1SIOA

Structure of kumamolisin-as complexed with a covalently-bound inhibitor, acipf
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
356
structure length
356
Chain Sequence
AAPTAYTPLDVAQAYQFPEGLDGQGQCIAIIELGGGYDEASLAQYFASLGVPAPQVVSVSVDGASNQPTGDPSGPDGEVELDIEVAGALAPGAKFAVYFAPNTDAGFLDAITTAIHDPTLKPSVVSISWGGPEDSWTSAAIAAMNRAFLDAAALGVTVLAAAGDSGSTDGEQDGLYHVDFPAASPYVLACGGTRLVASGGRIAQETVWNDGPDGGATGGGVSRIFPLPAWQEHANVPPSANPGASSGRGVPDLAGNADPATGYEVVIDGEATVIGGTSAVAPLFAALVARINQKLGKAVGYLNPTLYQLPADVFHDITEGNNDIANRAQIYQAGPGWDPCTGLGSPIGVRLLQALL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords kumamolisin-As
publication title Crystallographic and biochemical investigations of kumamolisin-As, a serine-carboxyl peptidase with collagenase activity
pubmed doi rcsb
source organism Alicyclobacillus sendaiensis
molecule tags Hydrolase/hydrolase inhibitor
total genus 109
structure length 356
sequence length 356
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1sioA00
4CFYA 3AJ9A 3HJRA 3EDYA 1AQNA 4H6VA 1GTG1 4I0WB 3VSBA 3WIVA 3VYVA 4OMDA 1GA1A 1C9NA 2ID4A 3DW3X 1VSBA 1NDUA 1SBIA 1YJBA 2W2PA 1P7VA 4WOCA 1S2NA 3SICE 1JEAA 1PTKA 2GKOA 1DUIA 1S02A 2DUJA 3DVSX 2Z2YA 3LPAA 4GI3A 2ZWOA 1SPBS 3DE6X 1BE6A 1AF4A 3BPSA 3LXUX 1A2QA 1GT91 1SN7A 4DWWA 2WUWE 1SUCA 1V6CA 3PTLA 1R0RE 1SIBE 4CFZA 2Z30A 3DDZX 3QTLA 2WV7A 5K7SA 1TO2E 3I37X 2Z2ZA 3T41A 2SECE 3DE2X 4H6XA 1YU6A 4NE7A 3AJ8A 1XF1A 4DZTA 2W2MA 5AQEA 1Y4AE 3ZXXA 5JXHA 5FAXA 1EA7A 2PWAA 3TI7A 2ZRQA 1TECE 1TM1E 3UNXA 1Y48E 1LW6E 1PJ8A 2PYZA 3LPDA 1BE8A 1ST2A 2XRMA 3DYBA 3A3OA 2WUVA 2IXTA 1SUBA 1Y1KE 1MPTA 3TI9A 4M1ZA 5FBZA 2DP4E 3BX1A 1WVMA 1GA4A 1WSDA 2SBTA 1SCDA 5ARCA 4C3VA 1BFKA 2SNIE 1NLUA 1CNMA 1WMFA 2Z2XA 3F7OA 4MZDA 1P8JA 1SUDA 3F7MA 1Y3CE 3TECE 5AVJA 2W2QA 3QFHA 2PRKA 1Y3FE 4NMXB 3SQOA 5JXIA 4KB5A 1KE2A 3P5BA 1GTJ1 3GCXA 1Y3DE 1R64A 2V8BA 5JXGA 3OSZA 3DE5X 4CG0A 2X8JB 1SIOA 1IAVA 3DE1X 1SIUA 1WMEA 1Y9ZA 3DW1X 1Y34E 4DJ5X 1NDQA 3WQBA 5FFNA 3ZXYA 2HD4A 3VHQA 4ZOQI 2QTWB 3GCWA 1YJCA 3WHIA 1T1EA 1TO1E 1TK2A 2Z57A 2XTJA 2PQ2A 3LPCA 1PEKE 1AH2A 1C9JA 3CO0S 1Q5PA 4RYDA 2SICE 3AFGA 4K8RB 5CW1A 1EGQA 4C3UA 2G4VA 1KDYA 1AU9A 5AVKA 3DE3X 1UBNA 1SUAA 2B6NA 1KDVA 1ST3A 3F49S 1DBIA 1TMGE 3H42B 1TM7E 1OT5A 1SCBA 2WWTA 1C3LA 3EE6A 1SBNE 5JMOA 4YN3A 1HT3A 5ARBA 4BWGA 4FONA 3VTAA 2IY9A 1S01A 1SBCA 1ZVJA 3BGOS 3GT4A 1SUPA 1PFGA 1BJRE 1TM4E 4WOBA 3Q5GA 3DVQX 3VV2A 1OYVA 4Z2AA 2X8JA 2E1PA 2W2NA 4H6WA 4ZARA 1SELA 2PKCA 1SCAA 2ID8A 4LVNA 5ARDA 1THMA 3CNQS 2PMWB 3WIUA 1Y33E 3I34X 4KG7A 4HX2A 1CSEE 5I9SA 3I30X 4J94A 5B1EA 2TECE 2W2OA 2P4EA 1AVTA 4AKSA 2DQKA 2ST1A 1SBHA 1YJAA 1P7WA 1SVNA 1GNVA 3D43A 3DVRX 1Y4DE 1TM3E 2Z56A 1GTL1 3I2YX 1KDZA 3D9QX 1GNSA 5JXJA 1SH7A 3Q40A 2ZWPA 1GCIA 1SBTA 5AMXA 4B5LA 1T1GA 3VV3A 1SUEA 1Y3BE 3L1KA 1T1IA 1C9MA 1V5IA 5B1DA 3PRKE 4KPGA 1KE1A 4JP8A 2Z58A 1BFUA 1OYOA 4LVOA 4HVLA 1GA6A 3DE7X 1WMDA 3A3PA 1SCNE 3DWEX 2HPZA 4AKTA 3A3NA 3QMPA 1AK9A 1TM5E 5SICE 4OV6B 1IC6A 1BH6A 1ZVKA 4NE9A 3EIFA 4OMCA 3DE0X 3DE4X 2PWBA 1SCJA 1R6VA 3GT3A 1AV7A 1MEEA
chains in the Genus database with same CATH superfamily
2GF2A 1G3UA 3HB5X 1G3IA 1N2BA 4L4ZA 1YCFA 2XBMA 4PLYA 1GZ4A 2GOYA 5CLIA 3A9RA 1EUCB 3ZCTA 4FYPA 2ZJOA 1XQVA 4PHCA 1J25A 2B1QA 3KQVA 1DIOB 1EM6A 3C8MA 1XPUA 5KTPA 2GFHA 3WIVA 3HL0A 1RI4A 1FIUA 4F91B 3TXXA 2I7CA 4MS4A 3ZBPA 1W5TA 1L9KA 5ECDA 1A71A 2G7ZA 3BFKA 2WEKA 1I24A 1LQTA 5KJ6A 1NVBA 5B3JC 3B1JA 4XD7A 3RIEA 1B0AA 4DPLA 5BW4A 3TM4A 4G89A 2MSNA 1VSBA 2VJDA 2B4TO 1C0EA 1KIAA 1GL6A 3GJYA 3LHKA 4XB2A 5TS2A 1N4AA 4P54A 3SXUB 4G8CA 5JDCC 3C98A 1BIFA 1UADA 1SM4A 2XY4A 3WGUA 4YLYA 3CIOA 2X8WA 3E9MA 1F8XA 1JX6A 3IEXA 4LJAA 2JCVA 4BIMA 4JX9A 3RVDA 2X0RA 1NNEA 2JB9A 4CMAA 5LQAA 1E79A 1FC0A 1LI4A 1REQA 1Z34A 2CFTA 2P2CA 2BM1A 3WAKA 3B36A 5DNYB 4X6UA 2GCGA 3GEBA 4HFMA 2I2AA 4FN5A 2WKRA 4X92A 5HBRA 3GX1A 2PZBA 3STXA 5KNBD 1KJWA 2VK8A 2E5FA 4IIHA 1S8AA 3QUQA 2JW5A 2AEFA 2HMTA 2B6HA 1ISFA 3EZYA 3GJ7A 4DKJA 2WW8A 3RCBA 4B8ZA 1Y1RA 2CDBA 4F6CA 1V6SA 2AB0A 2DQSA 4AO6A 5A9SA 5K0GA 5KMGB 2WIKA 3LXUX 3RAEC 4PCLA 1JG2A 1JLKA 3OE7A 4Q24A 4EPVA 4RHEA 1ECJA 3QEKA 3X2EA 2OFWA 1Z13A 4OGKA 1OWOA 2DBQA 2BFFA 3SJCA 5KI6A 4BO5A 4C2BA 3OH8A 1U1DA 3M5PA 3GG2A 3IE0A 1JPUA 1P17A 4CFZA 3UQZA 3NM5A 4MV1A 4MSUA 2PBFA 1BRMA 4IJ5A 2AI2A 3KD2A 4TL6A 1R0LA 2RI0A 1VECA 2X6TA 4YMSA 2AVDA 5EJEA 5A0FA 1SOMA 3U61B 1DTSA 4GSLA 3VDXA 2VBIA 3SIXA 1TCBA 3TFOA 2NGRA 2Z4RA 3B7WA 1YR9A 4BN0A 5AHKA 3OI7A 1KZ1A 4HQ0A 4NJOA 3VR4A 5HJ2A 2IUFA 2VJMA 5G0UA 4DIKA 4OHXA 1H1DA 3KQLA 2E9SA 3QPVA 1MJNA 1E1QA 5I7VA 3NBMA 5CK4A 5LMUB 1LPOA 4D3YA 3BD9A 4PO1A 1KARA 5ALGA 5I8WA 1NNSA 2CHUA 3F8SA 3HCRA 4WA7A 2Y0PA 1WCXA 1TJ5A 5FAXA 4A03A 2TMKA 3PE4A 1EA7A 3P4YA 3S81A 5A4FS 2IOHA 4HAVA 5FL7D 4DBVO 1BVYF 2QN8A 5JY6A 2IYTA 3DR5A 4C0WA 1L7QA 2FPOA 1LEHA 1S9DA 1E1RD 3QVMA 4LE0A 4X3CA 1TW2A 1NJ8A 2HFJA 5FUVA 1II8A 2QZZA 2B3DA 3G49A 3LBNA 3OZTA 4PCAA 1Y48E 2NO0A 4U7HA 1Z7BA 2QZJA 4PPYA 1WP4A 3ENNA 1S7CA 3KR1A 4YRGA 3ZY6A 1PTJC 1QOQB 4XJSA 1TEZA 4YDQA 1ST2A 5DP1A 3HV2A 3ZOZA 5CBPA 3ESYA 3DWIA 1R10A 1R6TA 3RRJA 1JZQA 3BWCA 1IRXA 2VCYA 4EKDA 2BSAA 1V41E 3TI9A 4A36A 2YIMA 5FBZA 5H70A 2PX0A 3K5PA 3EASA 4G84A 4MV9A 3AOEA 4BLPA 4DJTA 2DSTA 1OGYA 5EYPB 1RQGA 4C3VA 5ARBA 2QJTA 3I09A 5FTKA 1MQ9A 1NFFA 2Y0CA 4URUR 1EDOA 3MJSA 3V4RA 2NW6A 4KN8A 2ECPA 2MMCA 1WMFA 4PO3X 3VU9A 4Z9AA 3LF2A 2F4NA 4LJKA 5JDIA 1LVHA 1SD2A 3TKYA 4DCPA 1U2PA 1PSWA 2VHYA 1UQRA 2WABA 4N48A 5EIOA 6GPBA 1LCIA 1SXJE 2ZRCA 3PR1A 4UAJA 4DLLA 1GYQA 2H4YA 1YRQA 4F1KA 4K46A 5AVJA 3RYTC 3S0JA 3FUCA 1E2JA 4C5CA 1ZM9A 1JXOA 2Q1UA 1C0KA 3HY4A 3KSUA 4HQ6A 4QOHA 2Y2UA 4FGZA 1QH1A 4HDOB 3ZE6A 4IYRA 4MKRA 3B70A 3IALA 3K70C 1CERA 1A7KA 3UC9A 2QXUA 4DC1A 3V6LA 1GZUA 4S2EA 2X7HA 5I7OA 1H1LA 3NBXX 1GPMA 2PPLA 2BHTA 5LJLA 4G6ZA 1W1WA 2EJWA 3SZ3A 3T7RA 1T6ZA 1YZ3A 3OTGA 4HRYA 2WDPA 5BSTA 1EFKA 5AJVB 1M6VA 4YCCA 1J09A 3T12A 2WHRA 1QH8B 1PZXA 1VYVA 2GAOA 2Q2VA 5YASA 3CIFA 4EWLA 1WR8A 1CUZA 2PYIA 4U6NA 1LNSA 1Z73A 2Q2QA 4UOEA 5L6LB 4H31A 1W6UA 1XNHA 4JUFA 1YR2A 4M7PA 1QH0A 2WWYA 1NVMB 4IMPA 1GV0A 1HNNA 2CDCA 4CF3A 2ADFA 5JY1A 4YRQA 2XVZA 4LNHA 4D9IA 4LXXA 1JJIA 2RH8A 2XE4A 3K5HA 1EE2A 1LQ2A 2Z98A 2R6R1 5I47A 3QK7A 3VA7A 2A5GA 4BO8A 3A25A 2FWBA 3ITKA 1CLEA 2NYVA 3VYWA 2GFIA 4XX0B 3A1WA 3DWFA 1SVIA 5K05A 3ZJTA 1LLUA 3TNFA 3KOXA 1FFHA 2YMQA 1XMOB 4GE3A 4OP3A 3HR7A 1EVQA 1RPJA 2V3VA 1YVRA 3IX7A 3MLBA 1YH3A 3PFNA 5A9TA 1O4WA 2H3HA 1CY4A 3N39C 5KJFA 3HB0A 3QJGA 2P9EA 4ER7A 4MROA 4D9FA 3F2IA 5K8IA 1D8TA 5JJCA 3KZNA 3THRA 1RZRA 3RPEA 3GFOA 1NJ6A 2B30A 2HIGA 1U9CA 4IM7A 4B7AA 1XAIA 1F8YA 1CRZA 4QREA 1AH2A 3EVAA 1W5FA 4CETA 3AIMA 2J3EA 1C9JA 1CUGA 1H23A 3EGXB 2E4VA 2LE0A 3EIEA 3LL7A 3CNLA 4KQFA 4ANFA 3IJEB 3TTSA 2ZUSA 3FR7A 1PFVA 4XI9A 1Q1ZA 2A0FA 3OP4A 3R5HA 4LMAA 5A7HA 3SD7A 2PX3A 2IZ5A 2ZQYA 3Q15C 4TV8B 2B8NA 2IPNA 3QF4A 5F1KA 2C96A 4G0VA 4B34A 2DF8A 3B53X 3B82A 5AP9A 1N0UA 4X65B 3DE3X 1O94A 1Q17A 4HFNA 3AX6A 3RC7A 2Q07A 1OFGA 3CB2A 1X7XB 4BKUA 1PZFA 3B20A 2V7PA 2P1ZA 3JXEA 1IH8A 3F49S 4AMYA 3IPYA 1XX6A 1PEAA 4CMIB 1W0JD 1JQJC 3WV5A 1UQUA 4FMPA 1CS4C 3OMWA 1MRSA 1V9SA 4QPZA 1N8TA 2F1IA 1Z2EA 2GRUA 3AVOA 3GJTA 2LKCA 4Q9NA 2GEFA 1UZNA 4RMGA 3NIGB 1FU7A 4QU8A 2WWTA 3HLTA 2N1BA 1L5WA 2BW0A 4UHFA 2WJ4A 4GX1A 1IULA 2X0FA 1SC9A 2IH2A 1OBCA 1HFWA 2RGCA 5CT8A 1G3QA 5HUHA 2A5YB 5CXQA 3H1FA 1PO7A 2O2XA 4U2DA 2FWRA 3L4KA 1E9FA 2ZR9A 4FYXA 2CMDA 4WHMA 3QVUA 1JXQA 4Y2SA 3R7LA 4NR0A 3DAHA 4WLFA 3IDQA 5BUCA 5BVGA 4YB8A 1BXRA 1OJ7A 3G0DA 4R2MA 4UNSA 1EUYA 2J4CA 4QD3A 3HC7A 1V6AA 1FBNA 3BBLA 2BGWA 1F8GA 1FBTA 1PR4A 2VHQA 4GDMA 1JBKA 4IDBA 4KVGA 3KT3A 4KXXA 1FLDA 4PWYA 3ZIAD 4F6LA 5IJZA 3JYQA 3JQ8B 1V9LA 4MKGA 1YI0A 5A0VA 5GTDA 3DCIA 1NT2A 1YKGA 4QXMA 5IAEA 1GKLA 5FI3A 3FR8A 2B98A 3DPSA 1DBVO 2O7RA 3UAOA 4M83A 1YCGA 1B3BA 3SM3A 1U0BB 4TLEA 1EFTA 1JLLB 1Z07A 3A05A 4PZPA 4DMCA 5AJYA 2QG4A 3HABA 3KL2A 3EQZA 2FEMA 5F78A 4RNCA 3P2IA 4QODA 5CDHA 3HCAA 2Z8XA 1ULUA 3FVRA 4JYBA 3UJBA 3TEFA 1JIQA 2E1PA 1H66A 2W2NA 2JFOA 4FQ8A 1WB4A 1AKYA 1RKUA 2POQX 5IG2A 5CA1A 5M34A 3SJBA 1F0NA 1XZNA 2BE9A 3MJEA 2DJ5A 4CM5A 3ORQA 1ZICA 4U3JB 1R74A 2Q49A 3EXAA 1RAEA 3UFXA 1E3MA 1I7LA 1TX4B 3TRIA 3FBWA 5EP1A 1M5RA 2XADA 4RFSB 1T6BY 1UAYA 4F56A 1YKFA 2BHNA 3I32A 1I3CA 1XMPA 2VJKA 3UH0A 2H7CA 3ASUA 1KZ4A 4RVNA 2NU9B 3UZUA 2RHJA 1J0DA 3IR5A 1RI3A 2HX1A 2ZWVA 2OYCA 3L7AA 4LXGA 3T9FA 3IQDB 4PG8A 3H5IA 3SQMA 5BW8A 5C4MA 1H4QA 4P9NA 1IBSA 1QP7A 3W5UA 1T9CA 2P78A 3W9SA 1TKCA 4N5MA 3DBHB 2ZDHA 5KNCA 2R8PA 4OGWA 2JAPA 3AIIA 2WINI 1A8PA 4K9SA 4NFHA 4BOYA 4QXPA 2HO4A 3IMEA 1OYYA 1ZH0A 5JJIA 1MC4A 4D97A 2XB8A 2A0XA 2ZDQA 2C8KA 3NHAA 1YJAA 2H1SA 2RGWA 5G2OA 4EY5A 4BLVA 4HNUA 2AXEA 1GNVA 1T3HA 2VAWA 1Q12A 4GKAA 2X5JO 3SI7A 3WIDA 2V5AA 3ZDFA 2V98A 3NM6B 2CXOA 3OT4A 1ORTA 2IHVA 2WA2A 1SRQA 4D0NA 1ZLXA 2GDZA 1EXNA 1FOEB 3GEMA 2PKXA 3IKTA 3K73O 4BZZA 3ITNA 1Z6YA 3FFWA 2H06A 2XQKA 1ZW1A 6REQA 1XDBA 1FS4A 1ZN9A 2ZJBA 3OJFA 2X14A 4S04A 2P67A 3AVXA 2PLFA 1TXGA 1PP4A 2HJ9A 4DCUA 4KQWA 2PZ8A 2PYDA 2AE1A 3UWSA 3PEEA 2J0VA 3A1VA 5EJ8A 4MMXB 6PFKA 3OJWA 3PUJA 5A02A 2GK4A 3VVLA 3WLAA 2HXGA 2M6SA 3F1LA 1E4VA 1E3WB 3FCEA 1Z56C 1QMGA 1V5GA 2CLLB 2PMBA 4GI5A 3T3HA 4XM0A 1QIFA 2FG5A 1W4AA 3A7DA 1ZNYA 2ZUVA 1ZEJA 3ANYB 3E2MA 4HH1A 5B1SA 3NBFA 4RK7A 3J7TA 1GFZA 1SBTA 2QLJA 2VXBA 4KWTA 3F98A 1HEUA 4RA6A 3U4CA 3WLEA 1R2QA 1BDHA 1NMYA 2ZJ3A 3M4XA 3NO4A 4FMDF 3BZBA 2I54A 3JAKA 4R1MA 2APJA 4JEMA 4RVOA 3U3OA 4F4DA 3E3AA 3RANA 3L1KA 2XNSA 4FGWA 1T3ZA 1DGQA 1YC2A 1CK4A 2H54A 3OUZA 4LYYA 4JBWA 4EUSA 2HU8A 1WNFA 1QO9A 4PQEA 3RIHA 1R6XA 1BHJA 1T9ZA 4MQEA 1XI2A 4XGKA 5F73A 4MVJP 3TB6A 1VA4A 1YDEA 3L7YA 2B92A 2JCXA 4MARA 1MH1A 4ZICA 5A9SB 1AB6A 1IG0A 3SF0A 2X13A 3N8DA 1HZZC 5MN5A 3TVYA 2PUBA 4AJKA 1Y98A 3CR8A 1RXWA 1XQ6A 1YZHA 4ZHQF 2BFFB 1A1SA 5ESRA 3U49A 2AOXA 3NNSA 3UANA 4ASUD 2V8OA 4E7OA 2O59A 1RJFA 4JOSA 1E9AA 4WDRA 1B1AA 1GUYA 4L7VA 3DTTA 2D1RA 3VPXA 4ZC1A 5JC8A 4FILA 4GLFA 2O48X 1F2TA 1PZEA 3ZKAA 3MAGA 4DFDA 3LT2A 3L4BC 4JROA 5DHQA 2BLNA 3D5QA 3W3AH 3IV7A 3TW0A 5HKKD 4AKTA 2JIBA 1YE3A 2FR0A 2EGHA 2NV0A 3C8UA 3CRRA 2HU5A 3E8XA 3G6WA 3N0RA 4LWPA 2RI1A 1K8ZB 3N86A 3PC6A 4M1KA 1KIFA 1YT5A 2VJMB 4QYTA 4EPRA 2OFOA 3U60B 2IYXA 2A4KA 4ZPXA 2IEYA 4BIIA 1JYEA 2MYNA 3IRUA 3L1VA 4U9UA 5D6OA 2IGTA 1MXHA 2H8GA 2HLPA 1O0SA 1RAIA 1S2LA 2BBTA 1I1HA 3REGA 4Z0TA 1XKXA 1ZWLA 4ZOEA 3RC8A 2IYSA 1E5LA 1Z28A 3DZJA 1JHPA 1KYXA 3DE0X 4DSTA 2CL5A 4AJ2A 3AEQA 2HLDA 4ENRA 2OHXA 2JHCA 1QPBA 2HB6A 2VBGA 1SCJA 1AKMA 2XVMA 3FUWA 5P8WA 5HK8A 3DC2A 3K16A 4GX5A 1IWPB 4YAWA 5B7QA 1T8RA 4G0MA 3L0IB 1M8KA 3BD7A 4GMKA 4ZANA 4ATNA 4AAYA 1J21A 5AW2A 2R6ZA 3LO8A 3I73A 3OLZA 4I5IA 5JMTA 1OPRA 3BIFA 3D8BA 3F6CA 4J1QA 1XG5A 1UBEA 1X14A 1DBWA 1XVTA 2OORA 3FHCB 3GEIA 4FHGA 3TMAA 4BLOA 4BB9A 3OF3A 3KYJB 3P9PA 4KGVA 4OQQA 1YFJA 1G59A 1KFJB 4PYRA 3I2GA 1J07A 3C16C 4XOUA 2GYYA 2HN9A 1A7AA 4RWEA 5TEWA 1Q7GA 3HWWA 1B6SA 1R4MA 3IYLW 2DKOA 2I0FA 3HRKA 1NURA 4NYJQ 2GX6A 3CRQA 2GARA 2E82A 4FR2A 2JFVA 2O5VA 3CF0A 3OZRA 4N01A 5IJXA 1AG9A 1G5RA 1Z75A 2FEKA 3TRKA 5BNTA 5K45A 3IE1A 3G79A 4X7MA 5KTTA 3H5TA 1YR8A 1Z5UA 3ZGOA 3C8ZA 5IZ4A 2IXDA 3VU9B 2NTNA 4GLBA 5JD4A 2QN2A 3HEBA 5KZMB 1XHEA 5EKXA 2IY8A 2WNIA 2ZETA 1KHHA 2VP6A 3I76A 4G5OA 4J7CA 4W7SA 2MMGA 5D6NA 3QBVA 1S2NA 3R9IA 3AP2A 1WPQA 6ADHA 1RJ9A 4M6WA 2QD2A 1XD9A 2EJUA 2XXJA 4V0NA 5BMVF 5JJKA 1QIGA 3GFRA 4PX5A 4R8VA 3VDMA 2X3UA 4LRUA 4S0ZA 2DY1A 4WGFA 5IH7A 1U9YA 4JD5A 4H7HA 5AVXA 2XUFA 3HVUA 3CLSD 2TMDA 2B34A 4A0SA 2BEJA 1NXTA 4YRSA 2A33A 1NMZA 4DQKA 1YR1A 4C1BA 1H1LB 1OZGA 1DFHA 1WZUA 4PR0A 3EIXA 1QRDA 4NQRA 2QUJA 1GPWB 2QE7D 3HJGA 4KQGA 4RF2A 1N0VC 3V2HA 4AO7A 1LPMA 5CEJA 2FSVC 2A5FA 1D9ZA 3LKBA 4PX2A 4XUDA 1HRKA 4N6OA 1BD4A 5CNMA 4S05A 1OIWA 1GAJA 4KFSA 5KNDH 4CTMA 3JCZA 5A9RA 3ZHBA 1SN7A 4ETIA 3HFRA 4MP8A 2JLUA 4RBNA 1ZMBA 4DWWA 5K8UA 1U0SY 3MAAC 3UGKA 4IXDA 3U26A 2Q5IA 3FHTA 3AKYA 3DR3A 1V43A 4KL8S 3C41J 1YI1A 1Z2DA 3NALA 3L8GA 1R66A 1CY1A 4GLJA 4LJ6A 4UVHA 5H83A 2CWDA 1SXPA 5LQDA 2QD4A 1JAIA 3FJYA 2CHFA 2FZ5A 4JI3B 1LJLA 4L3VA 4Q9DA 2YUTA 3LDAA 3G0OA 3QE2A 4N0EA 1CJSA 5KYYA 2GTPA 4KE8A 2NM0A 2CCJA 4DA4A 1U11A 1EFVA 1NVKA 2BJWA 2XH8A 5AW3A 2V9ZA 4LSGA 2ORYA 3FTEA 3DBLA 3F71A 4IHAA 1YVDA 5TR9A 4DZTA 3L43A 4KUEA 4I1PA 1U7OA 1SURA 4NBKA 3INYA 5A3SA 1PG5A 1Z3IX 3WK6A 2HH9A 1ZJWA 4PSCA 3J81A 3VSAA 1U7XA 3AR6A 2GQ0A 2GSDA 2QUHA 3USZA 2ZR7A 4J3FA 2CL6X 3LZDA 5CJPA 3COVA 1NVWQ 4MRRA 4R3UC 3W1VA 4WZAA 4RC9A 3O47A 3RS5A 1QYRA 3NTLA 3I58A 3VPGA 1DAIA 3QF4B 3L2OB 4QIHA 4E32A 4KRGA 3VR6H 1SUSA 4U2GA 4HTAA 3FCYA 1OF1A 1KH3A 1R15A 3M4ZA 4HY3A 2YMLA 3LM8A 5ELMA 4JJIA 2XWSA 3CJRA 3SJZA 2ZJ1A 5FPYA 5CD1A 2O1WA 4LYEA 3WNBA 3CUVA 5LOVF 1C4WA 1OGJA 4KFUA 4UCWA 3LWBA 1A95A 3OM8A 2DP4E 4FT2A 2QRVB 4LYGA 4U6SA 4BTVA 3CHYA 5LXTA 2GD0A 3AW9A 3GVIA 5MF6A 5DYTA 2YVUA 1XT6A 1SCDA 3UJ3X 4RKFA 3WYBA 2WE8A 3KSBC 1EGMB 1R3DA 4IR7A 4C7XA 4P1ZA 1I4DD 3ACDA 5BNIA 4Q0MA 5IC5A 1J7JA 2GK7A 1EVEA 3BS4A 1GRVA 1TZJA 3BK7A 3MJCA 4JHLA 3X1DA 4CEJA 4DUZB 5TQ0A 5BVGB 4KO1S 3NH9A 5H4HA 1BXRB 2JLCA 1I6MA 1QWOA 1Y3CE 3PC4A 1GG9A 2ZJ2A 2HMWA 4HN4B 3TK1A 1RHMA 1IUOA 2V7XA 3RRZA 1XJCA 3H2HA 4AQYB 2CEAA 2OD9A 4UVEA 2G0AA 2K2QB 5BV1A 1ID8A 2GETA 4MHTA 3T61A 2PAFA 3SJUA 3HBLA 4AG3A 1Y6FA 2ATVA 2ZVDA 2VNHA 2X23A 4JL5A 4RJLA 3H8VA 2XWBF 3VVBA 1KDOA 2F6RA 3OIVA 3SPXA 1LTKA 2FG7C 4INAA 4DDUA 2SKEA 1OR8A 4OI2A 5IDWA 1CDZA 1Y3DE 2VP3A 4K6CA 1P72A 4E46A 1MEJA 3JYPA 3KJEA 3TTTA 5JD5A 1EE9A 2QYHA 5HCNA 1WXXA 2AN4A 4MPRA 4Z1MD 3HDYA 2X1VA 1XMVA 2JDID 4LHSA 1AT1A 3OSZA 4MGIR 1OXUA 4RW0A 3RYHA 4AYXA 4CKEB 4G9BA 4CG0A 1T4DA 2AIRA 3WYCA 3THWB 5C5IA 4UMEA 2O3JA 2WJHA 5UKDA 4J1NA 4UBLA 4HMQA 5F21A 5CA1B 5JBIA 4AC9A 1U02A 3IMKA 4IUYA 1IM8A 5AJWA 5KC8A 3DZGA 5H02A 1JKJA 4F5DA 3G1UA 4DV1B 4LYDA 4CMEC 2F43A 2V54A 2RAFA 5H9WA 1GQ2A 1VI2A 3ND8A 1I7PA 2F9MA 1C5KA 2V7GA 5JI2E 2YS6A 2ZIAA 5HIJA 4Q7KA 3QG5A 3K72B 1HA3A 2BD0A 1QR2A 3FGPA 3C6XA 1E8DA 3OD5A 4KVFA 5FTNA 2VTBA 2FPRA 3IXQA 1ZJ4A 1LC3A 4JR0A 4EO4A 5C2JB 4HGQA 1IHXA 2P4QA 1VMIA 3P4UA 3UIEA 2A7XA 4P4LA 3NT2A 1Z8HA 4ZEXA 1T1EA 3HU1A 4U2CA 5I4CA 4OJNA 4BQQA 3T1QA 3ZCRA 4CKCA 1ZNXA 4UPEA 1YS7A 2WKWA 1O4VA 3KLBA 3I83A 3NHFA 2JH9A 1YJXA 4BFYA 4RIGA 5DCWA 2HRBA 2GBLA 1AC5A 3E5RA 4ZGGA 1PBTA 1PEKE 4M0EA 3G88A 4UHCA 2DHEA 3GUYA 1QYDA 3S5JA 4BNGA 3P5SA 1PJZA 2WAMA 3QLJA 4M8NE 4YMIA 4C1NA 4EJ2A 4WADA 5ITWA 5AHRA 1VE3A 2BGKA 3TKAA 1S0UA 4P82A 5ADVA 3A26A 3LIIA 3L9XA 1SK8A 4X95A 1P73A 4UVDA 2X9GA 3PHIA 1Q1EA 5LIPA 1AO0A 3M4NA 2VR1A 1KI2A 5JS6A 3U6KA 2WD7B 3O82A 1AU9A 1N75A 4FP9A 1DFIA 4MEBA 5EP2A 2W58A 3HJHA 3PHGA 1KSGA 1RZVA 4TRMA 4DQLA 2Q9UA 4KK3A 5D3MA 1NXSA 6REQB 2Q7XA 1TIKA 1UJ5A 1WAMA 5GP1A 3OZUA 4NEGA 3UGQA 3CKYA 4KN5A 2PEZA 5A4MS 1OBOA 3AIOA 2FAXA 2JVKA 2PVSA 1JJBA 4GYWA 4OK3A 5SY9A 3EQ2A 2DBVO 3GP5A 3O9ZA 3DQZA 4NATA 1O58A 4MR9A 1NBWB 4DA6A 1W8DA 3TW4A 4GR9A 2ZB8A 1W52X 1CUVA 4RA6B 5BY2A 4GUDA 1S3FA 4NOMA 1T8TA 3JVIA 3SC3A 4LHYA 1VL6A 5CT6A 1RXYA 1Z4OA 3C8DA 3GFBA 3H5VA 1H93A 4RGVA 4WERA 3KUCA 1GGHA 1U7WA 1T5IA 1PLLA 5CFLA 4H3SA 5IHPA 1A5TA 3P26A 3PWKA 4MQEB 3U37A 5LDHA 3NTXA 2R5NA 3JWGA 3QFCA 2PA3A 3SR0A 3ZKWB 4AULA 3W5DA 1U98A 3R41A 4A0RA 4BNIA 4XR4A 1TPYA 1GQRA 2VT7A 3OCXA 2O5EA 5TJ9A 1G4UR 4KI0A 2EG5A 2PGOA 4FFLA 4I14A 4DRXA 3T3MB 4YCMA 2Q5CA 2YASA 4WMLA 3ZV5A 1N6IA 4EVRA 9ABPA 2VNSA 4K87A 4CE6A 1RI1A 5DASA 3PQ5A 4ERXA 5COBA 3I2KA 2Z2KA 4LRQA 4TS1A 1P1RA 1AQUA 3PRYA 3WB0A 2GNOA 3QRWA 1F2TB 4TGLA 1K6JA 1EWQA 1UFQA 2REXB 4FBMA 4UEKA 1Z0DA 3DL7A 5KOHB 5JD6A 1RQPA 1NX6A 4TWIA 5J4YA 1GR1A 5JQGB 1WXIA 4GKKB 4ARBA 4HWOA 6CHYA 9GPBA 1BTOA 2IUUA 3WWZA 4DR2B 3EVBA 1SELA 1MOZA 1KBQA 2M32A 2YV5A 2YIDA 5CH5A 3ZJ5A 3W2FA 4HAZA 4W7IA 3GEDA 2FZKA 3FSEA 2ZZNA 4P84A 4YDHB 3FFTA 1SKAA 1IONA 3CNQS 3D3WA 2EBWA 2DTXA 2PXCA 4OXKA 1IHYA 3NAZA 4NSNA 4Q7MB 4GBMA 4OI1A 1DLIA 2I6FA 2YWCA 1BHO1 3L6UA 5BPHA 1BAPA 3WLKX 2GZ2A 2BGLA 1JT9A 1RACA 3AEQB 3SEAA 4L2IA 5EKUA 5I9SA 2I99A 1P5RA 1NR5A 2XUHA 3BTSA 5E7JA 5IH3A 2ZJ4A 3ZIDA 2GK6A 2X9NA 5DYGA 1NBIA 3W04A 3I30X 2C99A 1IY8A 1L8QA 1C0IA 2ZTVA 3EEYA 2B83A 3IPCA 1KBZA 5JD3A 5CDFA 2YV2A 4Z4HA 5B1EA 1JR6A 5I9LA 2ZBDA 3HHPA 1XD8A 1JEJA 4TKMA 3X0DA 1F06A 1FFEA 4YV2A 1CIJA 4Y2HA 4IHJF 2I34A 2DPYA 2QRNA 1ULAA 2GB4A 2X5NA 4R9UC 3EGEA 3BWVA 2NPOA 3NJ8A 3Q0IA 4YRDA 5M7EA 4BZWA 3IT0A 1WVIA 5F3DA 2CFRA 1C81A 3A9SA 4REMA 1ML3A 1GCUA 3H5RA 5H3LA 1O0BA 3DVRX 1LBEA 3ZVLA 3QUCA 3EIUA 4BEVA 4K88A 4QLAA 3VJKA 4EHIA 1R4MB 3TCXB 1P2SA 1NQVA 1XB2A 2ZULA 3CSDA 4AN4A 4OLHA 2ZAGA 4WLUA 4ITVA 3H16A 4DLWA 1P2UA 5MFPA 1VLMA 3Q1KA 5KVSA 3NDJA 4MJ3A 2VZ0A 3S4YA 4RIFA 4MRNA 5D5PA 4YFVA 3NP7A 1E2IA 2X0IA 3A6JA 4EI2A 1KKLA 4EA9A 3GJ3A 2IYPA 3AGPA 3OE1A 1UPAA 4R3WA 3RWMB 3OFND 4FWBA 2XUOA 3Q40A 1ICEA 1DCKA 1QOZA 1UPBA 3GH1A 3LX8A 3RI3A 4XGIA 4PFJA 5ALIA 2HDOA 1U8ZA 1RD4A 1A8SA 3C6ZA 1PE0A 4NS4A 3V1UA 1RJ9B 3K0CA 4M6WB 3WR5A 3MERA 4M9UA 5J5VA 4JJKA 4BU1A 5KKNB 1N5JA 1MD9A 3NBZC 2X1HA 3OPXA 3GIWA 1X1SA 1XWFA 2DSNA 3SYNA 1BA3A 2CXXA 3UHJA 4K9OA 5ABPA 4GYKA 2QPTA 4PGFA 3NC0C 4FYYA 4PZEA 4J49A 4FOOA 5DCLA 3RSFA 1D2MA 2PWPA 4IIVA 2RHLA 3HVJA 3MRXA 3W2HA 4PYLA 5DI9A 4O4LA 4XE5A 3OY7A 4I4CA 1YDMA 3BXHA 1RXIA 4NI5A 5K0FA 3KBBA 1YQWA 5LNK1 2IHNA 2L0XA 2D5LA 2J3JA 4LQLA 1VSQA 4JP8A 1R88A 4C3ZA 3BRSA 5JS8A 4ZJPA 1BDMA 3WMEA 1UP4A 3IAS6 4CRWB 1Z45A 5LWQA 2XQIA 5CTJA 2VOEA 1KEUA 3G7NA 4ML3A 4BJHB 2ZJ6A 2DLCX 3BDAA 2XQVA 1LSUA 2FETA 1GA6A 4TZKA 2VDMB 3I6YA 3QU5A 4EENA 4H0FA 2ZIGA 3ED1A 4OXIA 2BDTA 3KB8A 4EG4A 3NB0A 1KU6A 1CQXA 4BP1A 4DLZA 1E3EA 2DWOA 3BREA 4N18A 1E9DA 3SBDA 4O2AF 3NATA 3EG5A 2YHUA 3STYA 1UPFA 4QJ4A 2HRCA 5DI3A 4GOJA 4TTVA 2BELA 5KYYB 1WO8A 2OMEA 3VH4A 2ZVQX 2NTJA 1JQDA 3M6UA 4WGGA 5GZ6A 2I78A 1EFVB 1OKKD 4LK2A 4G2TA 2G1UA 3DEKA 3LY5A 3EMBA 3H1EA 4UBJA 4GVPA 3U44A 3E9ZA 3D7KA 3PQ6A 4I8IA 2WTMA 3RSLA 1DQSA 5BMVA 1ZRNA 4NCHA 3VO9A 1KZ9A 2JFPA 1ZRMA 3R5JA 3VISA 1FTGA 1XA0A 2CFCA 3W2TA 4AZ3A 5I01A 2BP7B 3FCAA 2ZRLA 5JJBA 5K8VA 5KWIA 1J4AA 4IF6A 4G1FA 2A2ZA 1Z68A 4ZTUB 2FW1A 4NQZA 1VKOA 3S2EA 1KSJA 1R6VA 1X74A 3I05A 1TAHA 4R1UA 3I5XA 1WBDA 1ZJZA 4RZXA 1ESEA 3JS5A 3ZXXA 2BEVA 3EDOA 1T4MA 2XJ4A 3AUSA 4HS4A 3NDIA 3SYKA 2ZR0A 1MA0A 4FINA 5AFSA 2CGEA 4XR9A 3EYWA 3C7AA 4LI0A 3DVLA 2J41A 3TE7A 1KFKB 2W0MA 1GY8A 2P3LA 3VSBA 2QX4A 1JDNA 4UUOA 2D06A 2K2WA 1YAJA 3CINA 3GDGA 3N87A 2G06A 4I55F 2IU6A 4LQCA 4OJKA 4BFTA 4NENB 5K8JB 3AVUA 4O6VA 4TKVA 1D07A 5TF4A 5LXTB 1AKEA 1XCOA 4XW2A 1Z12A 2NXWA 3JW8A 3LQ4A 2G71A 4QASA 4RL4A 2Z6QA 2ZZKA 3NONA 3KELA 3QTTA 5D84A 2P91A 1PSZA 3KLPX 3PPWA 2YJ4A 4I1YA 2OG1A 2W4IA 1QIKA 4P5EA 2QBYB 4L4YA 4NZZA 3SYRA 2F62A 2JHGA 2D4AA 3JZAA 4HFRA 1MPXA 2YY7A 3IPXA 4BV9A 1M8PA 5TQ0B 1KOLA 4CEJB 1KOGA 5EA2A 3G02A 3Q5EA 3M6WA 3QWAA 4AJLA 3PUVA 4RTSA 3BXXA 1QX3A 1SXHA 1UQTA 2B0CA 3HP7A 4XCQA 2PFGA 3OZDA 1ZN7A 3T7AA 3S1SA 3SDZA 5KO2A 1V2GA 2GKOA 3F5SA 4D4KA 3KV3O 5JADA 2Y1CA 3P9CA 2RK6A 2QIOA 3PT9A 2BTEA 2CFOA 1E1RA 3AXTA 3QEMA 2F3SA 4GI3A 2AZMA 4BPBA 1X80A 1KJ9A 3W8FA 4DGQA 3HDJA 3IEVA 4JFAA 3H6HA 5ENDA 4XGQA 4YRCA 2DFDA 3ETJA 3RYHB 1C1HA 3SZGA 3ZJVA 5KAPA 4DV5B 2AF3C 4WNYA 3OFKA 4Y1RA 3RTDA 4D4MA 4FDTA 3VMMA 4CGYA 4BQIA 5C9ZA 4NCNA 4XDGA 2QRKA 3C3MA 4YROA 1X8XA 4ZT3A 3HXQA 1DIBA 1JEQB 4M9CA 1H5QA 3FVWA 4MGHA 5HE8A 4ZDIA 4BX8A 4EGSA 1SC3A 2QX8A 5IJ9B 3HWX1 4D8UA 2H08A 1FL9A 1JKJB 2WQZA 3F6RA 3GEPA 1U28A 2VJPA 1R5JA 2F43B 3ND9A 5K4AA 1QO0D 1ZK0A 5ALTA 3BIJA 4FDVA 1DUSA 2GKGA 3L5OA 1GNTA 2XMSA 3TLZA 3RGWS 1AF7A 3EQ6A 2J3QA 3O73A 5AYVA 1UBOS 1G9SA 3TOSA 2VTBB 3U16A 2LIVA 4QBFA 1E2GA 2XQJA 4ENWA 1IK6A 2YZ2A 3ZHVA 1E2HA 1G2PA 3VHXA 2C7VA 1PJSA 4ND8B 2PK3A 1FUKA 4DGSA 4ZYTA 4XLTA 3UBMA 3RSQA 3IUSA 3L0BA 4H6XA 4RIHA 3VTFA 4OX9Y 4X0EA 4KIGA 3LCJA 4RD2A 5DBIA 1A7UA 1JSLA 4OBBA 5H0IA 1DMSA 1XF1A 3I28A 3JQ7A 3MN1A 5K3FA 3JU3A 4XIGS 4DJEC 4J0EA 1C8BA 2GESA 4C22A 1KOJA 1VDMA 4MUIA 3SU8A 3AOEC 3JR7A 1PVVA 1TDJA 3OCYA 2YUIA 3GLQA 1RPNA 2C03A 2BZ0A 4KZPA 4ZMRA 3VC1A 3W2IA 4JBGA 3ECSA 2OO5A 1RBQA 4U2KA 4Z7JA 5AHWA 5JDIC 5EJAA 5JFGA 4BNLA 4BO9A 1NXVA 3C74A 4D4GA 1TU3A 3PUWA 1GN9A 3AUKA 2D1FA 5CYGA 3HCCA 1Y80A 3GNTA 3UXHA 4OHVA 2PFKA 3KKKA 5D3MB 1R3UA 1YIDA 4CV1A 1W4ZA 1ZHHA 4AF8A 3P4XA 4K9DA 4Q5IA 3DZDA 1TFRA 4YUVA 3ZVMA 2ZCJA 3G8AA 5LWHA 5ECWA 4F06A 3HKCA 1FFCA 1CYDA 4HRXA 4MVJD 3WWPA 2ZT7A 1BYUA 3NTQA 3I3OA 4D42A 1U90A 5EJ7A 3TAHA 3W34A 1XXHB 2EKZA 4MR9B 4CMGA 2LCQA 4W5QA 3WNQA 1MJFA 4B35A 1DKQA 1N2OA 3DDHA 3O4JA 3Q88A 2QPOA 5CR9A 4JBYA 2ZE5A 4W6ZA 5J2UF 3NU1A 2ADOA 1IWBB 3UUFA 2VI5A 3T5GA 1KERA 4ND6A 3B2EA 5FWYA 4CM6A 2HFKA 3PPVA 3AVQA 3R6GA 5J4KA 3KE8A 1SO8A 3OKAA 1HPLA 4OHWA 3L7NA 3GDHA 1Z25A 1SXJA 3IIEA 1NKVA 3NR2A 3ZK9A 3BWXA 3T4PA 4P3YA 1A9XA 1T8YA 3CLRD 4B2YA 1K88A 5JMWA 5DNDA 3E05A 2AR0A 4DRXB 2W6MA 3EZFA 1JH9A 4NU8X 2FX5A 4GGMX 4FGLA 5KOJA 2X19A 3C43A 4V0LA 5LCXA 4NS1A 4W63A 2KPOA 1JTFA 4REOA 5JISA 2V8BA 2Y1XA 5CXUA 5F35A 4MUNA 1FB5A 4QZVA 1NE2A 3E18A 1KMHA 3DE5X 4BO0A 1C3OA 1DIAA 3L0YA 2JLQA 5HHTA 4FYMA 2V59A 4ALIA 3BORA 3I01A 3PNKA 4D9CA 2BGNA 1W0JA 2ASEA 3D2CA 1N0WA 3NC4A 3VSCA 3NX4A 4JIMA 4UTOA 3TGPA 2M6KA 4MAFA 3VNVA 4EDHA 5HCUA 1XFDA 1NA5A 1ELOA 4TS9A 4DJ5X 4EG3A 2EL9A 5GIOE 4HQRA 5EHIA 1KI3A 2BI8A 1YULA 4PZUA 2BKLA 4N3GA 1JJAA 1WF6A 1VG8A 5DU2A 3GUHA 5BSFA 4O4IF 2IYYA 2Q6TA 3EQ9A 2OQ2A 1W4CA 5KX5F 1OH8A 4OLBA 5GOZA 1V7ZA 3PGVA 5EE0A 1GQYA 1O94C 4N9WA 4IWNA 4JP1A 3RJMA 2YWFA 3CUWA 4JFRA 1WVGA 3IT1A 4PHHA 3BCSA 5REQB 4L2IB 2BHLA 1O9BA 3A10A 1SUWA 2RHMA 3NV7A 2MU1A 3THOA 1XN1A 1JSXA 3FMVA 4CWAA 1JPNA 5HUJA 1M10A 5AW9A 3EA5A 1T1RA 3D1JA 3UWOA 4KE6A 4A92A 2BGJA 1Q95A 4KIFA 3DMGA 2QM0A 3ROPA 4LF4B 3FLBA 1JXMA 2AHRA 1ZN8A 4PGAA 2MYTA 5BQ3A 4L72A 3T3EA 1CULC 2JAQA 1AKVA 3AO0B 5B3AA 2XE7A 3RFVA 2FZLA 4BP3A 1ODTC 3OJ0A 5LQMA 4DB4A 1CUCA 1GFSA 2FZGA 1SVSA 3MGCA 4D44A 4KK4A 3UV6A 3SAJA 4FYIA 3N2YA 4ALNA 5BV0A 5EZSA 3WKAA 3ZI7A 5DYWA 3DT9A 1TAGA 2R8YA 4NEHB 3FMOB 1Z2CA 2G28A 1X7WA 3M7IA 1SUAA 1G20E 1GQOA 2Y9MB 4YCJA 3QOWA 1GFIA 3WLPA 4NCAA 4KR9A 4UCXA 2W70A 4EL0A 3ZU6A 5P21A 3QKSA 1DBIA 2J67A 3O92A 3PV0A 4ZJZA 4KITB 1Y7HA 2H59A 4FJ0A 1KYIA 3II6X 1WLYA 5DT9A 5B6PA 1VBNA 3WMWA 3R0IA 2R44A 4INPA 1ADFA 3KR0A 5CP8A 2GPBA 1E9CA 1HG0A 1F6DA 2PZFA 2QQFA 1NU8A 4Q4HA 1XCBA 4HWTA 1CNFA 1XIVA 4TT8A 5EINA 5LN1A 2DBYA 4RGQA 1RYBA 4RSGA 1K0UA 3W7BA 2WIAA 4DC0A 2XKBA 3BQMB 4YUXA 4BQSA 4BRZA 3ICWA 4NPCA 3WYNA 4WESB 1L4UA 4IRXA 2PLWA 2XQFA 3ZN2A 2BOVA 4ER6A 1G2OA 2AG6A 3ETEA 5DM4A 4O4LB 2JFYA 1A72A 2P9TA 3HDVA 3PHCA 1FUYB 1BE1A 2VDJA 5ANRB 3ZK8A 2IS1A 2X4LA 4YAIA 2WUFA 4ZGBA 4YRAA 4HL6A 1YJ8A 1HE4A 3U0BA 4EKNB 3D6AA 4IHJA 3I6BA 3IQZA 1OH5A 2IS6A 3MOSA 1QZUA 3D0KA 2PZKA 1IATA 3KQKA 3UATA 4KOAA 4WSOA 1DDOA 3BIWA 3I9KA 1I3LA 3BH7A 2AFHA 2AMVA 2DFTA 2LNDA 2NZ2A 3INGA 3RIYA 4TQAA 2ZANA 1UWLA 4V1CA 3A7EA 2HEIA 2QP9X 2OB1A 2QX7A 4I3GA 1XC7A 4S12A 5FPQA 3FPSA 4I1UA 5LBTA 3RAPR 3EEOA 4TUYA 3F6SA 5SV2A 5A5VA 1RE0A 3BXEA 4XVRA 4US0R 1WP9A 2AV6A 4TQGA 3I9LA 3QKRB 4MQ4A 4NPAA 1IEXA 1CEEA 1Z2PX 4KBGA 1SPXA 2OV6A 5DI3B 2C3MA 1X86B 3OJEA 1YIOA 2QVBA 13PKA 1RM3A 2B8WA 1PR3A 5KCMA 4DW8A 10MHA 3R4VA 2DUMA 4F5WA 5ALUA 3CT4A 4TWJA 3HHEA 4M8LA 3M83A 3R8XA 2FZVA 3DAPA 1XA3A 4ESEA 4FS8A 3TEJA 2NUAA 2CYBA 2BFOA 1EFPA 2FJ0A 2QR2A 2L2QA 4G4GA 1KO8A 4PFKA 4AZ3B 3EGVA 3N7TA 3I5UA 5JWHA 1ENOA 1U99A 1ZIOA 2PUHA 1EXVA 3G0BA 4M87A 2ZUFA 3Q7RA 4YJ3A 1DJPA 1JILA 1W47A 2XB9A 3MQFA 4HC4A 4BN4A 3AIKA 4GAEA 3OX1A 1IXYA 3ESAA 3SE7A 3KZOA 4CTOA 4G0WA 1MHPA 1OTYA 1AHNA 1GR0A 1YS6A 1AVTA 1XK7A 2K7ZA 2IEIA 2R1TB 3JARA 2ST1A 3VHLB 5BUSA 2ONKA 4ASUA 3KHUA 1M3SA 4HDKA 4N3BA 3RRXA 3ZCPA 1THGA 3LPMA 3MINA 1Q15A 4NAUA 3D54D 5IUNC 3HSYA 3GVHA 4CDRA 1S7GA 3MA0A 1YNOA 1EQUA 3BRWD 4K0RA 4TKVB 1GOTA 3RU9A 5ICMA 3DA8A 5KJCA 5IANA 3CVUA 5HKKA 1T43A 1UK6A 2RD2A 1Z5PA 2A14A 2XITA 4ZT5A 5FIUA 1VC2A 1GRRA 2XCUA 5DTJA 1GGFA 2XMBA 3N8NA 2JHFA 1GSOA 3KEQA 3D9QX 3L0OA 4A73A 4P7JA 2C5SA 4MJXA 2F1HA 1QGUA 1YRLA 4ZQBA 4DMRA 5EIXA 3PR2B 2R6DA 4L4SA 3C1AA 4P81A 5DHAA 5T6MA 5BSVA 2ZYAA 1RE1A 1CY6A 1IE3A 1LX6A 1ZU5A 2YV3A 4R9NA 2YW9A 3NWPA 3OLXA 3RG2A 4CF5A 4NU6A 4KWCA 2E6KA 3IXLA 1U1CA 5J5CA 2FNAA 5AIAA 3SS9X 5IBQA 3WO0A 4ENQA 1WABA 4B6GA 2AN9A 5CA0A 3UHFA 4LDAA 4YY3B 5J23A 2QT1A 3K0FA 5HP4A 3DBRA 4OU4A 4ZAVA 3R6LA 1CZOA 1D7AA 5LM3A 1EG7A 1Z9BA 3U3ZA 2Z95A 3ZI4A 1X80B 3UWDA 4Q93A 4OIMA 3WHPA 5CEFA 4MQ5A 5IVHA 2VHTA 3F6BX 4UEJA 4TKUA 4QGHA 1TEXA 3D8TA 2WWIA 4Y1RB 1KE1A 3RVSA 4FMBB 4BFZA 1K75A 4XWYA 3GUUA 2QSUA 4B3JA 3TIIA 1XTBA 3U4QA 2DYKA 1JVSA 3RODA 2H57A 3TB4A 4I55A 2JLZA 4L3OA 1VPEA 1A4RA 2B21A 4L85A 4EELA 1KGSA 2WMOB 2H92A 2PMEA 1QH9A 4DQUA 1JHRA 4PLCA 4AYWA 1DBPA 2D13A 2PPVA 5F12A 3ZZ1A 4F2GA 3ISVA 2GO7A 5BN3A 4KFRA 1COWD 1VL5A 1Y9EA 3AM4A 3QMPA 3PGJA 4Y3UA 3LTNC 2OORC 1UANA 4JENA 4NH0A 3PP8A 3VHXB 1UR5A 3SFTA 4NOJA 3P2EA 5EWLA 2XTMA 1ZM7A 4TQ9A 1DJNA 3TCNA 2QLMA 1PDWA 2JZCA 2HXYA 4ZRNA 2HM7A 4IQ8A 4RDXA 2Z6UA 2XIJA 3F2VA 3WGHA 3T5CA 3H2ZA 2BR4A 3JQ7B 2PJUA 4UEOA 4DG5A 3WTCA 3IKJA 3S2UA 3NRCA 1LD3A 3HBMA 5C5CA 3GMSA 3QTBA 4Q3DA 3SIPA 2YXDA 1VZ3A 3PJFA 4I6GA 4LGCA 1HQYE 2HCFA 4MW5A 4BB6A 2QE7A 3WL4A 5IVIA 4K3UA 4EF6A 3KYCA 5LZ9A 3PYLA 2WM9B 4UEWA 3NI2A 4IQGA 1DKLA 4KMOA 3T38A 3UTCA 2WAXA 3LDFA 1X1TA 1DC3A 1X8KA 3NHRA 4AK9A 2YN2A 3GA5A 1XHFA 1APBA 2VNAA 5U4QA 1ZVQA 2AWNA 3EXHA 3UKDA 2Z8YA 1KJQA 4QWWA 2ZB2A 2P4UA 2P69A 2IDZA 2AC2A 3RHTA 4P0QB 5DWDA 2M98A 3T1YB 3PDHA 2Q0SA 3K9NA 3OMLA 4AY5A 5E7MA 2JAWA 4K6GA 4HXYA 1YZVA 2G77B 3HKCB 4OXRA 1HQCA 3C6YA 2ZBQA 4Z0HO 5K6TA 2OGZA 1YASA 3OKFA 3FZYA 5E2BA 3SR4A 1V1MA 2BGIA 3H5NA 3I01M 3TQSA 2QTMA 4L9AA 1YONA 3DLAA 3DZ8A 2JGMA 3IEIA 3DF7A 1YGYA 3BJIC 4LQDA 3O3OB 5CVVA 4WXEA 5IVDA 1IBMB 2BFBA 5AQ1A 2Q3FA 3PC3A 4BRWA 3H4IA 4JI5B 2AFIE 5AVOA 1E5DA 2I9KA 4JC0A 3ZYZA 4MXDA 1DOAA 1NW9B 4HRVA 3R3HA 1KRWA 3M70A 1E3IA 1TLLA 3EAQA 4GOLD 5KDLA 4KMRA 4HS9A 4C0JA 5FWYB 1UOQA 2YY5A 3C97A 3F3MA 3HCFA 5CVJA 4BXOA 5LQRA 1C7IA 3H5OA 2I62A 5SYNA 2X3FA 3S2GA 1E58A 4QX6A 3W1EA 4DR3B 4R1PA 3A04A 4LXTA 4OAOA 4FS3A 1KK3A 1NL3A 1TJ4A 1A9XB 4L76A 4EG6A 4XPZA 5K3EA 1S02A 4Q02A 3TLMA 2I03A 2PV7A 1UXHA 4JYCA 1F9AA 1WEKA 3DFUA 1HV8A 3IIJA 3WGIA 2NSYA 3C3XA 3MFQA 5ENVA 3ZV3A 2HW8A 2Y4NA 1VP3A 5KOJB 3LPAA 4RD6A 2XDAA 1O7JA 3QI2A 2FEAA 1E3SA 4AM8A 2I76A 1CUEA 3CZ4A 4ESOA 4EHKA 1RYHA 5B7PA 4Q16A 2JLAA 3W2GA 1A2QA 4RHXA 1KMHB 2FCRA 4IX1A 1E9RA 1GT91 2GPSA 2O2HA 2QY9A 3KEGA 3DT8A 4LS3A 1PUIA 1QUEA 2HQSA 2B82A 5GGXA 5F5LA 2FV8A 4Z4CA 4MGEA 1LLDA 4YAGA 2CUKA 4LRXA 3WRWA 5DVZA 5SZJA 3GWZA 4WZBE 1MG0A 2P6UA 4H4DA 3REQA 2ZUEA 3OHSX 1EGVB 4KI7A 3FSGA 3PNOA 1IB6A 4XB6B 3RVJA 4LDJA 3A0UA 4NFYA 2XF2A 3GLFA 2GBPA 3F5QA 5INTA 2O5RA 1HY3A 4N03A 3ZWDA 2IKQA 3FVTA 1R12A 3C85A 1A9ZA 3MTIA 4ENTA 2GCOA 4KZKA 2BEWA 1AS2A 2O2CA 3LBHA 3Q0TA 4FOPA 1Y81A 2PUDA 1RYFA 3NVKI 3OFSA 4M0FA 3OTQA 4RMHA 4KOEC 3ONWA 1ODCA 5AVVA 4UM8B 3BAFA 5BQXA 1FPQA 2JJYA 4MV0A 1KJIA 1DX9A 1U5BA 1QZ3A 1X7ZB 1JG4A 1XR3A 1DXHA 2Z3ZA 4IV5A 1IHOA 1SEPA 4F8YA 5J2UA 1TUGA 3H04A 1QS0B 1UKEA 1Z2OX 3DZKA 3WGJA 5TT0A 1N33B 3GFQA 5FHRA 2NXEA 4ZC8A 5FAKA 2VDOB 3A6LA 3JZMA 1YA6A 4KR0A 1C3VA 1T24A 4E13A 3JTEA 4EEZA 1GTMA 4B3FX 2BMVA 3U13A 5KQPA 5A4JA 4AKIA 1B1CA 5FKJA 2ZS7A 4F3CA 4KDCA 2JZOA 3KRTA 3DUFB 4K3VA 2CLSA 1DWQA 2WTAA 2CUNA 3S1AB 3W5HA 4XUGB 4AWAA 3ESCA 2UVQA 3B3JA 5BOVA 5JZ9A 2C9MA 1B0PA 4GPBA 4MYUA 4Z1MA 1OAKA 2W8ZA 1IY0A 2JDIA 2WSMA 3OPMA 4N5DA 4OOEA 4E1BA 1C41A 3CH5A 3CH4B 4Q9LA 4B3GA 4CR8A 3TDMA 3MTEA 1TTPB 5MFZA 1FFAA 1H0SA 1CY7A 1A9PA 3R23A 2X4GA 4YO8A 1SNYA 4OBXA 2FUNB 4IIFA 4NK5A 1CJBA 3STTA 2HDNB 3FDZA 3WICA 2ECOA 4M1EA 2A30A 5IN4A 4NJMA 3W78A 2P6RA 1W6RA 4EYKA 3QKSB 4H2DA 1IXKA 3ZDCA 1PX0A 2GAIA 2Y0BA 4OXYA 2VJAA 2OLEA 5CX4A 5KYNA 2AEEA 2ZSUA 2ZIZA 4JLAA 5C18A 2EFDB 4Q1VA 2G88A 4G25A 2RAPA 2RC5A 1P3DA 4R9VA 4HX9A 3S3TA 1XLUA 3SSAA 1KI7A 3K0HA 3L9WA 1Z8DA 2H48A 2OECA 1K7YA 3HO6A 1JRLA 4GDFA 2AN5A 3N2KA 5BSKA 1DBRA 3O90A 3DEYX 4J1TA 4EHNA 5ECYA 3QY0A 5CVEA 1UWVA 1C7EA 3W5JA 5KX5A 3L0PA 2F3UA 1W1UA 4H0NA 4JQSA 3VH1A 4CQMD 3DJYA 1KQ3A 3SY8A 3K6RA 2GA9A 3AYZB 4XFKA 4ZVQA 3RT1A 5KNLA 2QM3A 1CZNA 1NBME 1Z8NA 2JBAA 3HKBA 4TROA 1I33A 2CZGA 5ALVA 5TLSA 4UOQA 1DZ3A 5KTNA 2WR8A 4MA4A 3UN1A 4ZCRA 1Y4SA 1JIUA 3GMTA 3PXEA 4H1TA 1NRXA 3H11A 1T2CA 3VU0A 2DPLA 1U0RA 2XD4A 1QP4A 1ZM4A 1E9BA 3GEHA 3ORSA 3OZIA 1CZLA 2GILA 1QHYA 2PU7A 2QR3A 2I2FA 3O1IC 3QH4A 1DSSG 4H17A 3Q3VA 4J6EA 4JVLA 4OJQA 2D1YA 4K81B 1R0BA 5HKAA 3L7BA 4TZ6A 4N54A 4AG6A 5FTJA 4LBWA 4CCYA 1I9CA 1TT5A 1DHRA 1VE9A 3LQ2A 2KWIA 5A6VA 1QDUA 1K7SN 4KSBA 3TEMA 2AFHB 4XPIA 4ALJA 4B87A 4DLNA 1W8IA 4D80A 1EZ1A 5JCJD 4DSUA 2KLBA 4EY8A 2J9RA 5IAOA 2EGGA 4F5EA 1J0CA 2F3QA 2X4DA 1DIHA 2GBLC 2HJHA 2WE7A 2WJWA 1JAXA 4TUYB 4ZQCB 5EPEA 2QG6A 3DL4A 3K8ZA 2AGVA 2P5UA 2Q6IA 1U0TA 4UTPA 1BEZA 4JBLA 1XTIA 3Q98A 1DEOA 2Q9AA 1MX1A 2CVZA 2FKNA 2RONA 3K53A 1IXSB 1SD1A 3DKRA 3FN4A 5C5DA 2P9QA 4ZOBA 5EWJB 3WAGA 1SHKA 4OI4A 2PJZA 3IEPA 1ONNA 4MUKA 2FZ4A 2R8EA 2YJ6A 3PFBA 1OIVA 1DTWA 3ZHZA 3AUFA 3H05A 3ELUA 1AUXA 2E4XA 4R8RA 5C4GB 1L4GA 2H63A 1IMJA 2O7QA 2NO7A 1S2MA 2JLBA 3ZDRA 4GRDA 1L4MA 2PH3A 5DDIP 1M83A 3MMNA 4CKWA 3BGVA 3ELWA 5HILA 5TMEA 1OZHA 5KNBH 1M5TA 2HF8A 4EI9A 3UOAB 4URHA 4ECEA 5G1PA 2DERA 1HFKA 3R3UA 4OSOA 2IWRA 3QFTA 1QV7A 2EGUA 1Y6ZA 1N6HA 1VHWA 4YJ3B 2YR0A 1OASA 4NOLA 4IIJF 3M3DA 4XIYA 3E27A 3FCOA 3VFDA 3ZTTA 4DMMA 3B1ZA 5JASA 5IS2A 1G63A 1IY9A 4W6QA 1O6GA 1KEZA 3ZW7A 4E09A 1FX1A 5BV7A 1JNYA 3DNMA 4W1RA 3JARB 4OO3A 2GZMA 2G1PA 4Z9FA 3TZBA 3K9HA 4HDKB 1G21A 1UMCB 1F8FA 1TKRA 3AL2A 1JG1A 4C78A 3QPUA 3SOPA 4UTRA 5FJJA 3RUHA 3X1MA 4B85A 3SQLA 5DP2A 1WCIB 2OGTA 1GZVA 4QYMA 3T9EA 4E31A 1Y1PA 3CX8A 2JCYA 1L8XA 4G3XA 5LA6F 2J32A 1CUSA 4BHTA 4TMWA 2XMCA 1RR6A 3FWYA 3LUAA 1Z62A 4JITA 1A77A 3E03A 1QRUA 1A7JA 2V5UA 4LDNA 4WJZA 5B1IA 3EW7A 4BMDA 5JXWA 4TMYA 1ZAKA 5J2TF 3WYEA 3EA4A 1HWYA 3H42B 4H1VA 4NZYA 4C20A 2PXXA 4AN0A 2CCGA 1J2YA 2WT4A 4Q39A 3ZGLA 4BFWA 1COZA 1G5PA 2DM6A 4MCIA 1EGAA 4Q1AA 3ENKA 4HBGA 3A6FA 5BW5A 4H15A 1XYVA 5BORA 5I48A 4CL0A 1ZSNA 1ZXBA 1Q7RA 5DNVA 1EZ4A 6YASA 1AXEA 1N78A 1KO4A 1ZCBA 2A5LA 3K1AB 4C3OB 2WJZB 4L8FA 1G42A 1VKRA 1WCV1 2C2BA 2PWZA 4MYHA 5ISMA 3PNMA 2O4UX 5CA0B 2XOKD 2I3GA 2I8LA 3VNUA 3E7XA 3K0FB 4ARCA 2FH5B 3DBRB 2BFDA 3I9MA 1DADA 4AJIA 1TZCA 3K2IA 3VTAA 2IHUA 1J23A 4XWOA 1ORHA 2H1FA 3HGQA 2IY9A 3KX2A 3GRCA 4M4SA 1UKVY 1ZCAA 2QB5A 3BGOS 3DAGA 4R2JA 2H16A 2C2ZA 4TKUB 1QPZA 3E7DA 4YRPA 3IMCA 1PFGA 3P0IA 4UTXA 4D3SA 2DFNA 2ZBFA 3M33A 4QT0A 4J9VA 4QOGA 4MA5A 4FFPA 4RF4A 3CH6A 3ZR4B 4M1OA 1UPCA 4RORA 3U4QB 2HJSA 4KFTA 1UPXA 2IHTA 2Z8YM 3NBUA 4YAOA 4Q7JB 1LLFA 3OIYA 3PNQA 1ADBA 4I55B 3ZHXA 4D96A 2WB2A 1DQNA 2UZAA 1C3JA 1M2EA 3G89A 3MCZA 4K6OA 2A4MA 3TUJC 4FGJA 2XWQA 1EH5A 4WAUA 4Z4EA 4A23A 4CKBA 4A1FA 4ZAYA 2ZSAA 3EEBA 3T3DA 1K98A 1UM8A 3I8OA 3KHSA 1IOZA 4BGUA 5BN3B 3OFNA 1KEWA 3C3CA 1FP4A 1NUTA 2UUCB 1BS2A 3FDFA 4C7BA 1ZC3A 3D31A 4N5HX 2Q2NA 4Y9DA 4ZALA 1VKZA 3OIGA 3FWHA 4P8RA 3W5SA 5B2EA 5U1PA 1LVUA 2WFAA 1QHHA 4Q4DA 3JZFA 3UB4A 5DYYA 4UMFA 1VGVA 2LCFA 4RZHA 4UNIA 4X54A 2C1ZA 1MA3A 3MYYA 2I33A 1M1NA 4GWLA 2ZSBA 4Q3EA 4UNNA 1KYQA 3PQ4A 3RUPA 1P44A 4WZ6A 4XWAA 3I9OA 4WJKB 1AUPA 3OPYA 4NZPA 2ZRMA 3M5WA 4P22A 5FWXA 1U8CB 4F9EA 1JLHA 1LK7A 3GNQA 4CEHA 5FO0A 4ALMA 1GVNB 3COPA 3AW8A 1JPJA 5BXYA 4MINA 1YS9A 3OCVA 2GHTA 2PX2A 3KYCB 1S5PA 1I6KA 2N46A 3VNSA 1SHUX 5I9IA 2JFZA 3I23A 2Q7DA 3BKXA 5L6MB 3FZEA 2QTNA 1L7XA 4L0MA 3TLJA 1N3IA 2WP0A 2XRYA 4HNTA 3ICOA 3TQOA 3EXHB 1FXWA 1NQTA 3IERA 3K0CC 4JT4A 1ODSA 1PGJA 2EL7A 4W5JA 4ZQEA 3L8DA 3MVEA 3UJPA 4BJ3A 4ZI7F 1KI6A 1SVNA 4R2LA 3O9MA 1E2NA 3Q85A 3OT1A 3OTHA 2WWXA 5JYBA 3WVNA 4U7WA 4QPPA 1N7GA 4N3CA 3P2KA 1OWPA 3LQFA 2DXIA 1LY1A 1QRRA 2Z56A 3A4MA 1DHTA 4FFBA 4QUJA 4L75A 3UUGA 1ZP6A 1VL1A 1JQBA 2RJNA 3CZ9A 3RRMA 3KJZA 2R8BA 1UMKA 1T9DA 2AT1A 4TYWA 1KWGA 1AV6A 3ESQA 4HEJA 2OBMA 1NC3A 3EZ2A 5IT5A 1ZJ5A 3VOSA 2IZ0A 2BUAA 2VATA 3HPRA 3W4IA 1H2AS 4NECA 3VBEA 1E7RA 5L3SA 4E21A 1NUQA 4MRMA 2H65A 5KIAA 4UBMA 4YJFA 4E7PA 2AFVA 2A9FA 2BVNA 2BI4A 2XA9A 4HWGA 4HXGA 3EZNA 2IPMA 5LR6A 4BXOB 1C7ZA 2H1CA 5HRAA 5J3JA 4N7RA 3SG0A 1EIWA 3IUEA 5GZ1A 2F9FA 4BL5A 2HQRA 4MUYA 3Q9SA 5EHGA 3A31A 3IRVA 4YYEA 4EF5A 1YMVA 5LP6F 1DAHA 2WSBA 1YUNA 2YWRA 1GP2A 3QPAA 5DNEA 1SQGA 4C0XA 5G1OA 3KJQA 4OPMA 3A32A 5EZYF 5ES4B 1PT9A 4RCYA 5AXDA 1FLVA 4Q9JA 1GGMA 3KKOA 5T3YA 3T5PA 3X1KA 1R0YA 5M5BA 2C61A 3GD5A 3BBPA 2FLVA 2IUSA 4MW0A 1L7MA 2COUA 3GR6A 4F84A 2OUIA 4M53A 1I8TA 2YX1A 3PFHA 1XXLA 5T4HA 1JHAA 1PBNA 5KTSA 4O0MA 3HJNA 2BI7A 3UAWA 4MVJI 2QPLA 3EY4A 3A1DA 1POXA 4J2HA 4F97A 1Y9JA 2NOAA 3H9GA 2Y1OA 3G5UA 1Z0UA 2CBZA 3KXKA 3SVZA 3D6FA 4ZQFA 3REQB 1PFKA 1UBHS 2EKBA 3K92A 3R6WA 4FJ2A 3GLFB 1U63A 3QXHA 1TC2A 4HB2A 5CYOA 1DO8A 3BSSA 1Y42X 1E59A 1VHJA 1O97D 4HYYA 2HPZA 1L1FA 3A4VA 3RHZA 1UL1X 2GCOB 3NASA 2BEWB 3UG6A 2XQGA 3ZWQA 4C76A 5A5GA 2OZEA 5AWFC 3TD6A 1ZUD1 4YP9A 5DX8A 3ZLUA 1ZNWA 1NR7A 1H94A 1IQRA 4OKSA 3UM9A 3DDOA 1Z29A 1EA5A 2E85A 3DMNA 4DLVA 3WJ2A 2YCBA 1FMLA 2GPJA 1QHEA 1U5BB 3OQVA 1Z7GA 2YJ5A 2X4IA 4L9SA 5J2UB 4ZI5A 3JQPA 4NCIA 3GARA 3DVAA 1X1RA 2F17A 1N6OA 4GE0A 2QYSA 4O1HA 4Q6BA 4B9AA 4M0DA 1SUFA 5JS1A 4X3OA 2GEBA 4IKPA 1C0LA 4K6KA 1ZVKA 4I81A 4PX3A 1XLTA 2DQ4A 2H00A 2ZSFA 1Z22A 2AQIA 4FDAA 3VZBA 1WXWA 4QDJA 2Y1GA 1EPUA 4KQHA 3S70A 1K4YA 4F2WA 4KQCA 1DPFA 3CRW1 3LX4A 3OWHA 4K2HA 5C80A 2F2TA 1U1IA 3IP6A 4JJ7A 4KFCA 5EHXA 3RVKA 3FKQA 4U1RA 1TA4A 2AMJA 1EFLA 3RIMA 1QG0A 4C5BA 3BQ9A 4CM9A 2V74B 3ZZTA 2BPOA 1E0SA 1JJ7A 5KHLB 3HJRA 4QJIA 2XCQA 2PUJA 1IJFA 5J43A 4NMHA 1Z5OA 2CE2X 4DR4B 5JPCA 5HIAA 1QFMA 4HF7A 2CNBA 4H6VA 3FOWA 1QIHA 3FDZB 4EW1A 3GLGB 4NJMB 2GD6A 2I4MA 2OTCA 1FFSA 3FPBA 2A1UB 1BA2A 3MNFA 4JGIA 2JGRA 4FMCB 4G0QA 1TQ6A 3OQOA 1CUJA 2IOYA 2OOKA 2EP7A 1C9YA 2WU4A 1GNLA 4XYLA 2AZ4A 3HYTA 2NVBA 4PGHA 3D2LA 3ZDEA 4FHEA 4FC6A 4FE7A 4WBNA 2FDCA 4ZU1X 3AP1A 2Q3BA 3CB4A 5JIBA 1JALA 1ND6A 2G9ZA 2VBCA 2TMYA 3GJSA 4IDFA 4EJMA 4A8HA 2Q4DA 4JP2A 3ZIUA 3NHPA 2IGBA 3O3NB 4G5HA 1L5MA 1KKMA 1G8JA 3SIRA 3H2BA 1P7VA 4DAOA 5GVSA 4M99A 1BMTA 5BYBA 1U28C 3RKRA 5L7TA 2ES4A 1KQNA 3VAAA 3ZWCA 3H11B 3QBDA 1K7CA 3JQAA 2O8BB 4RXUA 3VNQA 5EXTA 3QI7A 2FY8A 1XTJA 3G1WA 4JQCA 2HL6A 1FP2A 2X0JA 3GRFA 1GD1O 3QVGA 2PY6A 5K0TA 2W6OA 1AGRA 2CBXA 2XBUA 5DFAA 1VE1A 5EHZA 2BM9A 4YP1A 3PDJA 2JJ2A 3K6KA 3DB2A 1TT5B 1NTOA 2C4MA 1Q7EA 3GQVA 1P60A 1KTVA 4JJEA 1M6NA 2GVNA 1XP5A 3ILYA 4QSMA 4XPIB 5SZKB 4KPUA 1BE6A 1Q0UA 1Z35A 3N2EA 2W42A 3KTAA 4EX7A 2XI4A 2ZUUA 3K05A 4MDEA 5TQJA 1M1YA 2WUWE 4ZP1A 1M67A 1PAUA 4AL4A 1Q1BA 3DOFA 4DDHA 4UEQA 1R6AA 4AJ1A 2O8DA 4U7FA 4CIWA 3OKPA 3OCJA 3WJAA 1OZAA 4MVJA 3T52A 2W2VA 2W22A 2WV9A 5DO9A 5LP1A 4PAGA 1TQ8A 2OO5C 4CJXA 4LZJA 2HA3A 1DTWB 1L7RA 4LZWA 2CB9A 2P75A 4DKXA 2XMDA 2FHSA 1NMXA 2WHQA 3ZX4A 5DM60 1WEHA 2I3ZA 3A4NA 8LDHA 2AI3A 5T64A 2FMFA 3PHHA 4CKWB 2YVQA 4KQMA 1UEXC 2NZVG 3PI6A 3HK2A 4Z9YA 2A9OA 1E5XA 1RWVA 3B13B 4R1SA 5CB6A 4DUYB 4NOKA 3NH6A 1GKUB 1E2EA 3FI9A 1MC8A 5CMLA 3I8XA 3RV3A 2WSSD 1J70A 1HUQA 1NASA 1O03A 2V96A 2ZCUA 2AD1A 2VXYA 1A76A 4LZZA 1BH2A 1VJRA 1E3JA 1KBOA 1A8IA 2DCMA 3P94A 3G2LA 3JD1A 2ODTX 4BFXA 1P8AA 3HDGA 1ZM3A 1EFDN 5LZ8A 3H19A 2VH2A 3C8HA 3LE8A 2ZVJA 3HO1A 1G21B 4Z1OA 1J5XA 3ZHQA 4RQAA 1CUHA 2E37A 5HW0A 3M49A 4ZQHA 3C2QA 1PNTA 3QU7A 2VPTA 2XUKA 2XX3A 2YFKA 1XAJA 3AR4A 2RBEA 4ND4A 3W3AD 3SSNA 1K2WA 1XOIA 4CLEA 3MS7A 1T1JA 1Y6RA 1QIJA 4KAJA 2IE0A 3K7EA 1LW6E 3EJ6A 5I7HA 1YDHA 1ETHA 1SXJC 1IEWA 2FP3A 4OQYA 1JSRA 1L4NA 4QEKA 1M2OA 2GAFA 5K5EA 1QPGA 3KEMA 1K8YB 1Z26A 1Y1QA 3HB1A 4YQYA 1J8MF 2ERCA 5JAQA 3RJZA 3PGA1 4M1ZA 4B4OA 1M2VA 5FTMA 3BX1A 1CEQA 2BBOA 2BKXA 3FXAA 3EGCA 3OETA 3WADA 4INOA 1X1QA 5KYVA 5CD9A 1J42A 4F21A 1DBQA 2HZ7A 4YJGA 4JI7B 4LJ8A 1Z2NX 4RGBA 3WGVA 4YXFA 2Q3DA 2D0IA 4KLRA 2A84A 3O1JC 4E5NA 1OX5A 4CFSA 1ECPA 2J0SA 1JLMA 3GL9A 3DOIA 3HGMA 3W3ZB 2GXAA 1YB5A 2VHEA 2IDMA 1VTKA 4I7EA 4YUAA 1TYZA 3CM0A 2VWQA 4G24A 3JAMA 4TQUS 1MFZA 3G1TA 4RXMA 1H05A 1N0HA 4J43A 4OGFA 5BXQC 4KXMA 4DNPA 3MWLA 3WYDA 3C15C 5JXIA 1Y7LA 1G4HA 3DV9A 4QRHA 2DUNA 5TSDA 4L8VA 3TSYA 3H1GA 3OTIA 1FYDA 1J22A 1T6XA 1YK0A 3OWOA 3VR3D 5F9HA 3A2MA 4BFVA 4RTLA 1NAHA 4XIIA 4B5KA 2LV8A 1KQFA 4B9EA 3GPDG 4PCUA 3ENQA 2JEOA 4QPDA 2IYLD 3UT0A 4ZKEA 1HZJA 2H4XA 1N5IA 4INJA 2CXSA 2O3UA 2JFBA 3RFUA 2PQ6A 1W9MA 5LA6A 2H2IA 1CJCA 4ZCLA 3DOEA 3RTCA 3X1YA 4DV6B 4N9QA 4CKBB 3DE1X 3SHQA 2ZYTX 2O1XA 1XELA 5KYTA 1PU2A 1Y9ZA 3IODA 1FFGA 4QDOA 1NZJA 2WYVA 4DHEA 2R6FA 1FP4B 2XYQA 2Q99A 2M1XA 4GXRA 1NP7A 3CE6A 4R8KA 4ZVUA 1G8GA 1RRVA 4KXNA 4R7ZA 4RK4A 1RCFA 1GU1A 1U8TA 1ZUWA 5T7BA 2IYNA 1V45E 2IPOA 3IP9A 5K9ZA 4FNMA 1NVTA 3TS1A 2JFGA 1XCJA 2HA0A 4Q1FA 1M1NB 3GCZA 4RV4A 3BL5A 2BEKA 2P2ZA 4GWGA 3TM5A 1C3XA 3KAQA 1I30A 1EWRA 5IDVA 1VHLA 1Q1QA 2QI9C 3VZCA 4EZEA 5B58C 5FWXB 2J3KA 4KJXA 4CHGA 1ACLA 4CEHB 5EMJA 3FWKA 5KNDD 1TO1E 1JHOA 1Z0ZA 1VIAA 3DV2A 3IP3A 3HCPA 4L16A 5EGNA 4HT3B 3KZCA 3K0AA 1UBGA 2OQIA 2HF7A 1SZCA 1G5FA 2J9FA 2WC1A 1T3LA 2WU8A 2OEPA 3AEUA 3BF7A 4O2BF 1EVKA 2B2CA 2GTIA 5CU7A 3RS2A 3HTXA 3HBAA 2JKVA 2VT6A 3CF4G 3LV8A 1N1EA 4ZWNA 4F2HA 1M8JA 2E7ZA 2JIZD 3HP4A 4HR7A 5DHPA 5JNSA 1BVUA 3FH0A 1KI6B 2FE1A 1J7KA 2R62A 3AFGA 3LJKA 3N0WA 2MWMA 3QWHA 2H1OA 3OT1B 1H9AA 4N1AA 3JWEA 4UAGA 3ND7A 4YQZA 4WFQA 4ZCIA 5BWCA 1M6YA 2FB9A 2GPNA 5FYQA 3R7AA 7REQA 1R37A 1L5HA 1M34A 5JQWA 4R9SA 5H3HA 3AI1A 1MJGA 1A0OA 4CT5A 4Y2QA 1A4IA 2Q3LA 1J97A 4LI3X 4XFDA 3OAAD 4MICA 4P31A 3PL1A 4D25A 3HYSA 1OLOA 1P18A 3DOCA 5FYDA 5CXXA 3L7OA 1KK2A 1E96A 1OTHA 2W4QA 3LZCA 5M2QA 1V4BA 3LX5A 4EY4A 3VR0A 3AVTA 1B4DA 4EVSA 3CLTC 1RKBA 3X2FA 3NTUA 3TR6A 4AICA 5B6JA 3OZVA 4GFDA 3ZE8A 3EB9A 1BNCA 1V11B 2IQ5A 4PZZA 4ZO8A 4LVUA 5BR8B 1DKOA 5IAJA 5LMCA 2VHVA 3A1SA 2I22A 4XIFA 1H8ED 1WULS 3VDNB 4DLXA 1ZD1A 1ZISA 4PQRA 4BGDA 5LMZA 1MNAA 1N92A 5JMOA 3KQHA 2PVPA 3AZPA 3GJXC 4EB3A 1P2FA 3M6AA 3QLEA 1JPVA 3MWDA 4YYZA 1Q0ZA 2XCSB 1VMEA 3VR6D 5BQ5A 1Q84A 3HCOA 2YHIB 4P92A 2B2XA 3KOUA 2X7XA 4IDEA 4XA8A 3TNLA 4YUZA 2IEAA 1HEYA 2O57A 4FONA 4RELA 1JVBA 2Y67A 3D4OA 5AKXA 2FJPA 2FWNA 2B78A 2ATXA 3D4LA 2NQ8A 3PUIA 3ZHUA 1USIA 1R0SA 2JHAA 1NLZA 2JJMA 5EQJB 1ZVJA 1GRQA 3DFZA 1G9TA 1RJEA 4KO3S 4DJJA 3LY8A 3A1EA 2XUZA 4WACA 4H1WA 2D2FA 5GONF 5JH7F 4LFBB 3P27A 3M9LA 3ROXA 1MDBA 3A0RB 1TFUA 2IEBA 2NPFA 2E2WA 4AZ0A 4DA7A 1EJ0A 1RYEA 2K4MA 3D0OA 2VHJA 3ONEA 3KZXA 1PJRA 2YDXA 5TMBA 1V39A 1DVRA 3QVJA 5FOWA 4V3BA 5FLEX 2ECFA 2CKMA 2QRUA 3K94A 2G9NA 2XLBA 5JC1A 2EEZA 1V96A 4UPDA 2OLKA 4JR2A 2AH5A 4R31A 3TQCA 4A6EA 5CDUA 2ZU0C 4HDRA 9LDTA 2Z9CA 3RYIA 3ROGA 2CEKA 4HD8A 3VO8A 4DIMA 2ZK7A 3MFYA 3ABZA 1MCZA 2IFTA 3DMYA 4DLSA 3ZPXA 1Z17A 4MWZA 1SCAA 4PFSA 4TYPA 2J9XB 2UYQA 3JWJA 2WAYA 1W2GA 4HEA6 2XXAA 3JD2A 2AK2A 1VB3A 1DEAA 2EFYA 1FTSA 3UB2A 1MBZA 1KNQA 2BFWA 1AK2A 4MS1A 1EZZA 4K6FA 4R54A 4CBVA 1JZSA 5DN6D 1CCWA 2ONJA 1X42A 2XECA 1F4VA 4UE6A 1WZNA 4Y6RA 3RWBA 1OA1A 2R25B 4FHDA 3CVYA 2ET6A 2Z5LA 4GH5A 5JNRA 1T0PA 3JPWA 4R2WA 2WD9A 3HKDA 1WMSA 3IE2A 1K9VF 2GCNA 2X6QA 4NY1A 2XUGA 2YRWA 1YVPA 3F5MA 3H1BA 1F12A 5EZYA 2WSLA 5JJLA 1JZTA 4ZVTA 4EKIA 4YV0A 4OSEA 5FBQB 1XDGA 1X7DA 1K5GA 1H2EA 3GROA 3QU2A 3CEHA 5DT2A 4D57A 5G4KA 4FFRA 2FWMX 1XVUA 2VP9A 2WYOA 3L8CA 1FDOA 1CF4A 2I2BA 1U3FA 3EWAA 1B6RA 3FWNA 2BN4A 4CIXA 3O8CA 1JR4A 4B45A 2EYQA 3LHDA 2ODBA 4H9GA 4E33A 3SWWA 4JLBA 4JI2B 4RPKA 1G1MA 1C2TA 2G04A 2Q1YA 4LNAA 1RMTA 2BUCA 1VHDA 1IL0A 1G8AA 4F3KA 1XKLA 1K6MA 6Q21A 5HK9A 4ARIA 3UH1A 5JHHB 1WZ2A 1SVLA 4UARA 5HJ5A 5H16A 2IJGX 1T4BA 4EPWA 2C5EA 2G5TA 1JAYA 4MVJM 1FYFA 5LDGA 1COWA 2CXUA 2P2LA 2VDQB 4WBNB 5GAJA 1YF3A 1HNZB 1Q1GA 3LC1O 4IFEA 4TSFD 3NOXA 2ACEA 5EWJA 3DV0B 4FDUA 1I10A 2O52A 4QAJA 4S1WA 5CFQA 3SHTA 2XF8A 1OBHA 3VZQA 4F45A 4Z49A 1U3CA 1VQ1A 2ZWPA 2Q2WA 1PJ3A 3WGYA 1P2TA 5J63A 1E64A 4RVUA 4J2OA 2FHPA 3T4XA 1M8FA 4YT2A 821PA 3TNJA 1V8ZA 4Y9RA 5JDCA 4YCSA 2DB3A 2QQ0A 4NNOA 3AY0A 4PO9A 1IAQA 2OR3A 2HNAA 1MX5A 5TY0A 2E21A 2PT7A 1WUHS 4ZOLA 3IKLA 3CUUA 3HP1A 4UTVA 3QY9A 1GZ3A 3HBJA 4BMNA 1T25A 1C8KA 4HZUA 3B3AA 3UHAA 5DGIA 4E6EA 2VSYA 2ZBEA 3JQGA 4FDMA 4Q4AA 1YZUA 4WKOA 5JRZA 3KR9A 1LPSA 5ALPA 1V5IA 4F3NA 3W5VA 3V2IA 4M21A 4DSNA 3TW8A 1VJGA 1P0QA 1KU0A 2XA2A 1M2HA 5TMDA 3ESBA 3F74A 3TOXA 2HHJA 1EG2A 3GLRA 1JAZA 4NBLA 5WRFA 1M1YB 3FKSD 1VM6A 3CV3A 1STOA 2JGEA 1XMQB 1XTKA 1SIWA 2O8DB 1NN1A 3VPDA 4CG2A 2ERYA 3FIJA 4WWHA 1G8HA 5D3ZA 3IC5A 1IJBA 1GAWA 3LOPA 3EOZA 4JB3A 3ZI0A 2XKJE 2F1KA 3DMRA 4K40A 3U4AA 1UJ4A 1G19A 1A8QA 3OUTA 2CDRA 5KINB 5AI0A 3I4LA 1JFRA 1ZHFA 2VQ6A 3EXHC 4JH0A 1M6EX 4Q4LA 4XYGA 4CPDA 1QYIA 4FEGA 3UCEA 1OI7A 1V9CA 3Q5DA 3TTVA 2QZSA 2X2EA 3A1NA 3KZKA 2P65A 1ISGA 4ON9A 4U5QA 5TXGA 5U9CA 4CCWA 2IU4A 4HB4A 1IC6A 4NYIR 3HFGA 1R0CA 1XJWA 3CH7A 1TADA 4QVIA 1BWQA 1WU8A 2O6LA 2W6JA 5ALEA 1JLRA 1EEXB 1Z6QA 1Z7WA 4HATA 1F8UA 3UJ6A 4IS3A 1DJLA 5GVRA 4WXRA 4DTCA 3Q0EA 2UUAB 4D9NA 2QGFA 4NZNA 3EN0A 1MEEA 1D5CA 1RYYA 4QUHA 5D01A 2B4KA 1OFHA 3EVFA 2XWPA 3REOA 4P33A 3AV3A 1LPPA 1TGVA 3OZAA 4JNCA 4R71A 5FDFA 3B48A 1AQNA 3ILXA 3OQJA 3BL6A 4NLLA 2V7BA 2OA0A 3ZHRA 1K68A 4G26A 1ZI6A 1XZJA 1TVCA 3JZIA 4E1VA 3VC7A 5K6RA 4M1SA 1EP3B 5FHQA 5IDQA 4G07A 5DGTA 5HF6A 4CNQA 1TUEA 1NVDA 1U3WA 2IZZA 4LV5B 1KPIA 2NO6A 1P7CA 1UPTA 5IVPA 1H2BA 1OXBB 2ETVA 4D45A 4GL4A 5AHXA 3R2JA 3ZE1B 1D2CA 4FFSA 5CH3A 1F38A 2G7MC 2C0PA 2ID4A 3EPRA 4LZNA