 4EMTA 1POWA 3LUFA 5FUQA 5L7WA 3NORA 3DL7A 1J21A 2SKEA 5T6MA 1R6DA 2EW1A 3E5NA 4E5MA 4DG9A 3IQGX 2I8LA 4O1MA 3JQGB 1RKUA 1ISSA 3LQ2A 1FW8A 5G0TA 2CYBA 4CQNA 1H2YA 1KKUA 1ZUNB 2C42A 1A88A 4C1NA 1E99A 2QN6A 5AESA 1QS0A 5F7JA 3AP2A 3TTVA 4DXAA 4F11A 2E1RA 1V1RA 1U2TA 1XEXA 2QF7A 2FYTA 3NVAA 4NECA 5C31A 4LPKA 3LVBA 3LVFO 5DASA 2GT1A 4X24A 3FDZB 1O6CA 2A1IA 1I7SB 5KC8A 2JFVA 3ZH9B 3LGAA 1E6KA 4ZT5A 4A15A 1Q0UA 2PVCA 2C7VA 4LE1A 4M3NA 3WIOA 4QXQA 1GFWA 4DCOA 3NP9A 4BVJA 1WETA 3K9BA 3KKPA 1DIBA 1G5TA 2Q2WA 2WP0A 3HDTA 3O7WA 3BL5A 4XIFA 1SHJA 4ZQEA 3LCUA 3QVJA 1OLSB 1EHCA 4JNCA 4EYOA 4M1OA 4YA6A 4F5DA 1L7QA 2B2NA 3P8ZA 3WXMA 3DV0A 3AF6A 1RWMA 3A04A 2P90A 2DE0X 1FLDA 1BHO1 1ZCJA 3E9QA 4GYWA 4NZZA 1IDOA 3PGLA 3Q5GA 4LYEA 2P4UA 1TO2E 1RNLA 1TADA 3IPYA 2GZSA 3Q11A 2NADA 4M86A 1D1QA 1WP4A 3R24A 2EWVA 2VYQA 3KR1A 3VSAA 4AWBA 3STXA 4YMVA 2ZIVB 4IWNA 4TYNA 2PX3A 2JJ1A 3DOOA 4MR9B 5BSGA 3DZCA 1L6IA 1DXOA 1H93A 4EG4A 4X6LA 3D8NA 4NENB 1IH8A 3MFQA 4Q24A 5JV5A 4KIJA 3WLMA 1WB6A 3ZHXA 4F3RA 4OYHA 5H8WA 1DC7A 2AG5A 1XWFA 2ZBDA 2ZJ6A 2QI9C 3TCKA 2OAEA 2RB5A 3EW7A 4HMOA 3IO3A 4MVJF 2IUUA 4CUZA 1T8PA 10MHA 5IKEA 5HG0A 3ZNNA 4J29A 4ALIA 3ZJ5A 1JSXA 4HVTA 2E55A 1G59A 1NQTA 3FOCA 1J7JA 1KVUA 5BW8A 1YA6A 3PPIA 3IEKA 4LBYA 4HWPA 3W4JA 1MH9A 3IIJA 1KSGA 4YACA 4C3ZA 1FK8A 3BREA 4KMMA 3A4NA 3MWLA 4GHWA 2R86A 1CUCA 2B1QA 2H48A 3LRPA 3GOQA 3NBKA 4TMKA 3JRXA 3X2FA 3BSYA 1D4ZA 3TW6A 1T9ZA 3OOJA 4P81A 3ZCSA 3NDIA 4B3XA 4LMBA 4KN8A 1O87A 4FS8A 4KVAA 3TL6A 3V2GA 4F7WA 2YFKA 3L8ZA 1OD6A 4GX0A 1VRVA 4UDNA 3OWXA 2VHYA 2N47A 1ECGA 1SK9A 1WZEA 1NBAA 3H1TA 4GVPA 3WJ7A 1RI3A 4L8FA 3N1UA 3BKXA 4NU8X 2HO4A 3G85A 5FWXB 3G8AA 4DR2B 2JHPA 1LQTA 4HWTA 1Y4UA 2Y99A 4YAFA 3PGXA 1KY3A 1GAWA 2W7TA 4I1VA 3CF2A 1OYYA 3LC0A 4KV9A 4R1OA 3VZCA 3PHBE 3ORFA 4YT5A 1J24A 2B8NA 2HJGA 2WFLB 1AQYA 4CN9A 1FFHA 1JA9A 1UAAA 2IA5A 2XOXA 2ID7A 1XAJA 3AR4A 4IEIA 3E7DA 3L92A 3LO5A 4ZTBA 4PCAA 1GA1A 1G16A 5TF4A 4ZDKA 3O9ZA 3ZD7A 1IY0A 2B7LA 4HS4A 1JHRA 4RTLA 2H5JA 3VHQA 4B5KA 4NQZA 5ITWA 2R6HA 2ZT5A 4NDZA 2HNKA 1NUTA 4TGLA 2RAFA 4FFBB 5ER6A 1EBUA 3O1IC 5EJ2A 1GYRA 2I99A 3H9JA 2Y1LA 2QAJA 1ORIA 5E6UA 4K40A 5IDXA 2O1SA 1ETHA 1JBKA 5ETJA 3TKYA 2GHTA 4KNVA 5F1YA 3GIDA 4F4FA 1UADA 1TVKB 2OGSA 2WIGA 4V39A 4EZIA 2VA8A 4BFUA 1NBIA 4LNAA 1GQQA 1HBJA 4I1OA 2VF2A 2I5PO 1DAKA 4FYMA 3BRCA 4EHIA 4RTJA 4F6CA 3L49A 5CPFA 3Q7PA 4XGIA 4ZDIA 5FX2A 3HBFA 1I94B 4J4HA 3G5UA 2D2XA 4PSVA 2X6RA 1WG8A 4ZN6A 3KQNA 4ZI7B 4CEJA 1C41A 3M4JA 5IEBA 1ISJA 1H5UA 3WGNA 2WKRA 3GAAA 4AKHA 2XXAA 1MJ5A 4OV6B 3QPWA 1FNBA 2Z6UA 1DRJA 5DTEA 5CEFA 2OP0A 1H3EA 1SXIA 3DONA 4A8JC 3W1WA 1ZRMA 1Y1PA 3EEIA 3R40A 5JAMA 1OUMA 3MTAA 2AMYA 2O48X 3VKUA 2OAGA 4RTOA 3QKIA 3U7RA 3C98A 3ZDAA 3EF1A 3BCHA 4OX9Y 1I2AA 5AW7A 2VJOA 3NHRA 4GM1A 4O1HA 1E2NA 4DUGD 4X3CA 3RTCA 5EIBC 5D8DA 3TZQA 3W2FA 3EGDA 4Z3KA 3RWMB 1EX9A 4Z9BA 2BAGA 2BHSA 3D0QA 4D56A 5ALLA 1TUBA 4KFTA 1J0BA 3C45A 4JS0A 3UKDA 4Q9AA 5EWMB 1DS6A 1LTKA 1NXSA 2QG6A 2JKVA 2QJFA 1DO0A 4LJ6A 1UAGA 2Y0PA 1Z6AA 2CVPA 2DBYA 2IYWA 2ZJOA 3F9IA 4WCFB 1MFPA 2EGUA 4RJKA 4DL9A 3GEGA 3N8KA 2LTAA 4ZVRA 5IF9A 3A6PC 3FHCB 1QZXA 2W8BA 3E7FA 1ZJZA 3LBAA 4AY3A 3AERB 5LBIA 4EHJA 3PVSA 4BDTA 3TRHA 1R6AA 5EXXA 1EVIA 5KCMA 4LJKA 4G23A 1PR2A 4XJXA 4ZQBA 4DGSA 1KMCA 1YHNA 2ID8A 2PL5A 3AVOA 3P2MA 4FK8A 2ZJ4A 1OBHA 4KW7A 5B1DA 3SSAA 2W0SA 1RKBA 4QUDA 4RJ2A 3SJUA 4C4TA 4MV1A 1DFHA 2XDAA 4RTKA 5THQA 1SD2A 1T4DA 1YZVA 4WT7A 3RVNA 2AEEA 3WLSA 1P72A 4EF5A 3NIGB 4I9NA 4TSFA 2PO5A 4RFVA 3EQZA 4LBZA 2PZAA 4Y0NA 4JU8A 3S1SA 1H1LB 1JDVA 5TE9A 5CA0B 2CHQA 3L7IA 2XT9A 4RVHA 3S1AB 3WOVA 4YLGA 3H3FA 4C1BA 3VM6A 4PE5B 3SY8A 3UJ9A 4C0XA 1A98A 2W6NA 1HPLA 3WSTA 1Z3CA 3EA4A 1DOZA 2Q4BA 2C07A 4BLQA 3CF4A 1D2AA 2O2XA 4KI0A 5WRFA 1J2UA 1SUCA 5BURA 5DT9A 3R3HA 3K8YA 3T7SA 4Q7QA 5JNLA 2IDMA 1D8AA 3HFSA 3B52X 1A9PA 3F8SA 4EI8A 1XVVA 3K6KA 2CV1A 1P5FA 3B12A 3H13A 3JQRA 3NBAA 5IC4A 1YOVB 1LDGA 4WKOA 4ZU6X 3WIUA 2O4UX 3U6BA 2IWRA 2FB9A 1LLFA 1VG0B 2HF8A 4IJMA 1EVEA 1P4JA 1TAHA 2IXTA 5DOZA 5G0VA 4HS9A 4JI5B 3IOEA 4QUBA 2XITA 4UEJA 4B6EA 3T0FA 1BSVA 1QGED 3E84A 4XIGS 3DBIA 4BZXA 3RBAA 3C87A 1NW7A 5C3MA 2O0MA 1WU8A 1OH5A 1QOZA 3B6IA 4FB5A 4IOMA 4UC0A 4CTNA 4LOHA 5I4CA 1SO8A 4FC7A 4JXJA 1CEQA 1MVOA 1R0BA 2AE1A 4EPVA 2BF7A 5BRAA 2BN4A 3EK2A 1F6DA 2Y93A 4N3CA 4Q9HA 4Y7CA 5ESDA 2XQGA 3TNYA 3WK9A 3EY4A 4XTCS 1R6TA 3O9MA 3P52A 4KQMA 2DKNA 4HDMA 1W2GA 3ESDA 4YR7A 3C5VA 4RAOA 1PJ4A 4EF6A 3I3SR 1D4AA 2HXSA 3EXG1 3T3OA 4HDKB 1T1EA 5F2EA 3I5XA 4DLTA 2A9RA 4RWEA 4GPEA 3FXAA 5FOVA 2JLCA 4MX8A 4O8CA 3UXHA 5E8RA 3L1UA 1T9BA 2C1EA 1E61A 2Q3JA 2X8LA 2XLBA 2Q8PA 3MWEB 4I4NA 1K6IA 1VLVA 4ESHA 4DG8A 1OT3A 2OFWA 4KR3A 4S0ZA 5I4KA 1A71A 1GUDA 2G3YA 2NV0A 3FCOA 1MJGA 1XTRA 3VYSB 2JL1A 2QE7A 2WD7B 5D5HA 2B5VA 821PA 3UJNA 1EWKA 3USES 4BNYA 2JA2A 4J1QA 3CZ4A 3VYVA 4DY4A 3I04M 3HHEA 3LYLA 3BWEA 1A04A 5H80A 3QEMB 4OQFA 3I1YA 4E5KA 2A9OA 3EMVA 5KVSA 2D1RA 3OT5A 1P9RA 3NIWA 4WZBB 2HBZA 4XW2A 2JJ2D 2A5JA 3A7EA 4OI0A 2ZSJA 5ED0A 3KQHA 2RK4A 1K3FA 1AHIA 2AFHE 1SKUA 5DH9A 5IX8A 2O14A 2C58A 4P4SA 4UE6A 3R7SA 2O54A 5B37A 2WV9A 4IVQA 4HEJA 1NC1A 1B00A 4DVJA 1K2VN 1M8KA 1DVRA 1BCSB 3QPUA 4R6XA 4AL4A 1BRTA 4EYQA 5JWHA 1BFKA 2YUIA 4MLZA 1NDUA 5EMKA 2ABWA 4ALLA 4EMBA 2V98A 4AJ1A 2AJDA 3FG9A 4HADA 2JAXA 2WYIA 3PX3A 4PAGA 1YGYA 1ONOA 1DEXA 2MR5A 4HPJB 3ZV7A 1CZKA 1N0IA 1R9MA 1F48A 3DAFA 4Q9IA 3ZV6A 1ADYA 2MMGA 4NP6A 1IBCA 2ZBGA 3FBTA 1EUDB 3C4QA 1EWQA 2P6PA 1QHEA 4YP7A 4WBNF 4ZI3A 1QZTA 4ZYTA 4IG4A 1L8AA 2XNDA 1QV6A 1OA1A 5AO9A 3ZGYA 1LBEA 4C0SA 3NONA 3DPSA 2C5GA 5JPIA 4NZ9A 1FPMA 2LW7A 3IXMA 3OOWA 1I3CA 5B1YA 5J23A 5TQ2B 5DZSA 5BV2P 3NYWA 4E6PA 1QRDA 2G1AA 4O4JB 1D1SA 4G5OA 4ZAYA 5CAEA 4Q7MB 3H9QA 2W42A 4RS4A 2J3EA 3L7LA 3KJGA 3FRJA 5IJAA 2FX3A 5IXYA 4AQYB 2Q41A 4GUAA 2H1SA 3UEOA 4BB0A 1ADFA 5C8YF 4QL3A 3QKRB 5TGDA 4YAUA 2IKSA 1SFRA 4KYTA 1XNJA 2B83A 2O9JA 4I6GA 3ORHA 2PD3A 1XYYA 2HBRA 3A3PA 3C41J 4F92B 3RPEA 5CM9C 5DYYA 1UDWA 2N0SA 1QHIA 4ZJUA 1XPOA 1EM8A 2VDJA 3GGJA 4A82A 3F6BX 4J1NA 3FSGD 3KAJA 4TT3A 4FCCA 2PM8A 2XIJA 3HV2A 1P7VA 3P94A 3PKJA 4AY5A 4RJTA 5IVPA 3AETA 1J5PA 4H6VA 1R18A 3B6JA 1YVPA 4H77A 1S0UA 4WZAE 1X42A 3ZGNA 4BMSA 4DJTA 4UCQA 4OHVA 3VHXB 2X0RA 1AZSC 3ILVA 4GWGA 4JR2A 4EB0A 3IAAA 1QYXA 2YIVX 4ZO7A 3AIIA 4DIDA 3LQKA 4WZBA 3W5AA 2RGAA 2ORWA 4C0LA 4HY3A 3OX4A 2GMWA 4L16A 4V0LA 2QMYA 1S2LA 1JSRA 1Z4NA 4M0FA 2OCLA 4N0EA 4RKEA 4YP9A 3PZBA 5EGSA 3VTAA 1XQWA 3GP3A 1BJTA 1QK4A 2PXXA 1DQPA 2FUG6 3CVOA 1ICEA 1ZAKA 3OM1A 3CWQA 5FOTA 4RF2A 4DHEA 2GEUA 3E3NA 4E31A 5HKOA 4QQFA 3VBEA 3GLGE 1SELA 3ZCQA 4YNBA 4IXNA 2OUIA 1XVUA 3ZBUA 3ANTA 4FDMA 4KVZA 3MWEA 1BNCA 3FDFA 1NSFA 1YFZA 3G23A 1GN9A 1HFJA 2HZ7A 4OMFG 5H9VA 3W5HA 2OA0A 4TX1A 1H2FA 1WB5A 4O4IF 5DT2A 4XFDA 4EUFA 5LQSA 5C8YA 4ZICA 1V41E 2QVYX 4O2BF 2QAGC 2VJMB 1D2EA 2WJIA 1CF4A 3OU6A 1E7MA 2H85A 3BMCB 3TI7A 1IHYA 4X95A 4GLBA 3N8DA 4R8MA 4AKTA 1IZ0A 2YXEA 1EBFA 3DR3A 3BFJA 3BRWD 2GEKA 3OA2A 2OV4A 2RGXA 3KQVA 3CEMA 4D8WA 3MNFA 4G8BA 4B2IA 4TN1A 3AI2A 3QLUA 4BATA 3QWAA 2Z2YA 4PG7A 4ZXPA 1QCDA 4RA9B 5HBRA 1RPNA 1JS1X 1FS5A 2BBOA 3UJCA 4PPGA 4UVIA 2EXXA 1TM1E 5GZ3A 2W0MA 1G18A 1PRYA 4TMWA 4ZZ0A 2WP8J 4RETA 4M1TA 4Z8XA 1B42A 2GZDA 1XHFA 4P0QB 3OCYA 3GLIB 1XL0A 3OF2A 1MAAA 4QTTB 2XT0A 1VZ3A 4V2UA 4UMVA 4XR4A 3H1PA 3ISTA 2JI7A 1G21E 4JLPA 1GG9A 2WMYA 1Z5WA 1CY7A 3NDPA 5DF1A 3ZS8A 3ICEA 1I6WA 2H8KA 2CLMB 3NBFA 3SU8A 4BMCA 4AUNA 3H2ZA 5B1SA 4TLAA 2ZQZA 8ATCA 3S28A 3ZWCA 1JLKA 1KY5A 3KR0A 4ALJA 1EX1A 3FVQA 3HWSA 5D87A 3G5MA 1FUYB 1LUAA 2K7ZA 5AIAA 3ZV4A 4DA8A 4RTQA 2PUDA 2PT5A 2UV8A 2FPIA 4P98A 4U3JA 1X7XA 2XDWA 1NPTO 1UDRA 1P60A 2IYNA 2I4IA 2RD2A 2Q8NA 2ZJYA 4MMYB 3IDZA 4BQSA 5GTDA 5HXAA 1OGJA 4P7JA 5K2OA 3AF1A 1IK6A 1E5VA 3KOXA 3QEKA 4NG5A 1PVOA 2BVNA 5CNMA 2HCFA 2JD0A 3ICOA 4QM7A 4EITA 3AB7A 1KC3A 2PEZA 1ZISA 3KSZO 2R7NA 3UTDA 1MBZA 2XUPA 3JARB 2JH9A 5FLYA 4XPZA 5GJBA 2NV2B 3JQ6A 3JV7A 1BXRA 4TRRA 2JGDA 4BKMA 3T4XA 4E7OA 2JVKA 3QENA 2HMTA 4GNKA 1U0FA 1G7SA 5JY1A 3V8MA 1TKAA 3RVSA 5FNVA 1IAVA 1YI8A 3UHFA 4W82A 3CTMA 5TQJA 4J0QA 2P4SA 1NXPA 4OJMX 3SJBA 4RPKA 4KSCA 4E5DA 4I3FA 3MUNA 4DIBA 2B3TA 5I5GA 4IV5A 4IOKA 3LLUA 2H1FA 4B87A 1FLNA 4KB5A 2VSXA 5G2OA 2OHGA 5EZYA 3DAOA 1A8PA 4QEZA 4Z3DA 4M88A 3ELYA 1LI7A 3I23A 3AFMA 3KWJA 2PG3A 3LECA 1UKEA 1O94D 3PHIA 4FHDA 4G63A 5FRDA 3D59A 4MGEA 2PUEA 1RRMA 5CU7A 4MPRA 5AJVB 4N9WA 5ALRA 3VTKA 4C22A 1NG9A 2KX7A 3DNMA 2EKBA 2A35A 2PZMA 2OCXA 4QPCA 2XYHA 2YWRA 1QNLA 2GF0A 4WASA 2HPZA 5IW8A 3OTGA 3N2KB 3LFUA 1JG4A 621PA 4I14A 1T8RA 5FJIA 4BX8A 2Z6VA 4OYYA 4C6TA 4HD8A 3AUKA 3HI4A 1YC2A 1YAHA 4YCAA 2D0DA 3URMA 2R25B 5LCXA 3MXOA 2QLMA 2XAAA 5FPKA 2C8LA 1KGSA 1VYTA 3C14C 5AICA 4BVLA 3FMGA 1U2EA 3NGMA 1O9GA 2FQQA 1XCPA 1XFDA 4DR1B 4MROA 3F5DA 4NTZA 4KGVA 4KQCA 3G2IA 4QQRA 3MCZA 4TS3A 3T5DA 1IM8A 1OVGA 2WSBA 3R8FA 2QENA 1WS6A 5ILGA 5L40A 4Q1CA 4BLTA 3N76A 2QW8A 3BJIC 3QWIA 4MPDA 3SLRA 4ND3A 4JOBA 4BX3A 4EVIA 2YWHA 4LVCA 3D3WB 3GLIA 4O4HB 2Z98A 1SB9A 5T41A 4XTRA 3IT1A 3ILXA 1OBVA 2P41A 1TZBA 3PPYA 5DCYA 3ZK9A 2X5NA 4XJTA 5IAAA 1GUFA 3X1DA 1OBCA 3CRW1 5BXYA 3S8EA 2W2KA 3EDYA 4Y98A 2XUDA 4JOQA 5IHPA 1KZ7B 4TXJA 2VPQA 3GA5A 3ICVA 1MXFA 1G8MA 4QOHA 3ZE9A 2GUWA 4RJLA 2WU0A 1AQIA 3PFWO 3ABSB 2GK7A 1IWBB 1G2QA 1XMPA 2IP1A 2YWBA 4G84A 4IGIA 2HJWA 1H6DA 1EFRD 2QM8A 5ER9A 1RRVA 5KU7A 1SKAA 2JASA 2X2FA 5ALEA 3HU3A 4BQIA 3FZQA 2PQ2A 3FNGA 3QXHA 1ZN7A 2CEAA 5LMUB 3FYCA 4G09A 2PFSA 1QONA 2HEIA 5IC6A 5COAA 2D06A 3P0HA 3UJ7A 3LUHA 3NUGA 4M21A 1O8BA 2JIRA 3PITA 2D13A 3PLRA 3U31A 3QUCA 3ZIAA 5KINB 4JGGA 4P35A 5CB4F 1ZUHA 4KE7A 3GJYA 1J2TA 3B6KA 5LU9A 2C77A 4BCBA 7AT1A 3X1MA 4CIAA 4EFMA 3B9RA 4XAQA 5HIAA 4UEQA 5P8WA 4EK9A 3EIOA 3CX4A 4A0SA 5FH9A 4QFCA 2JK0A 5CBKA 3LHFA 4I5FA 1E3JA 1K6EA 2Y76A 4BU0A 1H3NA 2VN8A 5HQTA 2DHCA 2DHEA 2IEDA 1S2DA 4N5DA 4CMCA 1XZEA 2JGMA 2ZYTX 1NQUA 1K4MA 4MEBA 5CIQA 2WWWA 1AM4D 1XA4A 2V5UA 3MTDA 4JGIA 5JAOA 3UB4A 2JJMA 5I45A 3A1NA 2IYAA 3KQMA 2K6GA 3CO5A 8ADHA 2X8WA 5IC5A 4JH0A 2PLAA 5K0NA 2AS0A 4G6ZA 2ZQ5A 4NCNA 4DEYA 2OFFA 1VCHA 3PRKE 2O5CA 5EIEA 4QDKA 1JSCA 1TCAA 3GJSA 3V4SA 4DV1B 3R2JA 4C20A 5JQWA 1CZHA 1YDWA 4YO7A 2CB9A 2K5UA 3IA2A 4F7DA 2XMZA 4G0MA 3ZWWA 2J07A 2EEPA 2IODA 4OOFA 1YASA 2Z4SA 2VK4A 2PU7A 1U99A 1MAVA 2EP8A 3K2QA 1PJCA 1SQSA 1BX0A 1RM3A 1KFBB 3MTQA 2MHCA 4KRYA 2V9ZA 2J7KA 4ZV9A 3ZVNA 5A06A 1EIWA 4HBZA 1Q44A 2GN8A 1DIAA 4B40A 3IKMB 3TVTA 1KWGA 4DCJA 4QXPA 4AKEA 2H4XA 2A4KA 4GLJA 1OHHA 1F8FA 2TMDA 2X2OA 4I55F 2VQEB 1MGOA 3SIPA 1DC3A 1T9GS 1U3WA 5ES3A 1Z45A 1XPUA 4CGYA 5KMGA 2X42A 3NXKA 1HF3A 3NWJA 4NEGA 4NIMA 1NQVA 1QNFA 2WWYA 4PGGA 1GTSA 3F47A 2DKFA 1XXHE 5FWDA 4LISA 1P73A 2O2CA 4MRPA 1C50A 1C9EA 5EPUA 1U3UA 3ZLVA 1EP1B 3LKVA 1KOGA 3HVIA 3JSXA 4IS2A 4M9ZA 2ECQA 4LRUA 4YT8A 4II3A 5J59A 1E9EA 4DMFA 4N65A 4QQ8A 3PSAA 4U2DA 1THGA 3SQMA 1TI7A 3O84A 3STHA 2JI4A 2EF1A 9LDBA 1G60A 2V7GA 4GR4A 4IDHA 4MQ4A 4UU7A 2Q5HA 5ENDA 3KT8A 1D07A 3QTLA 4HGRA 1WIWA 3H65A 1I8TA 3RJ9A 1LPPA 3KK0A 2CVFA 1JRLA 1KH2A 1DTWA 1WSDA 2ZE5A 3KZ1E 3FNIA 1EVKA 4D9FA 1FTSA 4Q82A 4K3UA 5KNDD 1IMOA 3FRIA 2YQ4A 2ACKA 3GT0A 1VA5A 1W30A 1KAEA 3QVVA 3HCPA 2PKEA 2RGGA 3BL8A 4M1MA 2IH5A 5AK6A 3CMCO 4DZZA 1RE1A 1C0IA 1Y0BA 2ZRPA 4OI4A 2VDNB 3D3JA 5CDFA 3ZVKA 3D6TB 4IDDA 4Q3LA 3ZHUA 1W36C 2BFCB 2WUEA 3E22A 1MJGM 2C00A 3OU7A 1KZHA 1ZR2A 3DWGA 2B8TA 4NCIA 3D6VA 1BFDA 1U4NA 3MM4A 3SSOA 2XTNA 1I0IA 1FBNA 2NZ2A 3VO9A 5EHXA 5J1SB 5LP6F 4D99A 2VTBA 4KQ6A 4PU0A 4CM1A 1VL2A 3Q40A 2AJCA 5EKUA 2RHWA 4ZVQA 4CF7A 4QC2A 1X7WB 1YE8A 2C0CA 3C8MA 4LCEA 2XBMA 1GZDA 4FJ2A 1ZIOA 5AKGA 3WWEA 4B9AA 2V8BA 3PDWA 1Y48E 4WZAB 5J9FA 4EY8A 5CFOA 2J5RA 2AYXA 1QQ5A 3D7LA 4J90A 1DT3A 2E4AA 1M73E 4ZK2A 3BICA 2C29D 3GX1A 5F9MA 1TUGA 2H08A 1N8NA 4HXFB 2HYIC 1E94E 1YRAA 2OBFA 4LE0A 5K4AA 3WV4A 2ZRLA 1YT5A 1DT5A 3V42A 3H4IA 3GLIE 2DBZA 3IAFA 1SXJC 1E6LA 3TTTA 4AZ3B 4X93A 4EKDA 3U3DA 4EYGA 5CX1B 3E9CA 3ZTTA 4I9GA 4AN4A 1ZGZA 4BOYA 3ZDCA 4AS2A 4YCLA 3V6LA 1AGNA 3JQFA 2N3ZA 3GZNB 5EJ9A 2JJ1D 1TQ2A 4L8WB 4YAKA 4BVEA 3CLUC 1E4EA 2QOEA 3BM5A 3O74A 3OQBA 5CJPA 1MTOA 3PNSA 3W9UA 3DL0A 3FLMA 4JBGA 4LQCA 4QKQA 4B3CA 3OUUA 1E3QA 4DIFA 3DFKA 4DRZA 4IZIA 3QWFA 2EZ4A 3TQOA 2WMOB 2P9JA 3VNBA 3T3NA 2F43A 1GYQA 2C3YA 2RH5A 1E63A 3W8DA 2XUKA 3J80A 4G56A 1V95A 2OM2A 4YAOA 1UBLS 4E11A 1ANKA 1L3IA 2WF5A 3BGDA 3TG2A 1N2EA 2E85A 3K9FC 4P4SB 5JZSA 4QUAA 1TEXA 3GPLA 3LUPA 1FMTA 1ORVA 4EVQA 4D5GA 1ZCFA 1H4VB 3QRWA 3F5SA 5FJJA 1G64A 2V97A 3CLRC 1IPEA 4X8HA 5JD3A 4JXZA 1AUQA 4FGSA 5C8DA 3FFBA 4MKXA 4M0PA 1T4BA 4FFSA 2QMEA 4XZ3A 2DJIA 4CCWA 1CUGA 1FMFA 4KBFA 4R5HA 2HJ9A 3TQSA 3LT5A 4FBMA 4B80A 4AS1A 1MEOA 2FW6A 2HM7A 1QH0A 1I1OA 1PW5A 3L0BA 1Z39A 3T1QA 3R6LA 4JYMA 1DG3A 3VC3A 3OHSX 1KH1A 2XIQA 4K1XA 3SNHA 1Q83A 3WGJA 1Z0JA 1GUYA 1YZQA 2WKQA 4M1ZA 1AGXA 1W5AA 4MUEA 3SE7A 2JLZA 4XWTA 3CF6R 4J9UE 3EG9A 4EW3A 4RS3A 2QRKA 2IYEA 1CRWG 4R1PA 2C8KA 3HJUA 3MTIA 3FMVA 4AMZA 2EIHA 4JP5A 4NBRA 4OHCA 3EX7C 2B30A 4HGOA 1VHQA 3D02A 2Z5LA 3OLXA 3R7DA 1KQ3A 1KXJA 5HR5A 3ENQA 2ZBFA 3O8QB 4QBGB 1K3UB 4C03A 3FUWA 2PL1A 2VTKA 2HCBA 1NVBA 1SCBA 5AHXA 3GFQA 2LXNA 2O50A 4L27A 2QRUA 1QGYA 4BO1A 5CDFE 1CCWA 4YJ2B 2EFGA 1SD5A 3H11B 3RUAA 4MW1A 4Q00A 2JAPA 4HNTA 1M0SA 2XQKA 2Z6AA 4JL5A 2BMDA 1HMYA 1REQB 3LQ4A 1TC1A 2QGNA 2X58A 5MFZA 1ECBA 1KHHA 2VWPA 3M9LA 2P9GA 3G2NA 3CN9A 1KZ9A 1FXWF 4MUFA 3SYMA 1YS6A 3JQAA 2Q3DA 4LYGA 4YASA 4Q9LA 1VBFA 1GZVA 1FXSA 1CR6A 2HO5A 3HC7A 2FZLA 3ETEA 1YJCA 3GG9A 5LZ9A 4PPNA 2AV6A 1ZW6A 1VM6A 2WMNB 4NCKA 1OX5A 4OHXA 1NUPA 4RHYA 2AG0A 3ERCA 2WTAA 5BRNA 1YA4A 2JI6A 4EMUA 2EV9A 1X38A 3BGSA 3ONWA 4RJIA 3LP6A 3GEHA 121PA 1VHLA 2A58A 3EEFA 4FIZA 3IR7A 4RKWA 3LQFA 4MOWA 1T0IA 4XFJA 1N9GA 1O89A 2HUPA 4QVKA 4AMBA 2FP4A 1U8UA 1SC6A 2A0UA 4US2R 5LZ4A 3ZZ0A 1X9IA 3VYRB 5E0OA 3G0CA 5M2QA 4EGJA 3THYB 1E1YA 1PAUA 3HLKA 1A8IA 4G1BA 4EG3A 5A5VA 3S2EA 3PFBA 4ZQFA 5CW2A 1AZLA 4A6EA 1MZPA 4Z1MD 4E2WA 3FA2A 3IRVA 1ZGBA 4FUQA 1P8AA 1SG0A 3M4NA 1MLDA 1I13A 2DPXA 5BV7A 5I3CA 1ZC4A 2FEAA 2YMMA 4K8OA 5D85A 2UXDB 3H04A 4F8JA 1Z5NA 2BMFA 3F71A 3HFJA 4RZ3A 2NN3C 1JR3A 2HF2A 1D8TA 3GQBB 4K6MA 4PQGA 4BIMA 4D26A 4IH4A 2BL4A 4IO0A 2C5EA 2YCBA 3JARA 4R8VA 1MX3A 3M2PA 4QTZA 2HA6A 4UAGA 1P0FA 2X5KO 3CLVA 2C0PA 2QRHA 3CX3A 2WE8A 1NVVQ 1NZDA 3QY9A 3WK8A 3DDUA 1XLVA 1WX1A 4BRUA 2PCLA 4UCFA 4BGEA 3N3AC 4HAWA 2PVPA 4EW2A 3CX6A 5J2TF 2J08A 3HWRA 4GXNA 5T6BA 1CZLA 3AGPA 5JECA 4ZOBA 2GPYA 2BHLA 5FBWB 2R7LA 2WTEA 4ZZ3A 3N2YA 5KQPA 1E4VA 5IBQA 4C04A 4L5CA 4AJHA 2Q2QA 4W9NC 1V0JA 2RK3A 5BVHA 4FXOA 2Y2UA 1N2CA 2I9KA 1O9HA 2KLBA 1O4WA 1NKTA 1H85A 4YAIA 1YWGO 4OEHA 3EQ8A 2Q6VA 4URWR 2FI1A 4E2ZA 3CIFA 3W5DA 3JSAA 2G63A 3QPCA 1HNWB 1SVMA 3GVPA 1H2HA 4ESVA 1Y1QA 4WVLA 2YZNA 4PV7A 3A8TA 2UAGA 1RP1A 3N70A 3V5NA 3FUCA 3KJFA 5FIUA 3COVA 3BOSA 3IILA 1KJIA 2OSVA 3UAZA 4ZFNA 2C4NA 2AN5A 2VSQA 2Q50A 3BK1A 4RFSA 4C7JA 1NFRA 1C81A 3TQTA 3UGQA 2XD9A 3BWVA 4EATA 1KQPA 1JGTA 3KVNA 4MVJG 4YQYA 5FO0A 1W34A 4FDLA 3GK3A 4LC1A 1QHXA 2IBTA 1THMA 4C4AA 1Q11A 4ZXFA 4KXNA 1PIWA 1E1DA 3U3MA 4EHBA 4DIEA 3WDSA 3C24A 4HQLA 2ZOSA 2VRBA 2ZE6A 3N0WA 1K5HA 3A3YA 1TUEA 3CUKA 1IATA 5F51A 1W5SA 3G1TA 3T1TA 5KREA 1RC0A 1KNQA 2AFHA 2IYOA 3ZUPA 3NAZA 2HHLA 4C29A 3A28A 1U8ZA 3HSYA 2I22A 1JHAA 4QXAA 1MRNA 2RONA 2XF8A 4P83A 1T5TA 2BCGY 3LDHA 3Q0IA 4UHFA 3HL4A 5HSGA 3Q0EA 1ZNWA 5IXSA 1L8QA 1U0NA 4LJAA 2N9UA 3K1AB 5AVJA 1LDNA 1DIHA 4AULA 1R88A 3RUEA 4DCVA 4BNTA 2IJGX 2D6FA 2O8CB 3C7KA 1P19A 1GZUA 3BGVA 4D44A 1JILA 2DTDA 2PS3A 3EIFA 3R6TA 5LQCA 2I34A 3A9TA 5FR1A 3KKZA 1ZD3A 3U4DA 1MW8X 1DTSA 3HB7A 1E96A 1EFVB 5BWOA 4TLMB 5B6PA 1YU6A 3ZJYA 2H18A 1QQBA 1FSFA 4GP6A 5KSWB 5FI0B 5G0UA 1FCJA 1MR3F 1TYZA 2MSKA 3IVMA 1QKKA 1KDTA 4CKYA 2O07A 5GV8A 4BP3A 1TTTA 3LAWA 4WY8A 5FPTA 2HX1A 2XYVA 3MLBA 4DDWA 1A1VA 1M2KA 3GA0A 4DA9A 1Y3BE 5FV4A 4WOKA 1QHHA 1M9NA 2DQYA 2CHFA 3UPDA 3VISA 5KTKA 1UC9A 4E07A 3C3KA 3IP6A 4JBYA 2JJYA 1KYWA 1E2PA 2GBLA 3EASA 2FCRA 3GWZA 4RSGA 3SGLA 3H83A 1CFZA 4QT0A 2CLCX 2XBLA 5CD1A 3FPAA 1QBGA 1BQ4A 1AY0A 1YC5A 5EESA 1NMXA 4FI3F 4EA7A 2C4TA 5BXQC 5HF6A 4G5QA 3QELB 4NOLA 4YYZA 5IVIA 4G5XA 4LDRA 2YN4A 5C53B 4XJSA 5AOCA 4OJKA 1E64A 4DZRA 3K94A 3L0YA 2C3UA 5BYJA 1NVAA 3LCVB 3N5CA 4OQMA 3VRHA 4F12A 4DQKA 4Q05A 5LP6A 1XRPA 3K71B 5SICE 3FI9A 1XVAA 2QZSA 1R8QA 1SOMA 1ULBA 5DM1A 2W6JD 4MHSA 4EQ6A 2WQ7A 3OAAD 3WJAA 2D59A 2VNHA 1MMFB 1R15A 1M34B 4DLVA 4LJLA 2FDRA 2QROA 1E0KA 1LC0A 3BORA 4OQLA 2Q5CA 3BGWA 2XXJA 3D5EA 1IHXA 3GCWA 4RGBA 4ARIA 1FZTA 4RX1A 5CFMA 3HZHA 1J99A 1LRKA 1PQ4A 1YRHA 2VLBA 4MINA 1R66A 3DA8A 1AN9A 4H18A 4B3FX 1I7PA 2ZM5A 4TZ6A 4D0RA 4U2CA 1EU1A 5CB6A 3B1WA 2Q4DA 2Z3ZA 4N40A 3PQDA 3TLEA 3AILA 4R01A 3H5TA 5G4LA 1E0JA 4Y9TA 1P9LA 3TS1A 4CQLA 4EEKA 4LSWA 1CP3A 3RIHA 1OLSA 4TV9A 2B78A 3MMNA 5IF3A 3OTIA 4JXKA 5CVTA 1DQYA 1FX1A 2WTNA 3GEDA 3ONFA 5DI3A 4DAOA 4F97A 5LD2B 1M2EA 3USZA 1DRUA 2ZSHA 3AJRA 1FX0A 4OQEA 3AVYA 3HY6A 3DVAA 1PJ8A 1T2AA 3WADA 1VG9B 3SR4A 3WLHA 1Q7RA 5E38A 3ZVRA 1QE0A 4OKSA 4E13A 5FLXA 2X8BA 3I12A 1YRYE 3FN4A 5AKKA 2J48A 2ZI7A 3R8CA 4BU1A 4R3WA 4MJXA 3IBGA 3LJKA 4JLBA 4C14A 4B7CA 1A8UA 2P4HX 2ZJ2A 5CDSA 3K0SA 3WG9A 3AUYA 2B6NA 4O4IB 4V0SA 3QKUA 1U0BB 3B20A 1E2FA 2GCIA 3BL6A 5G0WA 3ZE7A 4ZT4A 3A10A 2RJ3A 2FN4A 2BFNA 4HO1X 5CMLA 4BX0A 5TJ9A 3T3DA 2GEBA 3AUAA 3SIWA 2I67A 4K05A 2YXPX 3DBLA 4X1IB 1AMUA 4EAAA 2GNAA 1VMKA 4C76A 4XIIA 2C3MA 3PDHA 5KYWB 4BP8A 3MWKA 3Q8XB 1RHQA 4IIEA 3FSJX 2HHJA 3ZDRA 3LX6A 2XUHA 5AVTA 4CNQA 1NVFA 1FB5A 3MCVA 4F3KA 5DLYA 2GNPA 4WFKA 1EZ1A 1EMDA 2OD7A 2GF2A 2WHPA 4WZ6A 1MX1A 3FGPA 1Y6RA 4EFNA 1ZHOA 3B9QA 2QZPA 1R5JA 4LC0A 3FUVA 1DKOA 2G88A 4QARA 2I2XB 2PJZA 2WYVA 3NR2A 1DRWA 4Y2GA 1GPUA 3IBTA 1GGMA 5KKNB 4YROA 1M2JA 4BZPA 5A1JA 3ODGA 1PZMA 1C4XA 4PYLA 4UTXA 5ITSA 2RHGB 3R9KA 4F2PA 1JIKA 1W52X 2MOKA 5FV7A 4P31A 4TV8B 4I1SA 1ESZA 3TW8B 5M3BA 4F8YA 4OGGA 4HQOA 1PJQA 1XDUA 4Q9JA 5JCJA 3IQIX 1JL3A 4PVDA 1SBIA 3O4IA 2ECKA 4O4LA 5IM4F 1YXMA 4M0EA 1MHPA 2ONKA 4KQGA 3QX7A 1MTZA 3AHJA 2EDAA 3B2EA 1V35A 4FR5A 3D9QX 4U39A 3ANSA 2I55A 4DA0A 5JAZA 4QU5A 2Y1XA 4NZOA 2FG6C 2CLDX 3B1XA 4YT4A 1SVKA 1YR2A 2IEIA 3CNEA 4NESA 3O21A 4C0AC 3DXYA 4EGAA 4ZEVA 1VKHA 2B4RO 3OMXA 3PDJA 2OV2A 1OWLA 3JR3A 4R3NA 2P6UA 5DCWA 2WJPA 2J0QA 3AC0A 4WZBE 4EJ6A 2ZWIA 3QKWA 1AXGA 1F0KA 2DQKA 4Z9AA 3FTNA 3PUJA 3X1KA 3GD7A 1BOOA 5ECGC 1JBEA 1QC5A 2HRRA 4UHJA 1JT9A 2CDAA 1RAFA 2D0IA 3PQ3A 4TVOA 3WGKA 1SVUA 4EMSA 1BDHA 3SN6A 2QRQA 3I52A 3DO6A 4HX5A 1TUBB 4YP0A 5FHQA 1OKKA 5LU8A 5LYJF 5K8LA 2JD2A 2V6IA 2MINA 2PYDA 3EH2A 1RLMA 2PUCA 4K1LA 1CJMA 4QXRA 2VZ0A 1P2DA 1U7OA 1Y4ZA 3IEXA 1R74A 2PR2A 3WJ1A 1UP6A 1PQWA 2D3TA 1FNNA 4R1MA 3X2EA 4D57A 1FSPA 3DEFA 3DZFA 3TLCA 1MRZA 1X1TA 2FPXA 4HYYA 4D4MA 4XVCA 3D7MA 3Q8MA 1MAWA 2IGTA 3O6VA 1ODCA 3BE8A 1UMDB 1YJXA 1GRCA 3NWEA 3P9XA 1MO3A 5EUQB 4TTJA 1NAHA 1D09A 4G1EB 4MQLA 4XI9A 4EZBA 2NZUG 4B2YA 3KOUA 2WNSA 4JYBA 1YRQA 2IYXA 2BM8A 3AOGA 3QIVA 1BE1A 4HLUA 3W7AA 3ZNQA 5BYKA 3EYAA 5FKJA 1QO9A 1FSGA 3RWBA 1FFGA 4JUFA 1XP8A 1SUSA 3H2IA 3UQYS 5AVXA 2G9VA 4PSCA 5LJLA 1D0IA 2ZM6B 1WUYA 5NLLA 1UOQA 5F7XA 2Z30A 2WSSD 1L7AA 1YR8A 1DKNA 2EJCA 2Q6TA 3WE7A 4OJYA 1N2BA 3IPLA 1VDZA 2PZEA 3D8HA 4KRXA 1NMQA 3FD8A 4EKGA 1JMVA 3ANNA 5JZMA 3JQPA 4ZRDA 3T3MB 3WLRA 2YWDA 5GOTA 5CX1A 3HM9A 2HKIA 5EVCA 3HCDA 1PKEA 1TMGE 4IF6A 3TOZA 2N46A 1GM5A 1J5XA 1Z07A 3D81A 1XEWY 2P2CA 4JLVA 3F7OA 4X63A 1AKWA 2I7XA 5HIKA 4EG8A 4I1UA 3UW1A 2WQZA 1QH8A 1II8A 5DHQA 3OCZA 3UW3A 4BQPA 2B4YA 3DE3X 4NJMB 5BQ3A 2O2JA 5JO9A 5L3QA 1C9JA 2I3DA 2ZI6A 4GMGA 3KB6A 1MJHA 4AO7A 1SXJA 1MENA 1VKOA 4KSBA 4EIWA 1F0YA 3I72A 3QNMA 3R4VA 4R8KA 1D2CA 4TMTA 4ZZIA 3O3MB 2BYTA 3GGOA 3NM4A 3ZKWA 2CVQA 2ST1A 2ZB4A 3B3AA 3S7TA 4E2XA 2ZSFA 3H75A 5EE9A 1L5QA 2A5YB 3BBLA 3TLGB 5BV1A 1FRNA 2H4HA 4QOGA 4LNUB 1NTOA 4YXWA 5AH0A 4DYDA 1HH4A 3ZBPA 1H8EA 5FAKA 1RXCA 4NYMR 1UAYA 3Q9UA 2BFFA 3RUPA 3VPDA 1KMHB 4IUYA 1Y5LA 3WJ2A 3JVVA 2PWPA 3W05A 1Y1TA 3QY0A 3V2IA 4GE3A 1JG6A 4WJZA 2QD3A 4R9VA 3VZBA 3BJZA 2YVKA 1RAAA 4WOCA 4Y6PA 5J2UA 1BGXT 4UUQA 2ZW9A 3B3GA 3M49A 1ZZEA 2NZVG 5JS1A 1T6NA 1JFLA 2NU8B 2I4OA 3ZU6A 5JALA 1PHPA 2R11A 2AC4A 1N9KA 3JASA 2X76A 2EOAA 4DRXA 3JQQA 3ZHVA 4BJHB 2V1UA 1OLUA 1NM5A 1TZJA 2FEMA 5HKKD 3M4XA 5JR3A 1W88A 3L7AA 4NZPA 2Q28A 3EC2A 3QI7A 3TIIA 3VO8A 1L1QA 4L95C 3FTFA 1XSEA 3AW9A 3OZ7A 2NO6A 1ZFNA 3WL6A 2AX4A 1DWUA 4WLNA 4KUHA 3IMKA 3TO5A 1QIDA 4CRWB 3GFFA 5DI9A 1KDPA 3T15A 4R2LA 4UNRA 2AZXA 1UWVA 3CUUA 3LDGA 5IDYA 3JWHA 4LGMA 4U2GA 4S1WA 4HR7A 4XM0A 2CNKA 2YN0A 5F2OA 4YR9A 3JQEA 4NENA 2FR1A 5DHSA 2FWMX 3R6WA 4WOBA 1A9XA 1X0XA 1WDWB 4MIKA 4XM1A 5ILQA 3TRIA 1R6VA 2ZIGA 3WDLA 1YBMA 1T3SA 4I66A 4NNJA 4DLRA 3DMRA 5K7SA 2P9QA 1RHMA 3UAYA 4YPFA 3C5WP 4TM7A 3V7YA 4E5PA 1P1KA 3P0RA 1SQFA 1NUSA 4DC9A 3UJ6A 1CP2A 3D31A 1ACMA 1E4YA 3LUGA 3SD7A 5IWAB 4QDOA 1ZWLA 4EDFA 4HC4A 1DIOB 1Q77A 2ZVQX 2FPOA 2WJAA 3EMKA 4R40A 5ERXA 3QE4A 3ZYCA 5F35A 4PLCA 5GADl 3K05A 2ILTA 1KVTA 1KIMA 1ST3A 1O8CA 2E0IA 3X43A 2VP6A 5KJCA 3RNOA 5EEHA 4UPEA 5LUAA 1VFPA 4I4IA 4J16A 1L1RA 1Z56C 3B3JA 2BBTA 1ADBA 2BLNA 2V0CA 5AQ1A 5KYYA 4EX7A 1OH8A 2Z9BA 5DK6A 4V3CA 4LXYA 2AN1A 4GFDA 3RRZA 1K7EB 1D2GA 2G5GX 1UDXA 4WK4B 4IXMA 3TAUA 4IQ4A 1JQLB 1NMYA 4A1FA 4PR3A 2CJWB 1YDFA 3WLFA 1WTAA 3L2OB 4W5NA 1HT3A 2JLYA 4MR9A 3TLZA 1SB8A 2FX2A 5K6AA 5KWVA 3GFOA 1JNYA 4FVTA 1OFVA 1TM5E 1OX4B 2FK7A 3OURA 4P5PA 3V97A 4Y2XA 1GAEO 1RQXA 2HA7A 3IT2A 3RUCA 1NXQA 2WWTA 3U17A 1R9NA 1AB6A 2CLEB 3WLQA 4WW0A 5IKMA 1HZZC 1V7QA 2VTVA 4ABYA 2P3LA 1XNQB 2PZFA 4W99A 3QHPA 1M2GA 4QD3A 2R66A 3GL9A 1F0PA 1O97C 1V6AA 2HD4A 3KYBA 2PTGA 3WO0A 1ZK3A 3UATA 1HDCA 2B9EA 3A1SA 4H4DA 1UM9A 1NYQA 3QFHA 3JQ7A 4ZQHA 3LPMA 1MB9A 5EIOA 1JFSA 1OI4A 5E9WA 1D2RA 2BTOA 1QKIA 3TPFA 2I6SA 3KHSA 5CR9A 3GP5A 1NG1A 4QRHA 3WAJA 4CXMA 3FDJA 3VOTA 1GGNA 1P1CA 2CXTA 5JAHA 2DFNA 2DFPA 3J81k 5LMCA 4FBLA 1SQ5A 1C7JA 3E9NA 3DUWA 4PM4A 1N32B 2CXSA 1T1GA 1V1RB 1Z2DA 4UNQA 4JI2B 3IE2A 1UM8A 2BTQA 3O0DA 3LWBA 4G0QA 3OM8A 3P5BA 4J1SA 3ZYZA 4AY4A 4EAQA 4POAA 3ZZUA 2CYAA 4HDNA 3W8EA 2FMKA 5IK2A 3F46A 2DLCX 3DDNA 2Z8XA 2Z9DA 1W36B 2O8BA 4JOCA 4TTTS 2AMFA 2H4YA 3PIDA 4CW7A 5JRJA 1UMBA 3PT5A 5A9TA 2AFIE 3ND5A 3O75A 4W7SA 5E3IA 3IXLA 1E6CA 2WNHA 4UNNA 1XE3A 4LJ4A 2VUIB 1R4AA 2HNBA 4DZTA 4EKEA 3DUFB 5CFZA 1Y7HA 1P3JA 1ZW1A 5BN5A 4MPPA 4OVKA 3K5PA 1TRHA 4FFRA 3DS8A 4PZZA 2Q5JA 4QPPA 3ISVA 4C3VA 4JA2A 3I28A 3P0EA 4C08A 1BIFA 1QG6A 3QOFA 5AYVA 4MDYA 4BE9A 1NFFA 1FYEA 3GHHA 4A3SA 4IKPA 3PTAA 2XWQA 1WW2A 4QWWA 1DHTA 1BO6A 3LDFA 5JMTA 5G1NA 5K09A 4MYSA 5IJWA 4I36A 2I54A 4YRDA 1WUHS 2GJSA 3EQ9A 4TWAA 5BUSA 1L3BA 3NHMA 4OXIA 3O4FA 3FMFA 5FHRA 4CQLB 4BQQA 3LY7A 2I76A 1EX7A 2O2EA 1CQJA 3SXJA 3O31A 3FAKA 4LEIA 1W19A 1ENZA 4RCVA 4XVQA 4ENQA 4QJIA 2P1RA 5ALNA 2APJA 4MQEA 3T5PA 4S1VA 1JIUA 3THWA 1FNCA 3N5KA 5CFNA 1TGVA 6ABPA 4CEIA 3CU5A 4J2HA 4MLPA 3TW4A 3A11A 4CL2A 4I9FA 3SYNA 4O02B 1M0TA 1GITA 5K6TA 2XCOA 3H16A 3W7BA 2FW0A 4HSGA 4P2GA 4PLFA 4EQ6B 4BAZA 1IZZA 3A1CA 4MS4A 6GPBA 4JJKA 1UM9B 5DJ5A 5JQGF 3WGQA 5JAPA 3ISJA 2YOHA 2JFQA 2B82A 3WISA 4XDYA 2O1WA 5D84A 3SDSA 3MLAA 3PEFA 4BBAA 3IURA 6NULA 4CM4A 2QTBA 5CB4A 3EA5A 5L6LB 1TJPB 1IXSB 4FFVA 3RSSA 3Q7SA 1MJNA 4H7DA 4MVYA 3OM9A 1ISRA 1PV2A 4DLBA 4D3FA 4UM8B 3QEAZ 4J91A 4UBIA 1QWOA 1CR0A 3INRA 5TVGA 5DNVA 2NVUB 2ZRDA 3QPBA 3KZKA 3TD2A 4Y2YA 3MGCA 3CT4A 4FE7A 4K87A 1Z2EA 2Q8QA 2YVQA 2ZJAA 1GAQA 1MAUA 4YONB 5A6SB 1R3UA 5HDQA 2XYRA 4GXRA 1DEAA 2C1ZA 1C1YA 1IZ9A 3D6UA 2CGEA 3G0OA 3DT9A 3IIIA 3K9CA 3KPVA 3P0IA 3N9IA 2ZYUX 1X87A 1EWTA 3NTRA 3U37A 3KKOA 4XKJA 5CBPB 3DVQX 4PO1A 3TZLA 1R4MA 2PGOA 2RC5A 4DR6B 1O6FA 1ELOA 2ANCA 4RD1A 2EBHX 1Y8QA 4D9JA 4G9BA 4JBXA 3CNHA 4XJVA 4L76A 2UVDA 2VPIA 4MJ7A 5IYZF 1Q6YA 2LRHA 3IAS1 3WNQA 4GZMA 4IDAA 1JG7A 2XYPA 1FU4A 3FIJA 4KSYA 3MXTA 4NDNE 3RR2A 3VDRA 3BSWA 1GO2A 2GBLC 3NOVA 2XV1A 1GTL1 4MRSA 3RF6A 1EUYA 3UJ8A 1KHTA 1IUKA 1DBVO 1PCXA 3RS2A 3U4GA 2XDQA 3MUFA 4L4UA 4ZGBA 2F8SA 2CFOA 2GHRA 4N3BA 4JQSA 4K2AA 1CZUA 1PF7E 5FNVF 4NICA 5EJAA 3IE0A 4LPSA 3SHTA 3UANA 4OHPA 5KNCD 3F78A 3OQVA 4DLZA 1N6IA 1Z6QA 1EVJA 8LDHA 3Q2IA 4JB2A 4NFYA 4RH1A 4Q4AA 4IIXA 4Z1OA 2YKGA 4Y6GB 2IOHA 3WA7A 2JS7A 1OPRA 5I7FA 2DKOA 5HF9A 4MYRA 4KR2A 3SZLA 2PL3A 4E94A 2NSYA 3LPDA 1KDZA 4YBZA 3QX3A 3QV2A 4F0JA 3TYXA 4MJ3A 3LUJA 4RM3A 3U3JA 1S02A 3WB9A 1EFUA 2GTHA 4PLHA 4CMGA 4EW6A 4GG1A 3HACA 1OC4A 3LUCA 3CUWA 1T5BA 3R5SA 1Z2AA 3B70A 3P19A 4OLHA 2J31A 4CIBA 2HADA 4NH4A 1Q5PA 1B76A 2BGJA 2KLHA 3BXHA 3HCFA 1DZ3A 1IY8A 1OI2A 3IDAA 4JMPA 4OY3A 3K6SA 3P9NA 3PXXA 2C4KA 2F3QA 2Q9AA 4Z2AA 3LF2A 2Z4RA 1JHXA 3PIIA 4HDRB 3OQIA 5JLAA 4CFZA 3QVXA 2OKCA 5HGXA 3VNUA 3SLGA 4D9EA 1TQ4A 2BFWA 1LBTA 2BFFB 1FQJA 4KAJA 1SIWA 2YFQA 3X1WA 2DX7A 3T34A 4J1TA 5K3SA 4RTRA 2YX1A 1YJ8A 3U7HB 4BLUA 2JB9A 4LKRA 1V9SA 3FGOA 3OE1A 3ADPA 3U26A 3YASA 4ER6A 1GKYA 1YCHA 4ISBA 5SZHB 3AV0B 3WKCA 3UJPA 2Y1FA 1FVOA 4C5AA 4PGHA 2NU7A 2NAPA 3VJKA 2JBHA 4KQ9A 5KX5A 1LPSA 1T5SA 2VK2A 4JIGA 2OM6A 4RD4A 4GUDA 3HN6A 2ZJZA 5IUNC 5BNTA 3T7JA 1P2SA 5LMZA 3LWNA 2X9VA 5FL7D 1J2EA 4INOA 1WCYA 3SC6A 3WOHA 4PC2A 3AP1A 1IK4A 2Q3BA 5TPZA 4TXNA 4EFKA 4ZIRA 1II8B 3BA1A 4B0OA 1PSZA 1UC4B 2BISA 1Y9ZA 4HRAA 3NRBA 1QMGA 3G8BA 3IXQA 3NHSA 3FKQA 3O73A 4I5IA 1EGVB 4LS3A 2A86A 5AW5A 1XCGB 1XL1A 4QG3A 2QLTA 3CZ9A 2XUOA 2KS6A 2PO7A 1P7YA 3LP5A 2PRKA 4RO0A 3BDAA 2V7TA 2Z8YA 4GSYA 4ABTA 3IAHA 4F60A 3BRQA 2HLPA 1GQRA 4Q37A 1JA1A 1SU8A 2EBWA 2FAXA 5K4HA 4KFRA 5C18A 4FC6A 1QF7A 4CIXA 1SRQA 2YWGA 3CLKA 4YS6A 2FWJA 3R5HA 3THYA 4KWTA 3R3ZA 4K2HA 1KI4A 1WNTA 4A2WA 3QU7A 3AHFA 2YFHA 3O93A 2FP4B 3QK7A 5CDYA 4P86A 4N5NA 2DZDA 2I65A 3ZKAA 1FLAA 3OQJA 2ZFUA 2CJFA 1SIUA 4KLCA 2XOKD 4DYHA 3JWJA 4X8OA 1KYVA 3SBDA 4DDTA 1QHGA 1ZD4A 3ZCXA 4JN6B 1CE8B 3F6SA 1PI3A 3NBXX 3SCZA 4XX1A 4C06A 2JIMA 1KJQA 3PYLA 5LB2A 1XQYA 4BO4A 1QGOA 1GEEA 3DBRA 2H1RA 3OEHA 4G1UC 4IIFA 1ICIA 1BMQA 4DCTA 2VYVA 2JVJA 4PCUA 3OKCA 3RFCA 4TLDA 4ANFA 3DMTA 3ZCTA 3C48A 2XTAA 4UBKA 4MRRA 4RFLA 1IPHA 3ZGZA 3G8DA 5KUTA 2N42A 2VSYA 1SBTA 2HSZA 3DE1X 2RHTA 3ORQA 4FSDA 4BUZA 4A2PA 5H1YA 4KQIA 3QF7A 5B6JA 1YFJA 7REQA 3HKEA 1BDJA 1KJ9A 2EG5A 3F5QA 1Y9EA 3H11A 1NRXA 1P2BA 2COKA 4WLUA 4CI9A 3BFVA 5F1PA 3N2GB 2GJAA 2V3VA 2RGWA 1Z0IA 2L42A 5JBIA 3SLKA 3UCFA 4DSNA 3AVUA 2IXDA 1KK1A 2FUEA 1U2GC 4PPFA 4B1FA 5AVSA 2I7DA 2VQ6A 1RXIA 1V3QE 2XT6A 4IKOA 4EM6A 2I6QA 2ZZKA 1HYQA 3D7RA 1G5PA 4H31A 5TMDA 3UC9A 4JMLA 3TLJA 3ZDEA 2BDUA 1XTJA 3U3XA 5FADA 1WV0A 5E7QA 1RQLA 3R6GA 4ZVVA 2BKUA 4GBGA 3TIGA 4MV0A 1OSNA 4BN0A 4O08A 1JX6A 5JBQA 3EG5A 1T43A 3SJCA 3T7EA 1UKCA 3FHLA 3RLIA 3VAAA 1A7UA 3F6PA 1U94A 3F74A 5ICMA 3GYGA 4YIHA 1JQBA 4DC0A 5KDOA 4FOSA 3DNPA 2JH3A 2FSIA 4MP8A 2GJ9A 3WWDA 3I01A 2EFJA 2HDOA 3O83A 4PZDA 5DBHX 5LYYA 4M1QA 4I19A 2QLBA 3MFYA 4HEA6 2HIMA 2I0FA 2QSYA 4M0CA 2ZWAA 1XLWA 4GECA 1SAYA 3IP1A 4UBMA 1OZHA 2VPPA 2JFGA 4HN2A 3VVMA 4YGYA 2E4UA 4ZP1A 5DBOA 1TIPA 2Y1WA 4DLPA 1Z7EA 3L40A 2DWUA 2EFDB 3HBJA 5GJCA 3EZLA 2C9YA 3EBOA 4JVMA 5TB5A 2YCLA 3TZEA 1VL0A 2IXFA 3G89A 4A27A 5E8JA 1YACA 1XZLA 4C7VA 1HFKA 2IYQA 4DANA 1DQZA 1JVSA 3I05A 1AQUA 2VHJA 3LL4A 4DBLE 3GGDA 3ONEA 4B71A 3ZGVA 1XTPA 1DGQA 3MT7A 5GVRA 3AI3A 1AKUA 3VR6A 1FE8A 5DB4A 3A06A 3RUHA 1KO8A 2RHLA 3FROA 4EHKA 4JC8A 1C29B 1RWXA 3QMWA 4YRQA 4YIKA 3IT3A 3I0MA 4CIVA 1ZCZA 5LBUA 1X1SA 5FUWA 3LH5A 4IH9A 3EHDA 4D2IA 4CTMA 2Y0EA 5FTWA 2X9GA 3EH1A 1TJ3A 4JP3A 4PGFA 3PT9A 2NPFA 1JQEA 1F0NA 2DHDA 3AH8A 3I2YX 3DEYX 3G02A 4OP1A 2C2KA 3VVLA 3W4KA 2OKGA 3STYA 2HJHA 1MB4A 3JVEA 3AI1A 4HVCA 2OHOA 4KPUA 1SMKA 1BXGB 4L4RA 5K3DA 3RIXA 3ZW7A 3SVLA 2J1LA 1YZLA 4DA6A 2WYUA 1ODKA 3KD3A 4BNHA 4FOLA 3DKVA 2F1OA 4V03A 3IUBA 3ND9A 3O9VA 4DQXA 2Q45A 1Q1QA 1QHHB 1FMLA 2V7EA 1T1IA 2ZUCA 2NU9B 5BSFA 4OA8A 2HOQA 5JH7B 3HJRA 2IU4A 1NQ5A 3FVTA 1GCAA 2ATEA 3BWMA 2CXRA 4WGGA 2ZRMA 4OQQA 4AB1A 3JY6A 3JZAA 4M8KA 2JIBA 2HWXA 4E15A 2PBRA 3WKBA 3KE9A 1WLYA 4TTVA 3BQ9A 3AERA 2QBYB 1I32A 2NLOA 2RG1A 4D3ZA 4HXYA 3H17A 1DMSA 1AQLA 1I7QB 2QL9A 4A0HA 3MGGA 4FSXA 4UZEA 3H99A 5A4JA 1SKYB 1T9GR 4FCTA 4IDQA 5DK4A 1W88B 4YQEA 4K81B 4P3KA 5KHAA 3Q3EA 5BP7A 3ENZA 3ZHBA 2FG7C 4QUEA 4DCUA 4MCJA 5B5SA 1B2RA 1H5NA 1KVSA 2JBAA 2UYYA 3NKVA 2ZPTX 2D2EA 4UREA 3SXUA 1C3EA 3SZUA 5ES4B 2HCRA 5LIPA 4UU1A 1CJUC 2O7NA 3V1MA 4D3XA 3PLAE 3EDQA 3M9WA 4RIHA 3ANYB 3A1FA 4BGUA 1AH2A 5DFAA 2OCPA 2YXNA 2PRJA 1SC4A 1XLTC 3P9KA 5ALIA 1TW2A 4FYJA 1P1IA 3RU2A 3SOPA 2WFMA 3MK31 3N6RA 3QU5A 4F9TA 2HU7A 1EJ0A 1OXVA 2HBYA 1HA3A 2BZ0A 5FWYA 2YMLA 3DTVD 4GOND 3ZQUA 3QTTA 4AJLA 1J25A 1E8MA 4CKBA 2PT9A 5I9MA 5KTTA 2F62A 1C80A 2WWXA 4KR9A 3UAOA 3R7FA 2Z2KA 3BZUA 1LWOA 5KAPA 2PYIA 1L1FA 1CQIA 2HLNA 4KE6A 1KOJA 2PUTA 4FS3A 4MZDA 2GZAA 2B34A 4IQ8A 3RYIA 1LA2A 2CNWD 3HHPA 1MUUA 1SVWA 2BFMA 2RGDA 2V7UA 4XCXA 1USIA 4HWRA 2XHZA 3EXEA 5THXA 1XG5A 2CE2X 4HF7A 5JHHB 3TUZC 2GAAA 4ECAA 4WJKB 4UTNA 3IDQA 1MXHA 4OHKA 4PO9A 3FUTA 3M34A 5K51A 2B4TO 4HZUA 5ENZA 1C4WA 1PNQA 2W70A 2QUBA 5F2KA 3F6RA 1Z33A 2MU1A 4XEUA 4CMEA 2A5LA 2OLKA 3OIWA 1TFUA 1ZXLA 1Q57A 4GMXA 1UK7A 1P7PA 3WYDA 1J33A 2BHTA 3UFXB 4Z2YA 3MINA 2Z5GA 2XJ9A 1IHUA 2J59A 3B6ZA 3FR8A 3G88A 3KUKA 3FLBA 4KYUA 1N2HA 3E9ZA 4YUXA 3AIKA 4BEBA 3G5TA 5K0BA 3R3WA 4TLCA 5A62A 4TMXA 4D0NA 4R1TA 3TB4A 5LWQA 1U8XX 1TEZA 3AHHA 4WEQA 1ISGA 2ZRQA 4WNYA 5FWNA 1E9BA 3EZ9A 2GHQA 4E08A 4IGAA 4CHGA 2QRMA 1H5QA 1ZIYA 4MUAA 3RVBA 4BO6A 2I6UA 3IH5A 3PG5A 4PC1A 4B73A 4K46A 5GVSA 2HQRA 1MOPA 2C7QA 3B53X 3COJA 1NN3A 3BIXA 1CVLA 2H1CA 4Q34A 2HCJB 3OCCA 3WLNA 4BMYA 3UQZA 2P5YA 2FEKA 3GEIA 4EB8A 1VI2A 4FQ7A 1A77A 1RXUA 4TMYA 3RB8A 2D2VA 2V3WA 2QTHA 1CD5A 1P5ZB 2JAHA 3CNLA 4JR0A