1SJ6A

Nmr structure and regulated expression in apl cell of human sh3bgrl3
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
95
structure length
95
Chain Sequence
MSGLRVYSTSVTGSREIKSQQSEVTRILDGKRIQYQLVDISQDNALRDEMRALAGNPKATPPQIVNGDQYCGDYELFVEAVEQNTLQEFLKLALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SH3 domain-binding glutamic acid-rich-like protein 3
publication title NMR structure and regulated expression in APL cell of human SH3BGRL3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 20
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04908 SH3BGR SH3-binding, glutamic acid-rich protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1sj6A00
3TOTA 4L0UA 3QAGA 4MZBA 1QQ2A 4GXZA 2GT6A 1X5EA 1Z9HA 4TR3A 3N5OA 2KUCA 3L78A 3I43A 4ID0A 3F4RA 3RAZA 1SK2A 4N10A 2OE1A 1EEMA 2VCZA 2FWEA 5D96A 2V1MA 4YQMA 2IPAA 3VPQA 2OJLA 4YQUA 1GNEA 5G1KA 3G9BA 4IQ1A 4L5OA 3UARA 1F3BA 2HXKA 3IRAA 4RI7A 2FD3A 5AN1A 2C8UA 1Z5YE 3NIVA 3KTLA 3BCIA 1S3DA 4EDZA 1MD4A 2K9FA 5EL8A 3EMPA 4EDYA 4IN0A 2XPEA 3R2QA 2O87A 3TJKA 1TK5B 4HZ2A 2B7KA 1WIKA 4J57E 2C3NA 4QL7A 11GSA 1K0NA 2H6ZA 4PX1A 3HCZA 22GSA 3DMLA 4PUFC 3RHCA 2L5LA 3Q18A 3GFKA 4KCAA 1X5DA 2RLIA 5IMZA 4PURA 4F2IA 2D2ZA 1TK8B 5JCUA 1R26A 2I4AA 5D93A 3FW2A 4OFTA 5J4UA 2CQ9A 2FY6A 5IOXA 5J9BA 4ML6A 3HKRA 2I1UA 1SJ6A 4GLTA 2GGTA 4K7NA 2YZHA 5CYYA 5KN2A 2NDOA 4GCIA 2FWGA 4MJAA 1VRSD 5G5EA 1ERUA 5GAPD 3KGKA 3KH7A 3QCPA 4HOJA 2H30A 1X0RA 3WT1A 3UEMA 1Z3EA 4I6XA 4P3YB 2C4JA 4G9HA 2H0HA 3GKXA 5ECHB 1ERWA 3EC3A 2LTKA 3FZ4A 2CT6A 1MDKA 2XBIA 6GSWA 5IO2A 1WP0A 3GTUA 4POBA 1HQOA 2IMKA 3CBUA 4HU9A 1ABAA 1WOUA 2REMA 4ZBBA 3W8JA 4PQ1A 4AJ6A 1WJKA 2E2GA 4PQHA 1GH2A 4BVYA 4CDOA 4CW9A 4F0BA 5LCZA 1X9MB 5G2ZA 3LYPA 5A4UA 2JZRA 4ZL9A 2V6OA 5CREA 3F6DA 3G7YA 2JSYA 3QFBC 4BPYA 1FG4A 1SJIA 4OO5A 1MEKA 4JR4A 2BTOT 1K0MA 3TJJA 3H1NA 4XS1A 5B8BA 3ZFLA 3TJBA 2DJ3A 1XOBA 1AUCA 5JCWA 2PPTA 3UIWA 1O8XA 1B9XC 3TRXA 6GSSA 2K6VA 3APSA 2LV3A 5F8BA 2YJ7A 4GQFA 1VF2A 2PMTA 4POKA 2K8SA 2P5QA 1K3OA 1CQGA 4I5QA 4HQSA 4KSOA 2MYGA 4NXIA 2AUVA 3UBKA 2DMMA 5J5NA 2GQLA 3TGZA 5F0GA 2H19A 2MMNA 2GSTA 3IHQA 4WR4A 4J2FA 3U5RE 5FHIA 5J9CA 4TW5A 3ERGA 3G7JA 3N9JA 2KP1A 2O8VB 5FT3A 4FYUA 3ZVJD 2G0FA 4HQZA 4ZL7A 5JWQB 2OBIA 4QQ7A 3VK9A 4JU5A 5IQYA 1PX7A 4F0CA 1GNWA 2K8VA 5D8IA 3VI5A 1PL2A 3KTBA 1TK0B 1M2AA 1F37A 2V41A 2M46A 9GSSA 3ZLPA 2L4CA 5ECPB 2VL2C 5DJLA 1O8WA 1QXHA 3DWVA 1TI1A 4MF5A 4AJ7A 1O7UA 2AAWA 3VWWA 1K0DA 2LSTA 2CVDA 4V2NA 1DBYA 2C0EA 3KIJA 1GWCA 4MLYA 1NHOA 1VGLA 4IQAA 2VL9A 2IN3A 2DJJA 17GSA 3WGEA 1PX6A 1M2DA 1M7TA 1LJRA 1MD3A 2A2RA 1WWJA 2VM2A 3QFAC 3BOAA 1GP1A 1TRWA 1WMJA 5IPGA 4MJCA 2O85A 3VURA 4OFNA 1FAAA 1JLWA 3FRCA 3TKQA 3DVWA 1G7EA 1I5GA 3F8UA 2Z9SA 3CSHA 2HSHA 2AYTA 4RQRA 3KP9A 2HZFA 3IA1A 3LJRA 2JSZA 5ECKB 2J9HA 1XWBA 4ZL8A 3H4KA 1V58A 2LNSA 4QL9A 1NSWA 1T3BA 1FB0A 4ZXGA 4YH2A 4EVMA 3GKKA 5HFKA 3IAM2 4ZBAA 1VF1A 4NHWA 1GTIA 3F9UA 2RUEA 2DBCA 2OKAA 3MSZA 3M9KA 3ERFA 4IW9A 4MJEA 1XWGA 1K0CA 3TUEA 3GURA 1SL1B 3MWHA 4KGIA 4N0ZA 3HZ4A 2GZZA 2GSQA 3Q74A 3TJGA 4ISDA 5D9VA 4RQXA 3J7Yb 3FZ9A 5IOWA 2WULA 3DEXA 3HJOA 3ZITA 4HDEA 2VCVA 2J23A 1RK4A 3I9V2 3L9SA 1AXDA 3EMXA 2PVQA 2LEGA 3PH9A 4LL4B 4BVXA 3ISOA 1YKAA 3ZFBA 5HR1A 1XW9A 4MZWA 2O89A 2V32A 3D4MA 2MMAA 2VOCA 3TB2A 8GSSA 2CX4A 4BWQA 3F0IA 2HFDA 2H71A 4I97A 2GQKA 3EURA 5D9WA 2H70A 3UMAA 4ZBDA 4TXOB 3MNGA 2N5BA 1T8EB 2L4QA 2DJ0A 1O6JA 4BA7A 5IMAA 5GZZB 4JZQA 3TDGA 3QAWA 2OE0A 4OFMA 4K9ZA 1TOFA 3TRQA 1HNCA 3O6TA 2MZCA 1VF4A 3IOSA 4MF7A 1TRUA 14GSA 1FW1A 1N8JA 2RM6A 3U6VA 2GTUA 4G19A 2QGVA 1EGRA 2WFCA 3P7XA 3KMOA 3CTFA 1E6BA 4PUAA 2V2GA 2DJ1A 1EWXA 3ZZXA 4AF2A 5IPHA 1PD21 4FIWA 3W8SA 1B4QA 4D73B 4TR1B 1UVZA 3IV4A 2A2SA 3V1WA 5ABRA 19GSA 3F4SA 4FYBA 2R5GA 3KP8A 1GTUA 2HE3A 5J41A 2FHEA 1PQNA 4MPGA 1OC9B 3CXGA 2L5OA 1ZYEA 3KH9A 1G0TA 2DJ2A 2PUKC 5H5QA 1V9WA 2H1GA 1S3CA 16GSA 4AGSA 1USBA 1XWCA 2LJKA 4Q5FA 3UBLA 5ID2B 1FVKA 1UA5A 4BL7A 2FWHA 2XC2A 10GSA 1UC7A 4KA0A 1U6TA 3QPMA 4CHSA 1XBSA 3DVXA 5CRHA 2FA8A 2B5EA 3C8EA 2CVKA 1QMVA 4MH3A 4PGTA 5DBQA 4TOPA 3TKPA 2LRCA 3ZMLA 4D73A 1JZWA 4TR1A 3ZREA 4KUNA 6GSTA 4NV5A 1XXUA 2C0GA 1SKWB 5JWRB 4OCEA 1WE0A 5CAXA 1J08A 3FKFA 2F9SA 2JL4A 4NAXA 1QK8A 3RDWA 2CX3A 1OC9A 5ECIB 3FR6A 1G6YA 1RQMA 2LJAA 2VIMA 2WGRA 1ML6A 3FY7A 1KTEA 5FWGA 5IMCA 4XTSA 3ME7A 5ID2A 2LRNA 2TRXA 4JR6A 4K2DA 5A5KA 3GHAA 1GSFA 1SKRB 3AY8A 1TW9A 2WRTA 3WGXA 3NZNA 1SENA 2MMZA 1SL2B 1EGOA 5ECNB 5HFGA 3TKSA 3D21A 2ZCTA 1EOHA 1AQVA 4MMMA 2VLTA 4TR4A 1T00A 2PN8A 3KM6A 1XW6A 4RUVA 1JLVA 1AQWA 2HYXA 1XFLA 5DAKB 5GSSA 1XCCA 2HNLA 3LEFA 5LNKe 2FLSA 2DIZA 1KEBA 2KP2A 2ZUPA 3HDCA 1B8XA 4GTUA 3L9UA 2PGTA 2YWOA 4ZILA 1R4WA 5E59A 4L5LA 4EL1A 5DQSA 2A4VA 1ZZYA 3GL3A 4N0VA 1YJ6A 3UAPA 2F3MA 4EF0A 1QGVA 2N5AA 3MDKA 1YF1A 4LLRA 3C73A 4OCFA 1GUKA 5GAND 1KBNA 2JZTA 3LORA 1GL8A 4E8EA 4O7HA 1B9YC 3GX8A 1PMTA 3DKSA 3HVXA 3HVVA 3WD6A 5KN1A 1GRXA 1U3AA 1W4VA 3GN3A 2G2QA 2V6KA 4OWYA 3FR3A 3GUSA 2YN1A 3LXZA 3E0UA 1XVQA 2DSAA 1N2AA 1ERTA 2XBQA 2F8AA 5AISA 4EUYA 2H0IA 3O3TA 2HRNA 2CAIA 1PKZA 1YF0A 3VWVA 4X1UA 5G5FA 3HYPA 4ULXA 4KCEA 3WGDA 2E0QA 1A2LA 1ON4A 3M8NA 5D9TA 5F07A 4N30A 5IO0A 4NWYA 1T7PB 5ENUA 4L0WA 2E7PA 4KE3A 2GLRA 1GUMA 3RBTA 4NPBA 1KNGA 1YEXA 1PSQA 1TKDB 1TRVA 2H75A 4O92A 1TU7A 1DSBA 1V57A 2FUG2 3RPNA 2NTOA 3F3RA 3GIXA 2JZSA 4IELA 3ERWA 2VUPA 1YDKA 1TDIA 4F9ZA 4WF5A 1X5CA 4GRFA 2JU5A 2LQQA 3EWLA 4NMUA 4WBJA 1GUHA 3GH6A 3SBCA 1EEJA 1GSSA 2GS3A 1NM3A 1F2EA 3WYWA 2E2MA 1IYIA 2EIOA 6GSXA 6GSVA 1M9AA 2WCIA 4ECJA 5D9XA 4I2TA 5ECSA 4ECIA 3IPZA 1ZL9A 3APOA 3VI7A 1OVNA 4KNDA 1BEDA 2B6MA 4TRXA 4XRAA 3HD5A 1IYHA 4TKYA 3RPPA 4ECCA 1OE8A 4IVFA 2EIQA 3ZIJA 1K0BA 2PVOC 1NHYA 3M3MA 1M99A 2R37A 2VAFA 2PU9C 2LQOA 5CRWA 4RI6A 2YNXA 4XS6A 4TR0A 20GSA 2F51A 4WBRD 1SK1A 2GVPA 1Z6NA 2HRFA 3LGCA 2MBSA 3PGTA 1JHBA 3S9FA 1GSDA 3HXSA 3UVHA 4K1FA 3D6IA 4EXJA 3CRTA 1A2JA 3VWXA 2OACA 2FGXA 2P5RA 5KN0A 2H8LA 1AAZA 2X99A 2WZ9A 2QSIA 2XHFA 2NVLA 3D5JA 5DALB 2JACA 1HNBA 4L8EA 1YQ1A 3GL5A 2L6CA 4IP1A 3EVIA 2LNTA 2C3TA 3FHKA 5COHA 5L71A 3C1RA 4GF0A 4ACSA 4MP4A 3L4NA 2VD0A 1T4YA 4XCSA 2FA4A 3H79A 2X64A 4LA1A 2DMLA 2H74A 1HYUA 3GSSA 3IXRA 4HUAA 5ECQB 1ILOA 1PL1A 2VM1A 1PN9A 2IIYA 1OC8A 3A2XA 2YJHA 3UVTA 4DEJA 5B6NA 1TRSA 1EP8A 2HT9A 3F4TA 5B8AA 2CZ3A 4WEYA 1XWKA 4OMVA 13GSA 2KLXA 3I69A 4IKHA 1BYEA 2I9HA 3HHVA 1M0UA 1XPVA 1HNAA 2PBJA 4EO3A 4K7IA 3CMIA 4TN8A 3C1SA 2B5YA 4H86A 4I8BA 5GSTA 3PR8A 3CRUA 2CA8A 4PNGA 5CP1A 2DC5A 1R5PA 3VPTA 3GKNA 1JZRA 5CRDA 4HU7A 2AHEA 1LBKA 1URMA 4V1Ag 3ZYWA 2YOIA 5DDLA 3K8NA 3DYRA 4K7OA 1X9WB 2MMOA 1OE7A 2GT5A 1OAZA 3P8WA 3KZQA 3LWAA 1K0OA 3GRXA 2FNOA 2H66A 5ECMB 3KCMA 1A8LA 3ED3A 3IK7A 3EYTA 4MCUA 3GH9A 1YEPA 2R4VA 4V2LA 1FB6A 3PINA 2WS2A 4E8HA 3GMFA 4IJ3A 5B6MA 4V2MA 3IR4A 5HFIA 3A3TA 3BD2A 1W89A 1OC3A 1TI3A 4ZIJA 3ME8A 1NW2A 3J7Yk 1JZDA 3H8QA 4TXOA 4ZB9A 1GULA 1FHEA 1GTBA 3C7MA 3DXBA 3QR6A 4ZB8A 2EC4A 2VCTA 2YCDA 3BJ5A 3FZAA 1XW5A 4BWSA 1SL0B 4PQIA 2WJUA 2P31A 2PWJA 1I9DA 3D4TA 5AIVA 5KEJA 2ON5A 1GLPA 1A0FA 2TIRA 2N5FA 2QKEA 3HZ8A 1FOVA 3TOUA 2IMEA 4F82A 4NV2A 3A2WA 2VO4A 3UJ1A 4MF6A 6GSYA 3ZTLA 1Q4JA 4JE1A 1X9SB 4K8MA 1ACVA 3ZMKA 3HJMA 1Q98A 2CV4A 4HZ4A 1U3IA 1R5AA 2H76A 2IL3A 2B3SA 2C80A 2GZPA 4KAEA 1GTAA 5G1LA 3HJPA 4DSQA 4GSTA 4GSNA 1BJXA 4DSSB 2RIIA 4KX4A 2BMXA 3TKSC 3VWUA 2P0GA 2MBTA 4I2UA 4XRDA 2IWTA 2ON7A 3WT2A 2HZEB 1THOA 1SD8A 3GYKA 5JCGA 5EY6A 4YAPA 1PA3A 4FH8A 1MDIA 1A24A 5ELAA 3IC4A 3QD9A 1ZOFA 4TXVA 5EVOA 2RM5A 1XWAA 3QOUA 3C71A 2H6XA 2YANA 2IMFA 3GTUB 5ELGA 1G6WA 5IM9A 4Q5NA 4WXTA 1EP7A 4ILFA 1V98A 12GSA 1SU9A 4ECBA 4PXOA 1Y6EA 3US3A 2VLVA 2YPMA 2LRTA 2ES7A 2EIRA 3IK9A 4MPFA 1PKWA 2L57A 2FWFA 3KMNA 2VLUA 3APQA 3LG6A 2PERA 1WRYA 4GSSA 4DSSA 4MJBA 2B1LA 5INYA 5CNWA 3A2VA 2X8CA 2HZEA 1J9BA 2DLXA 3G7IA 4IP6A 1WPIA 2NBSA 4IBPA 1DUGA 4MDCA 2H1BA 1A8YA 4JEDA 1F9MA 1VF3A 2YV9A 4POLA 2QC7A 2CVBA 2IJYA 2K18A 3KD0A 5DCHA 2IMIA 2VD1A 4DVCA 3ZRDA 5HQPA 5CRGA 1PRXA 3F3QA 3LQ7A 3IBHA 4JBBA 2H01A 4IHUA 3GV1A 4O32A 1ZGNA 4G10A 1TU8A 1V40A 1DE1A 3EU3A 2HSYA 4DSRA 3HA9A 2X8GA 1SJZA 1O85A 1ZYQB 1RW1A 1ST9A 2LS5A 4KH7A 1BQ7A 4WF4A 2OADA 2HLSA 4OD7A 1SK0A 3E9JB 5D73A 4K0GA 5JWOB 2H6YA 2AV4A 4J56E 3EINA 3M1GA 1BX9A 5DAKA 3TKSE 5HR0A 4K0NA 2YWIA 1XVWA 4EKZA 3QMXA 2OBKA 1SYRA 4Q5RA 2GZYA 1TTZA 4OO4A 2AJQB 3FK8A 4IGJA 1QUWA 2WDUA 4WKWA 4MABA 3O76A 4EE0A 3VLNA 4F03A 5H5SA 3P90A 3P2AA 4AJ8A 1OKTA 3TKRA 5HR2A 1JFUA 3F6FA 5A4WA 1FO5A 3NOFA 2R6KA 2GDRA 1BAYA 3M9JA 5KN3A 5DVBA 4X0XA 2RUFA 4MH2A 3D22A 2R3XA 2WB9A 4PNFA 4YAVA 2DJKA 1DE2A 3A5WA 1F3AA 2O7KA 4KDXA 5A4VA 4TVEA 2B7JA 1AC1A 2YWNA 1XIYA 5F05A 2C1YA 3LFLA 5IMDA 4WETA 1J0FA 3QAVA 3E3EA 3GX0A 4JRRA 3KXOA 3Q19A 2H0GA 1XZOA 3W6GA 6GSUA 4KB3A 1THXA 1B48A 5IMVA 5J3RA 3LXTA 1U88A 2L59A 5HR3A 1OKDA 2XPDA 2R2JA 3L0HA 4POMA 1A0RP 1E2YA 1XOAA 1AQXA 1M9BA 5ECLB 2TRCP 4GWRA 4X43A 1SKSB 2IFQB 3HVSA 5DCGA 2GQMA 4HJ2A 5DQYA 5H5RA 1O81A 4MA9A 1PGTA 1YY7A 1H4OA 1C72A 5G31A 5IMFA 1Z7PA 3M0FA 2VCWA 3H93A 1H75A 1TXXA 4G2EA 2VL3A 4FYCA 3DRNA 1EV4A 2DIYA 1UN2A 1EOGA 1MTCA 1SD9A 4XS4B 2F8FA 2KOKA 5AGYA 1ZCPA 1TP9A 1EZKA 1JZOA 1M2BA 3FR9A 3ZVJA 2H1DA 3CYNA 3KJYA 4MK3A 2VL2A 3DD3A 2I3YA 4KDYA 2M80A 1AIUA 3TCOA 4EC0A 2LKUA 1AW9A 4FO5A 4HEA2 2H72A 2IMDA 1MDJA 3TJFA 1BG5A 1A2MA 1O73A 1ERVA 2IFQA 3RHBA 4IJIA 1G7OA 3IAS2 2H1AA 3EE2A 3JCML 4O5RA 1A23A 2OA7A 4HJMA 5DJMA 4XIHA 5AIXA 3BBYA 2C3QA 1R7HA 5G30A 2L6DA 1QFNA 4LMWA 4Q5QA 1S3AA 4XHMA 1Z7RA 3QDNA 3VFIA 2M72A 5IIZA 3TRPA 3ZIVA 2X8HA 2JADA 4KDUA 5C04A 4XS4A 3HY2A 3F63A 2CZ2A 2CAQA 2YV7A 2C0FA 3I6AA 2GSSA 3FEUA 5DALA 2FCHA 1EV9A 2OE3A 3ZL5A 3D0ZA 3UL3A 1F6MC 1U87A 1GSUA 2VCQA 4Z7XA 2LJRA 1GSEA 5E4WA 2I81A 4LL1B 2C0DA 1FVJA 3GA4A 3IE3A 4HI7A 1T1VA 3GKMA 1OYJA 2YZUA 3Q6OA 3DGQA 3FYGA 2H73A 2YP6A 4MZCA 3BCKA 1SYXA 5EPFA 1V2AA 1YKCA 4NHZA 4ZB6A 3UOMA 3MAKA 5C00A 5F06A 1GSYA 1Y25A 2LUSA 1K3LA 1ZMAA 3CSIA 3KEBA 4WR5A 7GSSA 4K6XA 1K3YA 1YZXA 3CSJA 2NPBA 2HI7A 2VCXA 3GSTA 3LYKA 4IS0A 1Z6MA 2YWMA 2ZNMA 2GSRA 4GQCA 2KHPA 18GSA 1LU4A 5B7CA 4KW6A 3SWLA 4V1Ap 3CTGA 5LD0A 2B5XA 1CQHA 2AB6A 4YQVA 4N11A 2ALBA 3L9VA 4KSMA 4ML1A 3EU4A 5ECRB 3LSZA 3OR5A 1TJDA 2B1KA 1K0AA 4LMVA 1B4PA 5CO3A 1GSQA 5ECOB 1HD2A 1T4ZA 2BJXA 3GNJA 1GLQA 3IDVA 3FZ5A 3DIEA 4HS1A
chains in the Genus database with same CATH superfamily
3TOTA 4L0UA 3QAGA 4MZBA 1QQ2A 4GXZA 2GT6A 1X5EA 1Z9HA 4TR3A 3N5OA 2KUCA 3L78A 3I43A 4ID0A 3F4RA 3RAZA 1SK2A 4N10A 2OE1A 1EEMA 2VCZA 2FWEA 5D96A 2V1MA 4YQMA 2IPAA 3VPQA 2OJLA 4YQUA 1GNEA 5G1KA 3G9BA 4IQ1A 3MIXA 4L5OA 3UARA 1F3BA 2HXKA 3IRAA 4RI7A 2FD3A 5AN1A 4Z2UA 2C8UA 1Z5YE 3NIVA 3KTLA 3BCIA 1S3DA 4EDZA 1MD4A 2K9FA 5EL8A 3EMPA 4EDYA 4IN0A 2XPEA 3R2QA 2O87A 3TJKA 1TK5B 4HZ2A 2B7KA 1WIKA 4J57E 2C3NA 4QL7A 11GSA 1K0NA 2H6ZA 4PX1A 3HCZA 22GSA 3DMLA 4PUFC 3RHCA 2L5LA 3Q18A 3GFKA 4KCAA 1X5DA 2RLIA 5IMZA 4PURA 2R0PA 4F2IA 2D2ZA 1TK8B 5JCUA 1R26A 2I4AA 5D93A 3FW2A 4OFTA 5J4UA 2CQ9A 2FY6A 5IOXA 5J9BA 4ML6A 3HKRA 2I1UA 1SJ6A 4GLTA 4K5RA 2GGTA 4K7NA 2YZHA 5CYYA 5KN2A 2NDOA 4GCIA 2FWGA 4MJAA 1VRSD 5G5EA 1ERUA 5GAPD 3KGKA 3KH7A 3QCPA 4HOJA 2H30A 4A5PA 1X0RA 3WT1A 4X4JA 3UEMA 1Z3EA 4I6XA 4P3YB 1ZYNA 2C4JA 4G9HA 2H0HA 3GKXA 5ECHB 1ERWA 3EC3A 2LTKA 3FZ4A 2CT6A 1MDKA 2XBIA 6GSWA 5IO2A 1WP0A 3GTUA 4POBA 1HQOA 2IMKA 3CBUA 4HU9A 1ABAA 1WOUA 2REMA 4ZBBA 3W8JA 4PQ1A 4AJ6A 1WJKA 2E2GA 4PQHA 1GH2A 4BVYA 4CDOA 4CW9A 4F0BA 5LCZA 1X9MB 5G2ZA 3LYPA 5A4UA 2JZRA 4ZL9A 2V6OA 5CREA 3F6DA 3G7YA 2JSYA 3QFBC 4BPYA 1PFOA 1FG4A 2X49A 1SJIA 4OO5A 5KOXA 1MEKA 4JR4A 2BTOT 1K0MA 3TJJA 3H1NA 4XS1A 5B8BA 3ZFLA 3TJBA 2DJ3A 1XOBA 1AUCA 5JCWA 2PPTA 3UIWA 1O8XA 1B9XC 3TRXA 6GSSA 2K6VA 3APSA 2LV3A 5F8BA 2YJ7A 4GQFA 1VF2A 2PMTA 4POKA 2K8SA 2P5QA 1K3OA 1CQGA 4I5QA 4HQSA 4KSOA 2MYGA 4NXIA 2AUVA 3UBKA 2DMMA 5J5NA 2GQLA 3TGZA 5F0GA 2H19A 2MMNA 2GSTA 3IHQA 4WR4A 4J2FA 3U5RE 5FHIA 5J9CA 4TW5A 3ERGA 3G7JA 3N9JA 2KP1A 2O8VB 5FT3A 4FYUA 3ZVJD 2G0FA 4HQZA 4ZL7A 5JWQB 2OBIA 4QQ7A 3VK9A 4JU5A 5BMUA 5IQYA 1PX7A 4Z2TA 4F0CA 1GNWA 2K8VA 5D8IA 3VI5A 1PL2A 3KTBA 4PTSA 1TK0B 1M2AA 1F37A 2V41A 2M46A 9GSSA 3ZLPA 2L4CA 5ECPB 2VL2C 5DJLA 1O8WA 1QXHA 3DWVA 1TI1A 4MF5A 4AJ7A 1O7UA 2AAWA 3VWWA 1K0DA 2LSTA 2CVDA 4V2NA 1DBYA 4O5UA 2C0EA 3KIJA 1GWCA 4MLYA 1NHOA 1VGLA 4IQAA 2VL9A 3HVNA 2IN3A 2DJJA 17GSA 3WGEA 3LW9A 1PX6A 1M2DA 1M7TA 1LJRA 1MD3A 3A5IA 2A2RA 1WWJA 2VM2A 3QFAC 3BOAA 1GP1A 1TRWA 1WMJA 5IPGA 4MJCA 2O85A 3VURA 4OFNA 1FAAA 1JLWA 3FRCA 3TKQA 3DVWA 1G7EA 1I5GA 4BIKA 3F8UA 2Z9SA 3CSHA 2HSHA 4BVXB 2AYTA 4RQRA 3KP9A 2HZFA 3IA1A 3LJRA 2JSZA 5ECKB 2J9HA 1XWBA 4ZL8A 3H4KA 1V58A 2LNSA 4QL9A 1NSWA 1T3BA 1FB0A 4ZXGA 4EIPA 4YH2A 4EVMA 3GKKA 5HFKA 3IAM2 4ZBAA 1VF1A 4NHWA 1GTIA 3F9UA 2RUEA 2DBCA 2OKAA 3MSZA 3M9KA 3ERFA 4IW9A 3EPTA 4MJEA 1XWGA 1K0CA 3TUEA 3GURA 1SL1B 3MWHA 4KGIA 4N0ZA 3HZ4A 2GZZA 2GSQA 3Q74A 3TJGA 4ISDA 1FOHA 5D9VA 4RQXA 3J7Yb 3FZ9A 5IOWA 2WULA 3DEXA 3HJOA 3ZITA 4HDEA 2VCVA 2J23A 1RK4A 3I9V2 3L9SA 1AXDA 3EMXA 2PVQA 2LEGA 3PH9A 4LL4B 4BVXA 3ISOA 1YKAA 3ZFBA 5HR1A 1XW9A 4MZWA 2O89A 2V32A 3D4MA 2MMAA 2VOCA 3TB2A 8GSSA 2CX4A 4BWQA 3F0IA 2HFDA 2H71A 4I97A 2GQKA 3EURA 5D9WA 2H70A 3UMAA 4ZBDA 4TXOB 3MNGA 2N5BA 1T8EB 2L4QA 2DJ0A 1O6JA 4BA7A 5IMAA 5GZZB 4JZQA 3TDGA 3QAWA 2OE0A 4OFMA 4K9ZA 1TOFA 3TRQA 1HNCA 3O6TA 2MZCA 1VF4A 3IOSA 4MF7A 1TRUA 14GSA 4G0KA 1FW1A 1N8JA 2RM6A 3U6VA 2GTUA 4G19A 4BL7B 2QGVA 1EGRA 2WFCA 3P7XA 3KMOA 3CTFA 1E6BA 4PUAA 2V2GA 2DJ1A 1EWXA 3ZZXA 4AF2A 5IPHA 1PD21 4FIWA 3W8SA 1B4QA 4D73B 4TR1B 1UVZA 3IV4A 2A2SA 3V1WA 5ABRA 19GSA 3F4SA 4FYBA 2R5GA 3KP8A 1GTUA 2HE3A 5J41A 2FHEA 1PQNA 4CY8A 4MPGA 1OC9B 3CXGA 2L5OA 4K2XA 1ZYEA 3KH9A 1G0TA 2DJ2A 2PUKC 5H5QA 1V9WA 2H1GA 1S3CA 16GSA 4AGSA 1USBA 1XWCA 2LJKA 4Q5FA 3UBLA 5ID2B 1FVKA 1UA5A 4BL7A 2FWHA 2XC2A 10GSA 1UC7A 4KA0A 1U6TA 3QPMA 4CHSA 1XBSA 3DVXA 5CRHA 2FA8A 2B5EA 3C8EA 2CVKA 1QMVA 4MH3A 4PGTA 5DBQA 4TOPA 3TKPA 2LRCA 3ZMLA 4D73A 1JZWA 4TR1A 3ZREA 4KUNA 6GSTA 4NV5A 1XXUA 2C0GA 1SKWB 5JWRB 4OCEA 1WE0A 5CAXA 1J08A 3FKFA 2F9SA 2JL4A 4K5SA 4NAXA 1QK8A 3RDWA 2CX3A 1OC9A 5ECIB 4MNNA 3FR6A 1G6YA 1RQMA 2LJAA 2VIMA 2WGRA 1ML6A 3FY7A 1KTEA 5FWGA 5IMCA 4XTSA 3ME7A 2HRAA 5ID2A 2LRNA 2TRXA 4JR6A 2A4HA 4K2DA 3GHAA 5A5KA 1GSFA 1SKRB 3AY8A 1TW9A 2WRTA 3WGXA 3NZNA 1SENA 2MMZA 1SL2B 1EGOA 5ECNB 5HFGA 3TKSA 3D21A 2ZCTA 1EOHA 1AQVA 4MMMA 2VLTA 4TR4A 1T00A 2PN8A 3KM6A 1XW6A 4RUVA 1JLVA 1AQWA 2HYXA 1XFLA 5DAKB 5GSSA 1XCCA 2HNLA 3LEFA 5LNKe 2FLSA 2DIZA 1KEBA 2KP2A 2ZUPA 3HDCA 1B8XA 4GTUA 3L9UA 2PGTA 2YWOA 4ZILA 1R4WA 5E59A 4L5LA 4EL1A 5DQSA 2A4VA 1ZZYA 3GL3A 3CQFA 4N0VA 1YJ6A 3UAPA 2F3MA 4EF0A 1QGVA 2N5AA 3MDKA 1YF1A 4LLRA 3C73A 4OCFA 1GUKA 5GAND 4EIQA 1KBNA 2JZTA 3LORA 1GL8A 4E8EA 4O7HA 1B9YC 3GX8A 1PMTA 3DKSA 3HVXA 3HVVA 3WD6A 5KN1A 1GRXA 1U3AA 1W4VA 3GN3A 2G2QA 2V6KA 4OWYA 1M3JA 3FR3A 3GUSA 2YN1A 3LXZA 3E0UA 2X4AA 1XVQA 2DSAA 1N2AA 1ERTA 2XBQA 2F8AA 5AISA 4EUYA 2H0IA 3O3TA 2HRNA 2CAIA 1PKZA 1YF0A 3VWVA 4X1UA 5G5FA 3HYPA 4ULXA 4KCEA 3WGDA 2E0QA 1A2LA 1ON4A 3M8NA 5D9TA 3IHGA 5F07A 4N30A 5IO0A 4NWYA 3IC8A 1T7PB 5ENUA 4L0WA 2E7PA 4KE3A 2GLRA 3PPUA 1GUMA 3RBTA 4NPBA 1KNGA 1YEXA 1PSQA 1TKDB 1TRVA 2H75A 4O92A 1TU7A 1DSBA 1V57A 2FUG2 3RPNA 2NTOA 3F3RA 3GIXA 2JZSA 4IELA 3ERWA 2VUPA 1YDKA 1TDIA 4F9ZA 4WF5A 1X5CA 4GRFA 2JU5A 2LQQA 3EWLA 4NMUA 4WBJA 1GUHA 3GH6A 3SBCA 1EEJA 1GSSA 2GS3A 1NM3A 1F2EA 3WYWA 2E2MA 1IYIA 2EIOA 6GSXA 6GSVA 1M9AA 2WCIA 4ECJA 5D9XA 4I2TA 5ECSA 4ECIA 3IPZA 1ZL9A 3APOA 3VI7A 1OVNA 4KNDA 1BEDA 2B6MA 4TRXA 4XRAA 3HD5A 1IYHA 4TKYA 3RPPA 4ECCA 1OE8A 4IVFA 2EIQA 3ZIJA 1K0BA 2PVOC 1NHYA 3M3MA 1M99A 2R37A 2VAFA 2PU9C 2LQOA 5CRWA 4RI6A 2YNXA 4XS6A 4TR0A 20GSA 2F51A 4WBRD 1SK1A 2GVPA 1Z6NA 2HRFA 3LGCA 2MBSA 3PGTA 1JHBA 3S9FA 1GSDA 3HXSA 3UVHA 4K1FA 3D6IA 4EXJA 3CRTA 1A2JA 3VWXA 2OACA 3FMWA 2FGXA 2P5RA 5KN0A 4HSCX 2H8LA 1AAZA 2X99A 2WZ9A 2QSIA 2XHFA 2NVLA 3D5JA 5DALB 2JACA 1HNBA 4L8EA 1YQ1A 3GL5A 2L6CA 4IP1A 3EVIA 2LNTA 2C3TA 3FHKA 5COHA 5L71A 3C1RA 4GF0A 4ACSA 4MP4A 3L4NA 2VD0A 1T4YA 4XCSA 2FA4A 3H79A 2X64A 4LA1A 2DMLA 2H74A 1HYUA 3GSSA 3IXRA 4HUAA 5ECQB 1ILOA 1PL1A 2VM1A 1PN9A 2DKIA 2IIYA 1OC8A 3A2XA 2YJHA 3UVTA 4DEJA 5B6NA 1TRSA 1EP8A 2HT9A 4G0LA 3F4TA 5B8AA 2CZ3A 4WEYA 1XWKA 4OMVA 13GSA 2KLXA 3I69A 4IKHA 1BYEA 2UZ8A 2I9HA 3HHVA 1M0UA 1XPVA 1HNAA 2PBJA 4EO3A 4K7IA 3CMIA 4TN8A 3C1SA 2B5YA 4H86A 4I8BA 5GSTA 3PR8A 3CRUA 2CA8A 4PNGA 5CP1A 2DC5A 1R5PA 3VPTA 3GKNA 1JZRA 4USSA 5CRDA 4HU7A 2AHEA 1LBKA 1URMA 4V1Ag 3ZYWA 2YOIA 5DDLA 3K8NA 3DYRA 4K7OA 1X9WB 1ZYPA 2MMOA 5KOWA 1OE7A 2GT5A 1OAZA 3P8WA 3KZQA 3LWAA 1K0OA 3GRXA 2FNOA 2H66A 5ECMB 3KCMA 1A8LA 4ICYA 3R3EA 3ED3A 3IK7A 3EYTA 2A2PA 4MCUA 3GH9A 1YEPA 2R4VA 4V2LA 1FB6A 3PINA 2WS2A 4E8HA 4Z2RA 3GMFA 4IJ3A 5B6MA 4V2MA 3IR4A 5HFIA 5BRTA 3A3TA 3BD2A 1W89A 1OC3A 1TI3A 4YKGA 4ZIJA 3ME8A 1NW2A 3J7Yk 1JZDA 3H8QA 4TXOA 4ZB9A 1GULA 1FHEA 1GTBA 3C7MA 3DXBA 3QR6A 4ZB8A 2EC4A 2VCTA 2YCDA 3BJ5A 3FZAA 1XW5A 4BWSA 1SL0B 4PQIA 2WJUA 2P31A 2PWJA 1I9DA 3D4TA 5AIVA 5KEJA 2ON5A 1GLPA 1A0FA 2TIRA 2N5FA 2QKEA 3HZ8A 1FOVA 3TOUA 2IMEA 4F82A 4NV2A 3A2WA 2VO4A 3UJ1A 4MF6A 6GSYA 3ZTLA 1Q4JA 4JE1A 1X9SB 4K8MA 1ACVA 3ZMKA 3HJMA 1Q98A 2CV4A 4HZ4A 1U3IA 1R5AA 2H76A 2IL3A 2B3SA 2C80A 2GZPA 4KAEA 1GTAA 5G1LA 3HJPA 4DSQA 2HSMA 4GSTA 4GSNA 1BJXA 4DSSB 2RIIA 4KX4A 2BMXA 3TKSC 3VWUA 2P0GA 2MBTA 4I2UA 4XRDA 2IWTA 2ON7A 3WT2A 2HZEB 1THOA 1SD8A 3GYKA 5JCGA 5EY6A 4YAPA 1PA3A 4FH8A 1MDIA 1A24A 5ELAA 3IC4A 3QD9A 1ZOFA 4TXVA 2R0CA 2RM5A 5EVOA 2DKHA 1XWAA 3QOUA 3C71A 2H6XA 2YANA 2IMFA 3GTUB 5ELGA 1G6WA 5IM9A 4Q5NA 4WXTA 1EP7A 4ILFA 1V98A 12GSA 1SU9A 4ECBA 4PXOA 1Y6EA 3US3A 2VLVA 2YPMA 2LRTA 4BVYB 4G0IA 1PN0A 2ES7A 2EIRA 3IK9A 4MPFA 1PKWA 2L57A 2FWFA 3KMNA 2VLUA 3APQA 3LG6A 2PERA 1WRYA 4GSSA 4DSSA 4MJBA 2B1LA 5INYA 5CNWA 3A2VA 2X8CA 2HZEA 1J9BA 2DLXA 3G7IA 4IP6A 1WPIA 2NBSA 4IBPA 1DUGA 4MDCA 2H1BA 1A8YA 4JEDA 1F9MA 1VF3A 2YV9A 4POLA 2QC7A 2CVBA 2IJYA 2K18A 3KD0A 5DCHA 2IMIA 2VD1A 4DVCA 3ZRDA 5HQPA 5CRGA 1PRXA 3F3QA 3LQ7A 3IBHA 4JBBA 2H01A 4IHUA 3GV1A 4O32A 1ZGNA 4G10A 1TU8A 1V40A 1DE1A 3EU3A 2HSYA 4DSRA 3HA9A 2X8GA 1SJZA 1O85A 1ZYQB 1RW1A 1ST9A 2LS5A 4KH7A 1BQ7A 4WF4A 2OADA 2HLSA 4OD7A 1SK0A 3E9JB 5D73A 4K0GA 5JWOB 2H6YA 2AV4A 4J56E 2QA2A 3EINA 3M1GA 1BX9A 5DAKA 3TKSE 5HR0A 4K0NA 2YWIA 1XVWA 4EKZA 3QMXA 2OBKA 1SYRA 4Q5RA 2GZYA 1TTZA 4OO4A 2AJQB 3FK8A 4IGJA 1QUWA 2WDUA 4WKWA 4MABA 3O76A 4EE0A 3VLNA 4F03A 5H5SA 3P90A 3P2AA 4AJ8A 1OKTA 3TKRA 5HR2A 1JFUA 3F6FA 5A4WA 1FO5A 3NOFA 2R6KA 2GDRA 1BAYA 3M9JA 5KN3A 5DVBA 4X0XA 2RUFA 4MH2A 3D22A 2R3XA 2WB9A 4PNFA 4YAVA 2DJKA 1DE2A 3A5WA 1F3AA 2O7KA 4KDXA 5A4VA 1M3IA 4TVEA 2B7JA 2HRKA 1AC1A 2YWNA 1XIYA 5F05A 2C1YA 4FQUA 3LFLA 5IMDA 4WETA 1J0FA 3QAVA 3E3EA 3GX0A 4JRRA 3KXOA 3Q19A 2H0GA 1XZOA 3W6GA 6GSUA 4KB3A 4YKFA 1THXA 1B48A 5IMVA 5J3RA 3LXTA 1U88A 2L59A 5HR3A 1OKDA 2XPDA 2R2JA 3L0HA 4POMA 1S3RA 1A0RP 1E2YA 1XOAA 1AQXA 1M9BA 5ECLB 4KF9A 2TRCP 4GWRA 4X43A 1SKSB 2IFQB 3HVSA 5DCGA 2GQMA 4HJ2A 5DQYA 5H5RA 1O81A 4MA9A 1PGTA 1YY7A 1H4OA 1C72A 5G31A 5IMFA 1Z7PA 3M0FA 2R0GA 2VCWA 3H93A 1H75A 1TXXA 4G2EA 2VL3A 4FYCA 3DRNA 1EV4A 2DIYA 1UN2A 1EOGA 1MTCA 1SD9A 4XS4B 2F8FA 2KOKA 5AGYA 1ZCPA 1TP9A 1EZKA 1JZOA 1M2BA 3FR9A 3ZVJA 2H1DA 3CYNA 3KJYA 4MK3A 2VL2A 3DD3A 2I3YA 4KDYA 2M80A 1AIUA 3TCOA 4EC0A 2LKUA 1AW9A 4FO5A 4HEA2 2H72A 2IMDA 1MDJA 3TJFA 1BG5A 1A2MA 1O73A 1ERVA 2IFQA 3RHBA 4IJIA 1G7OA 3IAS2 2H1AA 3EE2A 3JCML 4O5RA 1A23A 2OA7A 4HJMA 5DJMA 4XIHA 5AIXA 3BBYA 2C3QA 1R7HA 5G30A 2L6DA 1QFNA 4LMWA 4Q5QA 2QA1A 1S3AA 4XHMA 1Z7RA 3QDNA 3VFIA 2M72A 5IIZA 3TRPA 3ZIVA 2X8HA 1XG8A 2JADA 4KDUA 5C04A 4XS4A 3HY2A 3F63A 2CZ2A 2CAQA 2YV7A 4O5QA 2C0FA 3I6AA 2GSSA 3FEUA 5DALA 2FCHA 1EV9A 2OE3A 3ZL5A 3D0ZA 3UL3A 1F6MC 1U87A 1GSUA 2VCQA 4Z7XA 2LJRA 1GSEA 5E4WA 2I81A 4LL1B 2C0DA 1FVJA 3GA4A 3IE3A 4HI7A 1T1VA 3GKMA 4CY6A 1OYJA 2YZUA 3Q6OA 3DGQA 3FYGA 2H73A 2YP6A 4MZCA 3BCKA 1SYXA 5EPFA 1V2AA 1YKCA 4NHZA 4ZB6A 3UOMA 3MAKA 5C00A 5F06A 1GSYA 1Y25A 2LUSA 1K3LA 1ZMAA 3CSIA 3KEBA 4WR5A 7GSSA 4K6XA 1K3YA 1YZXA 3CSJA 2NPBA 2HI7A 2VCXA 3GSTA 3LYKA 4IS0A 1Z6MA 2YWMA 2ZNMA 2GSRA 4GQCA 2KHPA 18GSA 1LU4A 5B7CA 4KW6A 3SWLA 4V1Ap 3CTGA 5LD0A 2B5XA 1CQHA 2AB6A 4YQVA 4N11A 2ALBA 3L9VA 4KSMA 4ML1A 3EU4A 5ECRB 3LSZA 3OR5A 1TJDA 2B1KA 1K0AA 4LMVA 3MYDA 1B4PA 5CO3A 1GSQA 5ECOB 1HD2A 1T4ZA 2BJXA 3GNJA 1GLQA 3IDVA 3FZ5A 3DIEA 4HS1A
chains in the Genus database with same CATH topology
3TOTA 4L0UA 3QAGA 4MZBA 1QQ2A 4GXZA 2GT6A 1X5EA 1Z9HA 4TR3A 3N5OA 2KUCA 3L78A 3I43A 4ID0A 3F4RA 3RAZA 1SK2A 4N10A 2OE1A 1EEMA 2VCZA 2FWEA 5D96A 2V1MA 4YQMA 2IPAA 3VPQA 2OJLA 4YQUA 1GNEA 5G1KA 3G9BA 4IQ1A 3MIXA 4L5OA 3UARA 1F3BA 2HXKA 3IRAA 4RI7A 2FD3A 5AN1A 4Z2UA 2C8UA 1Z5YE 3NIVA 3KTLA 3BCIA 1S3DA 4EDZA 1MD4A 2K9FA 5EL8A 3EMPA 4EDYA 4IN0A 2XPEA 3R2QA 2O87A 3TJKA 1TK5B 4HZ2A 2B7KA 1WIKA 4J57E 2C3NA 4QL7A 11GSA 1K0NA 2H6ZA 4PX1A 3HCZA 22GSA 3DMLA 4PUFC 3RHCA 2L5LA 3Q18A 3GFKA 4KCAA 1X5DA 2RLIA 5IMZA 4PURA 2R0PA 4F2IA 2D2ZA 1TK8B 5JCUA 1R26A 2I4AA 5D93A 3FW2A 4OFTA 5J4UA 2CQ9A 2FY6A 5IOXA 5J9BA 4ML6A 3HKRA 2I1UA 1SJ6A 4GLTA 4K5RA 2GGTA 4K7NA 2YZHA 5CYYA 5KN2A 2NDOA 4GCIA 2FWGA 4MJAA 1VRSD 5G5EA 1ERUA 5GAPD 3KGKA 3KH7A 3QCPA 4HOJA 2H30A 4A5PA 1X0RA 3WT1A 4X4JA 3UEMA 1Z3EA 4I6XA 4P3YB 1ZYNA 2C4JA 4G9HA 2H0HA 3GKXA 5ECHB 1ERWA 3EC3A 2LTKA 3FZ4A 2CT6A 1MDKA 2XBIA 6GSWA 5IO2A 1WP0A 3GTUA 4POBA 1HQOA 2IMKA 3CBUA 4HU9A 1ABAA 1WOUA 2REMA 4ZBBA 3W8JA 4PQ1A 4AJ6A 1WJKA 2E2GA 4PQHA 1GH2A 4BVYA 4CDOA 4CW9A 4F0BA 5LCZA 1X9MB 5G2ZA 3LYPA 5A4UA 2JZRA 4ZL9A 2V6OA 5CREA 3F6DA 3G7YA 2JSYA 3QFBC 4BPYA 1FG4A 2X49A 1SJIA 4OO5A 5KOXA 1MEKA 4JR4A 2BTOT 1K0MA 3TJJA 3H1NA 4XS1A 5B8BA 3ZFLA 3TJBA 2DJ3A 1XOBA 1AUCA 5JCWA 2PPTA 3UIWA 1O8XA 1B9XC 3TRXA 6GSSA 2K6VA 3APSA 2LV3A 5F8BA 2YJ7A 4GQFA 1VF2A 2PMTA 4POKA 2K8SA 2P5QA 1K3OA 1CQGA 4I5QA 4HQSA 4KSOA 2MYGA 4NXIA 2AUVA 3UBKA 2DMMA 5J5NA 2GQLA 3TGZA 5F0GA 2H19A 2MMNA 2GSTA 3IHQA 4WR4A 4J2FA 3U5RE 5FHIA 5J9CA 4TW5A 3ERGA 3G7JA 3N9JA 2KP1A 2O8VB 5FT3A 4FYUA 3ZVJD 2G0FA 4HQZA 4ZL7A 5JWQB 2OBIA 4QQ7A 3VK9A 4JU5A 5BMUA 5IQYA 1PX7A 4Z2TA 4F0CA 1GNWA 2K8VA 5D8IA 3VI5A 1PL2A 3KTBA 4PTSA 1TK0B 1M2AA 1F37A 2V41A 2M46A 9GSSA 3ZLPA 2L4CA 5ECPB 2VL2C 5DJLA 1O8WA 1QXHA 3DWVA 1TI1A 4MF5A 4AJ7A 1O7UA 2AAWA 3VWWA 1K0DA 2LSTA 2CVDA 4V2NA 1DBYA 4O5UA 2C0EA 3KIJA 1GWCA 4MLYA 1NHOA 1VGLA 4IQAA 2VL9A 2IN3A 2DJJA 17GSA 3WGEA 3LW9A 1PX6A 1M2DA 1M7TA 1LJRA 1MD3A 3A5IA 2A2RA 1WWJA 2VM2A 3QFAC 3BOAA 1GP1A 1TRWA 1WMJA 5IPGA 4MJCA 2O85A 3VURA 4OFNA 1FAAA 1JLWA 3FRCA 3TKQA 3DVWA 1G7EA 1I5GA 3F8UA 2Z9SA 3CSHA 2HSHA 4BVXB 2AYTA 4RQRA 3KP9A 2HZFA 3IA1A 3LJRA 2JSZA 5ECKB 2J9HA 1XWBA 4ZL8A 3H4KA 1V58A 2LNSA 4QL9A 1NSWA 1T3BA 1FB0A 4ZXGA 4EIPA 4YH2A 4EVMA 3GKKA 5HFKA 3IAM2 4ZBAA 1VF1A 4NHWA 1GTIA 3F9UA 2RUEA 2DBCA 2OKAA 3MSZA 3M9KA 3ERFA 4IW9A 3EPTA 4MJEA 1XWGA 1K0CA 3TUEA 3GURA 1SL1B 3MWHA 4KGIA 4N0ZA 3HZ4A 2GZZA 2GSQA 3Q74A 3TJGA 4ISDA 1FOHA 5D9VA 4RQXA 3J7Yb 3FZ9A 5IOWA 2WULA 3DEXA 3HJOA 3ZITA 4HDEA 2VCVA 2J23A 1RK4A 3I9V2 3L9SA 1AXDA 3EMXA 2PVQA 2LEGA 3PH9A 4LL4B 4BVXA 3ISOA 1YKAA 3ZFBA 5HR1A 1XW9A 4MZWA 2O89A 2V32A 3D4MA 2MMAA 2VOCA 3TB2A 8GSSA 2CX4A 4BWQA 3F0IA 2HFDA 2H71A 4I97A 2GQKA 3EURA 5D9WA 2H70A 3UMAA 4ZBDA 4TXOB 3MNGA 2N5BA 1T8EB 2L4QA 2DJ0A 1O6JA 4BA7A 5IMAA 5GZZB 4JZQA 3TDGA 3QAWA 2OE0A 4OFMA 4K9ZA 1TOFA 3TRQA 1HNCA 3O6TA 2MZCA 1VF4A 3IOSA 4MF7A 1TRUA 14GSA 4G0KA 1FW1A 1N8JA 2RM6A 3U6VA 2GTUA 4G19A 4BL7B 2QGVA 1EGRA 2WFCA 3P7XA 3KMOA 3CTFA 1E6BA 4PUAA 2V2GA 2DJ1A 1EWXA 3ZZXA 4AF2A 5IPHA 1PD21 4FIWA 3W8SA 1B4QA 4D73B 4TR1B 1UVZA 3IV4A 2A2SA 3V1WA 5ABRA 19GSA 3F4SA 4FYBA 2R5GA 3KP8A 1GTUA 2HE3A 5J41A 2FHEA 1PQNA 4CY8A 4MPGA 1OC9B 3CXGA 2L5OA 4K2XA 1ZYEA 3KH9A 1G0TA 2DJ2A 2PUKC 5H5QA 1V9WA 2H1GA 1S3CA 16GSA 4AGSA 1USBA 1XWCA 2LJKA 4Q5FA 3UBLA 5ID2B 1FVKA 1UA5A 4BL7A 2FWHA 2XC2A 10GSA 1UC7A 4KA0A 1U6TA 3QPMA 4CHSA 1XBSA 3DVXA 5CRHA 2FA8A 2B5EA 3C8EA 2CVKA 1QMVA 4MH3A 4PGTA 5DBQA 4TOPA 3TKPA 2LRCA 3ZMLA 4D73A 1JZWA 4TR1A 3ZREA 4KUNA 6GSTA 4NV5A 1XXUA 2C0GA 1SKWB 5JWRB 4OCEA 1WE0A 5CAXA 1J08A 3FKFA 2F9SA 2JL4A 4K5SA 4NAXA 1QK8A 3RDWA 2CX3A 1OC9A 5ECIB 4MNNA 3FR6A 1G6YA 1RQMA 2LJAA 2VIMA 2WGRA 1ML6A 3FY7A 1KTEA 5FWGA 5IMCA 4XTSA 3ME7A 2HRAA 5ID2A 2LRNA 2TRXA 4JR6A 2A4HA 4K2DA 3GHAA 5A5KA 1GSFA 1SKRB 3AY8A 1TW9A 2WRTA 3WGXA 3NZNA 1SENA 2MMZA 1SL2B 1EGOA 5ECNB 5HFGA 3TKSA 3D21A 2ZCTA 1EOHA 1AQVA 4MMMA 2VLTA 4TR4A 1T00A 2PN8A 3KM6A 1XW6A 4RUVA 1JLVA 1AQWA 2HYXA 1XFLA 5DAKB 5GSSA 1XCCA 2HNLA 3LEFA 5LNKe 2FLSA 2DIZA 1KEBA 2KP2A 2ZUPA 3HDCA 1B8XA 4GTUA 3L9UA 2PGTA 2YWOA 4ZILA 1R4WA 5E59A 4L5LA 4EL1A 5DQSA 2A4VA 1ZZYA 3GL3A 4N0VA 1YJ6A 3UAPA 2F3MA 4EF0A 1QGVA 2N5AA 3MDKA 1YF1A 4LLRA 3C73A 4OCFA 1GUKA 5GAND 4EIQA 1KBNA 2JZTA 3LORA 1GL8A 4E8EA 4O7HA 1B9YC 3GX8A 1PMTA 3DKSA 3HVXA 3HVVA 3WD6A 5KN1A 1GRXA 1U3AA 1W4VA 3GN3A 2G2QA 2V6KA 4OWYA 3FR3A 3GUSA 2YN1A 3LXZA 3E0UA 2X4AA 1XVQA 2DSAA 1N2AA 1ERTA 2XBQA 2F8AA 5AISA 4EUYA 2H0IA 3O3TA 2HRNA 2CAIA 1PKZA 1YF0A 3VWVA 4X1UA 5G5FA 3HYPA 4ULXA 4KCEA 3WGDA 2E0QA 1A2LA 1ON4A 3M8NA 5D9TA 3IHGA 5F07A 4N30A 5IO0A 4NWYA 3IC8A 1T7PB 5ENUA 4L0WA 2E7PA 4KE3A 2GLRA 3PPUA 1GUMA 3RBTA 4NPBA 1KNGA 1YEXA 1PSQA 1TKDB 1TRVA 2H75A 4O92A 1TU7A 1DSBA 1V57A 2FUG2 3RPNA 2NTOA 3F3RA 3GIXA 2JZSA 4IELA 3ERWA 2VUPA 1YDKA 1TDIA 4F9ZA 4WF5A 1X5CA 4GRFA 2JU5A 2LQQA 3EWLA 4NMUA 4WBJA 1GUHA 3GH6A 3SBCA 1EEJA 1GSSA 2GS3A 1NM3A 1F2EA 3WYWA 2E2MA 1IYIA 2EIOA 6GSXA 6GSVA 1M9AA 2WCIA 4ECJA 5D9XA 4I2TA 5ECSA 4ECIA 3IPZA 1ZL9A 3APOA 3VI7A 1OVNA 4KNDA 1BEDA 2B6MA 4TRXA 4XRAA 3HD5A 1IYHA 4TKYA 3RPPA 4ECCA 1OE8A 4IVFA 2EIQA 3ZIJA 1K0BA 2PVOC 1NHYA 3M3MA 1M99A 2R37A 2VAFA 2PU9C 2LQOA 5CRWA 4RI6A 2YNXA 4XS6A 4TR0A 20GSA 2F51A 4WBRD 1SK1A 2GVPA 1Z6NA 2HRFA 3LGCA 2MBSA 3PGTA 1JHBA 3S9FA 1GSDA 3HXSA 3UVHA 4K1FA 3D6IA 4EXJA 3CRTA 1A2JA 3VWXA 2OACA 3FMWA 2FGXA 2P5RA 5KN0A 2H8LA 1AAZA 2X99A 2WZ9A 2QSIA 2XHFA 2NVLA 3D5JA 5DALB 2JACA 1HNBA 4L8EA 1YQ1A 3GL5A 2L6CA 4IP1A 3EVIA 2LNTA 2C3TA 3FHKA 5COHA 5L71A 3C1RA 4GF0A 4ACSA 4MP4A 3L4NA 2VD0A 1T4YA 4XCSA 2FA4A 3H79A 2X64A 4LA1A 2DMLA 2H74A 1HYUA 3GSSA 3IXRA 4HUAA 5ECQB 1ILOA 1PL1A 2VM1A 1PN9A 2DKIA 2IIYA 1OC8A 3A2XA 2YJHA 3UVTA 4DEJA 5B6NA 1TRSA 1EP8A 2HT9A 4G0LA 3F4TA 5B8AA 2CZ3A 4WEYA 1XWKA 4OMVA 13GSA 2KLXA 3I69A 4IKHA 1BYEA 2UZ8A 2I9HA 3HHVA 1M0UA 1XPVA 1HNAA 2PBJA 4EO3A 4K7IA 3CMIA 4TN8A 3C1SA 2B5YA 4H86A 4I8BA 5GSTA 3PR8A 3CRUA 2CA8A 4PNGA 5CP1A 2DC5A 1R5PA 3VPTA 3GKNA 1JZRA 4USSA 5CRDA 4HU7A 2AHEA 1LBKA 1URMA 4V1Ag 3ZYWA 2YOIA 5DDLA 3K8NA 3DYRA 4K7OA 1X9WB 1ZYPA 2MMOA 5KOWA 1OE7A 2GT5A 1OAZA 3P8WA 3KZQA 3LWAA 1K0OA 3GRXA 2FNOA 2H66A 5ECMB 3KCMA 1A8LA 4ICYA 3R3EA 3ED3A 3IK7A 3EYTA 2A2PA 4MCUA 3GH9A 1YEPA 2R4VA 4V2LA 1FB6A 3PINA 2WS2A 4E8HA 4Z2RA 3GMFA 4IJ3A 5B6MA 4V2MA 3IR4A 5HFIA 5BRTA 3A3TA 3BD2A 1W89A 1OC3A 1TI3A 4YKGA 4ZIJA 3ME8A 1NW2A 3J7Yk 1JZDA 3H8QA 4TXOA 4ZB9A 1GULA 1FHEA 1GTBA 3C7MA 3DXBA 3QR6A 4ZB8A 2EC4A 2VCTA 2YCDA 3BJ5A 3FZAA 1XW5A 4BWSA 1SL0B 4PQIA 2WJUA 2P31A 2PWJA 1I9DA 3D4TA 5AIVA 5KEJA 2ON5A 1GLPA 1A0FA 2TIRA 2N5FA 2QKEA 3HZ8A 1FOVA 3TOUA 2IMEA 4F82A 4NV2A 3A2WA 2VO4A 3UJ1A 4MF6A 6GSYA 3ZTLA 1Q4JA 4JE1A 1X9SB 4K8MA 1ACVA 3ZMKA 3HJMA 1Q98A 2CV4A 4HZ4A 1U3IA 1R5AA 2H76A 2IL3A 2B3SA 2C80A 2GZPA 4KAEA 1GTAA 5G1LA 3HJPA 4DSQA 2HSMA 4GSTA 4GSNA 1BJXA 4DSSB 2RIIA 4KX4A 2BMXA 3TKSC 3VWUA 2P0GA 2MBTA 4I2UA 4XRDA 2IWTA 2ON7A 3WT2A 2HZEB 1THOA 1SD8A 3GYKA 5JCGA 5EY6A 4YAPA 1PA3A 4FH8A 1MDIA 1A24A 5ELAA 3IC4A 3QD9A 1ZOFA 4TXVA 2R0CA 2RM5A 5EVOA 2DKHA 1XWAA 3QOUA 3C71A 2H6XA 2YANA 2IMFA 3GTUB 5ELGA 1G6WA 5IM9A 4Q5NA 4WXTA 1EP7A 4ILFA 1V98A 12GSA 1SU9A 4ECBA 4PXOA 1Y6EA 3US3A 2VLVA 2YPMA 2LRTA 4BVYB 4G0IA 1PN0A 2ES7A 2EIRA 3IK9A 4MPFA 1PKWA 2L57A 2FWFA 3KMNA 2VLUA 3APQA 3LG6A 2PERA 1WRYA 4GSSA 4DSSA 4MJBA 2B1LA 5INYA 5CNWA 3A2VA 2X8CA 2HZEA 1J9BA 2DLXA 3G7IA 4IP6A 1WPIA 2NBSA 4IBPA 1DUGA 4MDCA 2H1BA 1A8YA 4JEDA 1F9MA 1VF3A 2YV9A 4POLA 2QC7A 2CVBA 2IJYA 2K18A 3KD0A 5DCHA 2IMIA 2VD1A 4DVCA 3ZRDA 5HQPA 5CRGA 1PRXA 3F3QA 3LQ7A 3IBHA 4JBBA 2H01A 4IHUA 3GV1A 4O32A 1ZGNA 4G10A 1TU8A 1V40A 1DE1A 3EU3A 2HSYA 4DSRA 3HA9A 2X8GA 1SJZA 1O85A 1ZYQB 1RW1A 1ST9A 2LS5A 4KH7A 1BQ7A 4WF4A 2OADA 2HLSA 4OD7A 1SK0A 3E9JB 5D73A 4K0GA 5JWOB 2H6YA 2AV4A 4J56E 2QA2A 3EINA 3M1GA 1BX9A 5DAKA 3TKSE 5HR0A 4K0NA 2YWIA 1XVWA 4EKZA 3QMXA 2OBKA 1SYRA 4Q5RA 2GZYA 1TTZA 4OO4A 2AJQB 3FK8A 4IGJA 1QUWA 2WDUA 4WKWA 4MABA 3O76A 4EE0A 3VLNA 4F03A 5H5SA 3P90A 3P2AA 4AJ8A 1OKTA 3TKRA 5HR2A 1JFUA 3F6FA 5A4WA 1FO5A 3NOFA 2R6KA 2GDRA 1BAYA 3M9JA 5KN3A 5DVBA 4X0XA 2RUFA 4MH2A 3D22A 2R3XA 2WB9A 4PNFA 4YAVA 2DJKA 1DE2A 3A5WA 1F3AA 2O7KA 4KDXA 5A4VA 4TVEA 2B7JA 2HRKA 1AC1A 2YWNA 1XIYA 5F05A 2C1YA 4FQUA 3LFLA 5IMDA 4WETA 1J0FA 3QAVA 3E3EA 3GX0A 4JRRA 3KXOA 3Q19A 2H0GA 1XZOA 3W6GA 6GSUA 4KB3A 4YKFA 1THXA 1B48A 5IMVA 5J3RA 3LXTA 1U88A 2L59A 5HR3A 1OKDA 2XPDA 2R2JA 3L0HA 4POMA 1A0RP 1E2YA 1XOAA 1AQXA 1M9BA 5ECLB 4KF9A 2TRCP 4GWRA 4X43A 1SKSB 2IFQB 3HVSA 5DCGA 2GQMA 4HJ2A 5DQYA 5H5RA 1O81A 4MA9A 1PGTA 1YY7A 1H4OA 1C72A 5G31A 5IMFA 1Z7PA 3M0FA 2R0GA 2VCWA 3H93A 1H75A 1TXXA 4G2EA 2VL3A 4FYCA 3DRNA 1EV4A 2DIYA 1UN2A 1EOGA 1MTCA 1SD9A 4XS4B 2F8FA 2KOKA 5AGYA 1ZCPA 1TP9A 1EZKA 1JZOA 1M2BA 3FR9A 3ZVJA 2H1DA 3CYNA 3KJYA 4MK3A 2VL2A 3DD3A 2I3YA 4KDYA 2M80A 1AIUA 3TCOA 4EC0A 2LKUA 1AW9A 4FO5A 4HEA2 2H72A 2IMDA 1MDJA 3TJFA 1BG5A 1A2MA 1O73A 1ERVA 2IFQA 3RHBA 4IJIA 1G7OA 3IAS2 2H1AA 3EE2A 3JCML 4O5RA 1A23A 2OA7A 4HJMA 5DJMA 4XIHA 5AIXA 3BBYA 2C3QA 1R7HA 5G30A 2L6DA 1QFNA 4LMWA 4Q5QA 2QA1A 1S3AA 4XHMA 1Z7RA 3QDNA 3VFIA 2M72A 5IIZA 3TRPA 3ZIVA 2X8HA 2JADA 4KDUA 5C04A 4XS4A 3HY2A 3F63A 2CZ2A 2CAQA 2YV7A 4O5QA 2C0FA 3I6AA 2GSSA 3FEUA 5DALA 2FCHA 1EV9A 2OE3A 3ZL5A 3D0ZA 3UL3A 1F6MC 1U87A 1GSUA 2VCQA 4Z7XA 2LJRA 1GSEA 5E4WA 2I81A 4LL1B 2C0DA 1FVJA 3GA4A 3IE3A 4HI7A 1T1VA 3GKMA 4CY6A 1OYJA 2YZUA 3Q6OA 3DGQA 3FYGA 2H73A 2YP6A 4MZCA 3BCKA 1SYXA 5EPFA 1V2AA 1YKCA 4NHZA 4ZB6A 3UOMA 3MAKA 5C00A 5F06A 1GSYA 1Y25A 2LUSA 1K3LA 1ZMAA 3CSIA 3KEBA 4WR5A 7GSSA 4K6XA 1K3YA 1YZXA 3CSJA 2NPBA 2HI7A 2VCXA 3GSTA 3LYKA 4IS0A 1Z6MA 2YWMA 2ZNMA 2GSRA 4GQCA 2KHPA 18GSA 1LU4A 5B7CA 4KW6A 3SWLA 4V1Ap 3CTGA 5LD0A 2B5XA 1CQHA 2AB6A 4YQVA 4N11A 2ALBA 3L9VA 4KSMA 4ML1A 3EU4A 5ECRB 3LSZA 3OR5A 1TJDA 2B1KA 1K0AA 4LMVA 3MYDA 1B4PA 5CO3A 1GSQA 5ECOB 1HD2A 1T4ZA 2BJXA 3GNJA 1GLQA 3IDVA 3FZ5A 3DIEA 4HS1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TOT A;  4L0U A;  3QAG A;  4MZB A;  1QQ2 A;  4GXZ A;  2GT6 A;  1X5E A;  1Z9H A;  4TR3 A;  3N5O A;  2KUC A;  3L78 A;  3I43 A;  4ID0 A;  3F4R A;  3RAZ A;  1SK2 A;  4N10 A;  2OE1 A;  1EEM A;  2VCZ A;  2FWE A;  5D96 A;  2V1M A;  4YQM A;  2IPA A;  3VPQ A;  2OJL A;  4YQU A;  1GNE A;  5G1K A;  3G9B A;  4IQ1 A;  4L5O A;  3UAR A;  1F3B A;  2HXK A;  3IRA A;  4RI7 A;  2FD3 A;  5AN1 A;  2C8U A;  1Z5Y E;  3NIV A;  3KTL A;  3BCI A;  1S3D A;  4EDZ A;  1MD4 A;  2K9F A;  5EL8 A;  3EMP A;  4EDY A;  4IN0 A;  2XPE A;  3R2Q A;  2O87 A;  3TJK A;  1TK5 B;  4HZ2 A;  2B7K A;  1WIK A;  4J57 E;  2C3N A;  4QL7 A;  11GS A;  1K0N A;  2H6Z A;  4PX1 A;  3HCZ A;  22GS A;  3DML A;  4PUF C;  3RHC A;  2L5L A;  3Q18 A;  3GFK A;  4KCA A;  1X5D A;  2RLI A;  5IMZ A;  4PUR A;  4F2I A;  2D2Z A;  1TK8 B;  5JCU A;  1R26 A;  2I4A A;  5D93 A;  3FW2 A;  4OFT A;  5J4U A;  2CQ9 A;  2FY6 A;  5IOX A;  5J9B A;  4ML6 A;  3HKR A;  2I1U A;  1SJ6 A;  4GLT A;  2GGT A;  4K7N A;  2YZH A;  5CYY A;  5KN2 A;  2NDO A;  4GCI A;  2FWG A;  4MJA A;  1VRS D;  5G5E A;  1ERU A;  5GAP D;  3KGK A;  3KH7 A;  3QCP A;  4HOJ A;  2H30 A;  1X0R A;  3WT1 A;  3UEM A;  1Z3E A;  4I6X A;  4P3Y B;  2C4J A;  4G9H A;  2H0H A;  3GKX A;  5ECH B;  1ERW A;  3EC3 A;  2LTK A;  3FZ4 A;  2CT6 A;  1MDK A;  2XBI A;  6GSW A;  5IO2 A;  1WP0 A;  3GTU A;  4POB A;  1HQO A;  2IMK A;  3CBU A;  4HU9 A;  1ABA A;  1WOU A;  2REM A;  4ZBB A;  3W8J A;  4PQ1 A;  4AJ6 A;  1WJK A;  2E2G A;  4PQH A;  1GH2 A;  4BVY A;  4CDO A;  4CW9 A;  4F0B A;  5LCZ A;  1X9M B;  5G2Z A;  3LYP A;  5A4U A;  2JZR A;  4ZL9 A;  2V6O A;  5CRE A;  3F6D A;  3G7Y A;  2JSY A;  3QFB C;  4BPY A;  1FG4 A;  1SJI A;  4OO5 A;  1MEK A;  4JR4 A;  2BTO T;  1K0M A;  3TJJ A;  3H1N A;  4XS1 A;  5B8B A;  3ZFL A;  3TJB A;  2DJ3 A;  1XOB A;  1AUC A;  5JCW A;  2PPT A;  3UIW A;  1O8X A;  1B9X C;  3TRX A;  6GSS A;  2K6V A;  3APS A;  2LV3 A;  5F8B A;  2YJ7 A;  4GQF A;  1VF2 A;  2PMT A;  4POK A;  2K8S A;  2P5Q A;  1K3O A;  1CQG A;  4I5Q A;  4HQS A;  4KSO A;  2MYG A;  4NXI A;  2AUV A;  3UBK A;  2DMM A;  5J5N A;  2GQL A;  3TGZ A;  5F0G A;  2H19 A;  2MMN A;  2GST A;  3IHQ A;  4WR4 A;  4J2F A;  3U5R E;  5FHI A;  5J9C A;  4TW5 A;  3ERG A;  3G7J A;  3N9J A;  2KP1 A;  2O8V B;  5FT3 A;  4FYU A;  3ZVJ D;  2G0F A;  4HQZ A;  4ZL7 A;  5JWQ B;  2OBI A;  4QQ7 A;  3VK9 A;  4JU5 A;  5IQY A;  1PX7 A;  4F0C A;  1GNW A;  2K8V A;  5D8I A;  3VI5 A;  1PL2 A;  3KTB A;  1TK0 B;  1M2A A;  1F37 A;  2V41 A;  2M46 A;  9GSS A;  3ZLP A;  2L4C A;  5ECP B;  2VL2 C;  5DJL A;  1O8W A;  1QXH A;  3DWV A;  1TI1 A;  4MF5 A;  4AJ7 A;  1O7U A;  2AAW A;  3VWW A;  1K0D A;  2LST A;  2CVD A;  4V2N A;  1DBY A;  2C0E A;  3KIJ A;  1GWC A;  4MLY A;  1NHO A;  1VGL A;  4IQA A;  2VL9 A;  2IN3 A;  2DJJ A;  17GS A;  3WGE A;  1PX6 A;  1M2D A;  1M7T A;  1LJR A;  1MD3 A;  2A2R A;  1WWJ A;  2VM2 A;  3QFA C;  3BOA A;  1GP1 A;  1TRW A;  1WMJ A;  5IPG A;  4MJC A;  2O85 A;  3VUR A;  4OFN A;  1FAA A;  1JLW A;  3FRC A;  3TKQ A;  3DVW A;  1G7E A;  1I5G A;  3F8U A;  2Z9S A;  3CSH A;  2HSH A;  2AYT A;  4RQR A;  3KP9 A;  2HZF A;  3IA1 A;  3LJR A;  2JSZ A;  5ECK B;  2J9H A;  1XWB A;  4ZL8 A;  3H4K A;  1V58 A;  2LNS A;  4QL9 A;  1NSW A;  1T3B A;  1FB0 A;  4ZXG A;  4YH2 A;  4EVM A;  3GKK A;  5HFK A;  3IAM 2;  4ZBA A;  1VF1 A;  4NHW A;  1GTI A;  3F9U A;  2RUE A;  2DBC A;  2OKA A;  3MSZ A;  3M9K A;  3ERF A;  4IW9 A;  4MJE A;  1XWG A;  1K0C A;  3TUE A;  3GUR A;  1SL1 B;  3MWH A;  4KGI A;  4N0Z A;  3HZ4 A;  2GZZ A;  2GSQ A;  3Q74 A;  3TJG A;  4ISD A;  5D9V A;  4RQX A;  3J7Y b;  3FZ9 A;  5IOW A;  2WUL A;  3DEX A;  3HJO A;  3ZIT A;  4HDE A;  2VCV A;  2J23 A;  1RK4 A;  3I9V 2;  3L9S A;  1AXD A;  3EMX A;  2PVQ A;  2LEG A;  3PH9 A;  4LL4 B;  4BVX A;  3ISO A;  1YKA A;  3ZFB A;  5HR1 A;  1XW9 A;  4MZW A;  2O89 A;  2V32 A;  3D4M A;  2MMA A;  2VOC A;  3TB2 A;  8GSS A;  2CX4 A;  4BWQ A;  3F0I A;  2HFD A;  2H71 A;  4I97 A;  2GQK A;  3EUR A;  5D9W A;  2H70 A;  3UMA A;  4ZBD A;  4TXO B;  3MNG A;  2N5B A;  1T8E B;  2L4Q A;  2DJ0 A;  1O6J A;  4BA7 A;  5IMA A;  5GZZ B;  4JZQ A;  3TDG A;  3QAW A;  2OE0 A;  4OFM A;  4K9Z A;  1TOF A;  3TRQ A;  1HNC A;  3O6T A;  2MZC A;  1VF4 A;  3IOS A;  4MF7 A;  1TRU A;  14GS A;  1FW1 A;  1N8J A;  2RM6 A;  3U6V A;  2GTU A;  4G19 A;  2QGV A;  1EGR A;  2WFC A;  3P7X A;  3KMO A;  3CTF A;  1E6B A;  4PUA A;  2V2G A;  2DJ1 A;  1EWX A;  3ZZX A;  4AF2 A;  5IPH A;  1PD2 1;  4FIW A;  3W8S A;  1B4Q A;  4D73 B;  4TR1 B;  1UVZ A;  3IV4 A;  2A2S A;  3V1W A;  5ABR A;  19GS A;  3F4S A;  4FYB A;  2R5G A;  3KP8 A;  1GTU A;  2HE3 A;  5J41 A;  2FHE A;  1PQN A;  4MPG A;  1OC9 B;  3CXG A;  2L5O A;  1ZYE A;  3KH9 A;  1G0T A;  2DJ2 A;  2PUK C;  5H5Q A;  1V9W A;  2H1G A;  1S3C A;  16GS A;  4AGS A;  1USB A;  1XWC A;  2LJK A;  4Q5F A;  3UBL A;  5ID2 B;  1FVK A;  1UA5 A;  4BL7 A;  2FWH A;  2XC2 A;  10GS A;  1UC7 A;  4KA0 A;  1U6T A;  3QPM A;  4CHS A;  1XBS A;  3DVX A;  5CRH A;  2FA8 A;  2B5E A;  3C8E A;  2CVK A;  1QMV A;  4MH3 A;  4PGT A;  5DBQ A;  4TOP A;  3TKP A;  2LRC A;  3ZML A;  4D73 A;  1JZW A;  4TR1 A;  3ZRE A;  4KUN A;  6GST A;  4NV5 A;  1XXU A;  2C0G A;  1SKW B;  5JWR B;  4OCE A;  1WE0 A;  5CAX A;  1J08 A;  3FKF A;  2F9S A;  2JL4 A;  4NAX A;  1QK8 A;  3RDW A;  2CX3 A;  1OC9 A;  5ECI B;  3FR6 A;  1G6Y A;  1RQM A;  2LJA A;  2VIM A;  2WGR A;  1ML6 A;  3FY7 A;  1KTE A;  5FWG A;  5IMC A;  4XTS A;  3ME7 A;  5ID2 A;  2LRN A;  2TRX A;  4JR6 A;  4K2D A;  5A5K A;  3GHA A;  1GSF A;  1SKR B;  3AY8 A;  1TW9 A;  2WRT A;  3WGX A;  3NZN A;  1SEN A;  2MMZ A;  1SL2 B;  1EGO A;  5ECN B;  5HFG A;  3TKS A;  3D21 A;  2ZCT A;  1EOH A;  1AQV A;  4MMM A;  2VLT A;  4TR4 A;  1T00 A;  2PN8 A;  3KM6 A;  1XW6 A;  4RUV A;  1JLV A;  1AQW A;  2HYX A;  1XFL A;  5DAK B;  5GSS A;  1XCC A;  2HNL A;  3LEF A;  5LNK e;  2FLS A;  2DIZ A;  1KEB A;  2KP2 A;  2ZUP A;  3HDC A;  1B8X A;  4GTU A;  3L9U A;  2PGT A;  2YWO A;  4ZIL A;  1R4W A;  5E59 A;  4L5L A;  4EL1 A;  5DQS A;  2A4V A;  1ZZY A;  3GL3 A;  4N0V A;  1YJ6 A;  3UAP A;  2F3M A;  4EF0 A;  1QGV A;  2N5A A;  3MDK A;  1YF1 A;  4LLR A;  3C73 A;  4OCF A;  1GUK A;  5GAN D;  1KBN A;  2JZT A;  3LOR A;  1GL8 A;  4E8E A;  4O7H A;  1B9Y C;  3GX8 A;  1PMT A;  3DKS A;  3HVX A;  3HVV A;  3WD6 A;  5KN1 A;  1GRX A;  1U3A A;  1W4V A;  3GN3 A;  2G2Q A;  2V6K A;  4OWY A;  3FR3 A;  3GUS A;  2YN1 A;  3LXZ A;  3E0U A;  1XVQ A;  2DSA A;  1N2A A;  1ERT A;  2XBQ A;  2F8A A;  5AIS A;  4EUY A;  2H0I A;  3O3T A;  2HRN A;  2CAI A;  1PKZ A;  1YF0 A;  3VWV A;  4X1U A;  5G5F A;  3HYP A;  4ULX A;  4KCE A;  3WGD A;  2E0Q A;  1A2L A;  1ON4 A;  3M8N A;  5D9T A;  5F07 A;  4N30 A;  5IO0 A;  4NWY A;  1T7P B;  5ENU A;  4L0W A;  2E7P A;  4KE3 A;  2GLR A;  1GUM A;  3RBT A;  4NPB A;  1KNG A;  1YEX A;  1PSQ A;  1TKD B;  1TRV A;  2H75 A;  4O92 A;  1TU7 A;  1DSB A;  1V57 A;  2FUG 2;  3RPN A;  2NTO A;  3F3R A;  3GIX A;  2JZS A;  4IEL A;  3ERW A;  2VUP A;  1YDK A;  1TDI A;  4F9Z A;  4WF5 A;  1X5C A;  4GRF A;  2JU5 A;  2LQQ A;  3EWL A;  4NMU A;  4WBJ A;  1GUH A;  3GH6 A;  3SBC A;  1EEJ A;  1GSS A;  2GS3 A;  1NM3 A;  1F2E A;  3WYW A;  2E2M A;  1IYI A;  2EIO A;  6GSX A;  6GSV A;  1M9A A;  2WCI A;  4ECJ A;  5D9X A;  4I2T A;  5ECS A;  4ECI A;  3IPZ A;  1ZL9 A;  3APO A;  3VI7 A;  1OVN A;  4KND A;  1BED A;  2B6M A;  4TRX A;  4XRA A;  3HD5 A;  1IYH A;  4TKY A;  3RPP A;  4ECC A;  1OE8 A;  4IVF A;  2EIQ A;  3ZIJ A;  1K0B A;  2PVO C;  1NHY A;  3M3M A;  1M99 A;  2R37 A;  2VAF A;  2PU9 C;  2LQO A;  5CRW A;  4RI6 A;  2YNX A;  4XS6 A;  4TR0 A;  20GS A;  2F51 A;  4WBR D;  1SK1 A;  2GVP A;  1Z6N A;  2HRF A;  3LGC A;  2MBS A;  3PGT A;  1JHB A;  3S9F A;  1GSD A;  3HXS A;  3UVH A;  4K1F A;  3D6I A;  4EXJ A;  3CRT A;  1A2J A;  3VWX A;  2OAC A;  2FGX A;  2P5R A;  5KN0 A;  2H8L A;  1AAZ A;  2X99 A;  2WZ9 A;  2QSI A;  2XHF A;  2NVL A;  3D5J A;  5DAL B;  2JAC A;  1HNB A;  4L8E A;  1YQ1 A;  3GL5 A;  2L6C A;  4IP1 A;  3EVI A;  2LNT A;  2C3T A;  3FHK A;  5COH A;  5L71 A;  3C1R A;  4GF0 A;  4ACS A;  4MP4 A;  3L4N A;  2VD0 A;  1T4Y A;  4XCS A;  2FA4 A;  3H79 A;  2X64 A;  4LA1 A;  2DML A;  2H74 A;  1HYU A;  3GSS A;  3IXR A;  4HUA A;  5ECQ B;  1ILO A;  1PL1 A;  2VM1 A;  1PN9 A;  2IIY A;  1OC8 A;  3A2X A;  2YJH A;  3UVT A;  4DEJ A;  5B6N A;  1TRS A;  1EP8 A;  2HT9 A;  3F4T A;  5B8A A;  2CZ3 A;  4WEY A;  1XWK A;  4OMV A;  13GS A;  2KLX A;  3I69 A;  4IKH A;  1BYE A;  2I9H A;  3HHV A;  1M0U A;  1XPV A;  1HNA A;  2PBJ A;  4EO3 A;  4K7I A;  3CMI A;  4TN8 A;  3C1S A;  2B5Y A;  4H86 A;  4I8B A;  5GST A;  3PR8 A;  3CRU A;  2CA8 A;  4PNG A;  5CP1 A;  2DC5 A;  1R5P A;  3VPT A;  3GKN A;  1JZR A;  5CRD A;  4HU7 A;  2AHE A;  1LBK A;  1URM A;  4V1A g;  3ZYW A;  2YOI A;  5DDL A;  3K8N A;  3DYR A;  4K7O A;  1X9W B;  2MMO A;  1OE7 A;  2GT5 A;  1OAZ A;  3P8W A;  3KZQ A;  3LWA A;  1K0O A;  3GRX A;  2FNO A;  2H66 A;  5ECM B;  3KCM A;  1A8L A;  3ED3 A;  3IK7 A;  3EYT A;  4MCU A;  3GH9 A;  1YEP A;  2R4V A;  4V2L A;  1FB6 A;  3PIN A;  2WS2 A;  4E8H A;  3GMF A;  4IJ3 A;  5B6M A;  4V2M A;  3IR4 A;  5HFI A;  3A3T A;  3BD2 A;  1W89 A;  1OC3 A;  1TI3 A;  4ZIJ A;  3ME8 A;  1NW2 A;  3J7Y k;  1JZD A;  3H8Q A;  4TXO A;  4ZB9 A;  1GUL A;  1FHE A;  1GTB A;  3C7M A;  3DXB A;  3QR6 A;  4ZB8 A;  2EC4 A;  2VCT A;  2YCD A;  3BJ5 A;  3FZA A;  1XW5 A;  4BWS A;  1SL0 B;  4PQI A;  2WJU A;  2P31 A;  2PWJ A;  1I9D A;  3D4T A;  5AIV A;  5KEJ A;  2ON5 A;  1GLP A;  1A0F A;  2TIR A;  2N5F A;  2QKE A;  3HZ8 A;  1FOV A;  3TOU A;  2IME A;  4F82 A;  4NV2 A;  3A2W A;  2VO4 A;  3UJ1 A;  4MF6 A;  6GSY A;  3ZTL A;  1Q4J A;  4JE1 A;  1X9S B;  4K8M A;  1ACV A;  3ZMK A;  3HJM A;  1Q98 A;  2CV4 A;  4HZ4 A;  1U3I A;  1R5A A;  2H76 A;  2IL3 A;  2B3S A;  2C80 A;  2GZP A;  4KAE A;  1GTA A;  5G1L A;  3HJP A;  4DSQ A;  4GST A;  4GSN A;  1BJX A;  4DSS B;  2RII A;  4KX4 A;  2BMX A;  3TKS C;  3VWU A;  2P0G A;  2MBT A;  4I2U A;  4XRD A;  2IWT A;  2ON7 A;  3WT2 A;  2HZE B;  1THO A;  1SD8 A;  3GYK A;  5JCG A;  5EY6 A;  4YAP A;  1PA3 A;  4FH8 A;  1MDI A;  1A24 A;  5ELA A;  3IC4 A;  3QD9 A;  1ZOF A;  4TXV A;  5EVO A;  2RM5 A;  1XWA A;  3QOU A;  3C71 A;  2H6X A;  2YAN A;  2IMF A;  3GTU B;  5ELG A;  1G6W A;  5IM9 A;  4Q5N A;  4WXT A;  1EP7 A;  4ILF A;  1V98 A;  12GS A;  1SU9 A;  4ECB A;  4PXO A;  1Y6E A;  3US3 A;  2VLV A;  2YPM A;  2LRT A;  2ES7 A;  2EIR A;  3IK9 A;  4MPF A;  1PKW A;  2L57 A;  2FWF A;  3KMN A;  2VLU A;  3APQ A;  3LG6 A;  2PER A;  1WRY A;  4GSS A;  4DSS A;  4MJB A;  2B1L A;  5INY A;  5CNW A;  3A2V A;  2X8C A;  2HZE A;  1J9B A;  2DLX A;  3G7I A;  4IP6 A;  1WPI A;  2NBS A;  4IBP A;  1DUG A;  4MDC A;  2H1B A;  1A8Y A;  4JED A;  1F9M A;  1VF3 A;  2YV9 A;  4POL A;  2QC7 A;  2CVB A;  2IJY A;  2K18 A;  3KD0 A;  5DCH A;  2IMI A;  2VD1 A;  4DVC A;  3ZRD A;  5HQP A;  5CRG A;  1PRX A;  3F3Q A;  3LQ7 A;  3IBH A;  4JBB A;  2H01 A;  4IHU A;  3GV1 A;  4O32 A;  1ZGN A;  4G10 A;  1TU8 A;  1V40 A;  1DE1 A;  3EU3 A;  2HSY A;  4DSR A;  3HA9 A;  2X8G A;  1SJZ A;  1O85 A;  1ZYQ B;  1RW1 A;  1ST9 A;  2LS5 A;  4KH7 A;  1BQ7 A;  4WF4 A;  2OAD A;  2HLS A;  4OD7 A;  1SK0 A;  3E9J B;  5D73 A;  4K0G A;  5JWO B;  2H6Y A;  2AV4 A;  4J56 E;  3EIN A;  3M1G A;  1BX9 A;  5DAK A;  3TKS E;  5HR0 A;  4K0N A;  2YWI A;  1XVW A;  4EKZ A;  3QMX A;  2OBK A;  1SYR A;  4Q5R A;  2GZY A;  1TTZ A;  4OO4 A;  2AJQ B;  3FK8 A;  4IGJ A;  1QUW A;  2WDU A;  4WKW A;  4MAB A;  3O76 A;  4EE0 A;  3VLN A;  4F03 A;  5H5S A;  3P90 A;  3P2A A;  4AJ8 A;  1OKT A;  3TKR A;  5HR2 A;  1JFU A;  3F6F A;  5A4W A;  1FO5 A;  3NOF A;  2R6K A;  2GDR A;  1BAY A;  3M9J A;  5KN3 A;  5DVB A;  4X0X A;  2RUF A;  4MH2 A;  3D22 A;  2R3X A;  2WB9 A;  4PNF A;  4YAV A;  2DJK A;  1DE2 A;  3A5W A;  1F3A A;  2O7K A;  4KDX A;  5A4V A;  4TVE A;  2B7J A;  1AC1 A;  2YWN A;  1XIY A;  5F05 A;  2C1Y A;  3LFL A;  5IMD A;  4WET A;  1J0F A;  3QAV A;  3E3E A;  3GX0 A;  4JRR A;  3KXO A;  3Q19 A;  2H0G A;  1XZO A;  3W6G A;  6GSU A;  4KB3 A;  1THX A;  1B48 A;  5IMV A;  5J3R A;  3LXT A;  1U88 A;  2L59 A;  5HR3 A;  1OKD A;  2XPD A;  2R2J A;  3L0H A;  4POM A;  1A0R P;  1E2Y A;  1XOA A;  1AQX A;  1M9B A;  5ECL B;  2TRC P;  4GWR A;  4X43 A;  1SKS B;  2IFQ B;  3HVS A;  5DCG A;  2GQM A;  4HJ2 A;  5DQY A;  5H5R A;  1O81 A;  4MA9 A;  1PGT A;  1YY7 A;  1H4O A;  1C72 A;  5G31 A;  5IMF A;  1Z7P A;  3M0F A;  2VCW A;  3H93 A;  1H75 A;  1TXX A;  4G2E A;  2VL3 A;  4FYC A;  3DRN A;  1EV4 A;  2DIY A;  1UN2 A;  1EOG A;  1MTC A;  1SD9 A;  4XS4 B;  2F8F A;  2KOK A;  5AGY A;  1ZCP A;  1TP9 A;  1EZK A;  1JZO A;  1M2B A;  3FR9 A;  3ZVJ A;  2H1D A;  3CYN A;  3KJY A;  4MK3 A;  2VL2 A;  3DD3 A;  2I3Y A;  4KDY A;  2M80 A;  1AIU A;  3TCO A;  4EC0 A;  2LKU A;  1AW9 A;  4FO5 A;  4HEA 2;  2H72 A;  2IMD A;  1MDJ A;  3TJF A;  1BG5 A;  1A2M A;  1O73 A;  1ERV A;  2IFQ A;  3RHB A;  4IJI A;  1G7O A;  3IAS 2;  2H1A A;  3EE2 A;  3JCM L;  4O5R A;  1A23 A;  2OA7 A;  4HJM A;  5DJM A;  4XIH A;  5AIX A;  3BBY A;  2C3Q A;  1R7H A;  5G30 A;  2L6D A;  1QFN A;  4LMW A;  4Q5Q A;  1S3A A;  4XHM A;  1Z7R A;  3QDN A;  3VFI A;  2M72 A;  5IIZ A;  3TRP A;  3ZIV A;  2X8H A;  2JAD A;  4KDU A;  5C04 A;  4XS4 A;  3HY2 A;  3F63 A;  2CZ2 A;  2CAQ A;  2YV7 A;  2C0F A;  3I6A A;  2GSS A;  3FEU A;  5DAL A;  2FCH A;  1EV9 A;  2OE3 A;  3ZL5 A;  3D0Z A;  3UL3 A;  1F6M C;  1U87 A;  1GSU A;  2VCQ A;  4Z7X A;  2LJR A;  1GSE A;  5E4W A;  2I81 A;  4LL1 B;  2C0D A;  1FVJ A;  3GA4 A;  3IE3 A;  4HI7 A;  1T1V A;  3GKM A;  1OYJ A;  2YZU A;  3Q6O A;  3DGQ A;  3FYG A;  2H73 A;  2YP6 A;  4MZC A;  3BCK A;  1SYX A;  5EPF A;  1V2A A;  1YKC A;  4NHZ A;  4ZB6 A;  3UOM A;  3MAK A;  5C00 A;  5F06 A;  1GSY A;  1Y25 A;  2LUS A;  1K3L A;  1ZMA A;  3CSI A;  3KEB A;  4WR5 A;  7GSS A;  4K6X A;  1K3Y A;  1YZX A;  3CSJ A;  2NPB A;  2HI7 A;  2VCX A;  3GST A;  3LYK A;  4IS0 A;  1Z6M A;  2YWM A;  2ZNM A;  2GSR A;  4GQC A;  2KHP A;  18GS A;  1LU4 A;  5B7C A;  4KW6 A;  3SWL A;  4V1A p;  3CTG A;  5LD0 A;  2B5X A;  1CQH A;  2AB6 A;  4YQV A;  4N11 A;  2ALB A;  3L9V A;  4KSM A;  4ML1 A;  3EU4 A;  5ECR B;  3LSZ A;  3OR5 A;  1TJD A;  2B1K A;  1K0A A;  4LMV A;  1B4P A;  5CO3 A;  1GSQ A;  5ECO B;  1HD2 A;  1T4Z A;  2BJX A;  3GNJ A;  1GLQ A;  3IDV A;  3FZ5 A;  3DIE A;  4HS1 A; 
#chains in the Genus database with same CATH topology
 3TOT A;  4L0U A;  3QAG A;  4MZB A;  1QQ2 A;  4GXZ A;  2GT6 A;  1X5E A;  1Z9H A;  4TR3 A;  3N5O A;  2KUC A;  3L78 A;  3I43 A;  4ID0 A;  3F4R A;  3RAZ A;  1SK2 A;  4N10 A;  2OE1 A;  1EEM A;  2VCZ A;  2FWE A;  5D96 A;  2V1M A;  4YQM A;  2IPA A;  3VPQ A;  2OJL A;  4YQU A;  1GNE A;  5G1K A;  3G9B A;  4IQ1 A;  3MIX A;  4L5O A;  3UAR A;  1F3B A;  2HXK A;  3IRA A;  4RI7 A;  2FD3 A;  5AN1 A;  4Z2U A;  2C8U A;  1Z5Y E;  3NIV A;  3KTL A;  3BCI A;  1S3D A;  4EDZ A;  1MD4 A;  2K9F A;  5EL8 A;  3EMP A;  4EDY A;  4IN0 A;  2XPE A;  3R2Q A;  2O87 A;  3TJK A;  1TK5 B;  4HZ2 A;  2B7K A;  1WIK A;  4J57 E;  2C3N A;  4QL7 A;  11GS A;  1K0N A;  2H6Z A;  4PX1 A;  3HCZ A;  22GS A;  3DML A;  4PUF C;  3RHC A;  2L5L A;  3Q18 A;  3GFK A;  4KCA A;  1X5D A;  2RLI A;  5IMZ A;  4PUR A;  2R0P A;  4F2I A;  2D2Z A;  1TK8 B;  5JCU A;  1R26 A;  2I4A A;  5D93 A;  3FW2 A;  4OFT A;  5J4U A;  2CQ9 A;  2FY6 A;  5IOX A;  5J9B A;  4ML6 A;  3HKR A;  2I1U A;  1SJ6 A;  4GLT A;  4K5R A;  2GGT A;  4K7N A;  2YZH A;  5CYY A;  5KN2 A;  2NDO A;  4GCI A;  2FWG A;  4MJA A;  1VRS D;  5G5E A;  1ERU A;  5GAP D;  3KGK A;  3KH7 A;  3QCP A;  4HOJ A;  2H30 A;  4A5P A;  1X0R A;  3WT1 A;  4X4J A;  3UEM A;  1Z3E A;  4I6X A;  4P3Y B;  1ZYN A;  2C4J A;  4G9H A;  2H0H A;  3GKX A;  5ECH B;  1ERW A;  3EC3 A;  2LTK A;  3FZ4 A;  2CT6 A;  1MDK A;  2XBI A;  6GSW A;  5IO2 A;  1WP0 A;  3GTU A;  4POB A;  1HQO A;  2IMK A;  3CBU A;  4HU9 A;  1ABA A;  1WOU A;  2REM A;  4ZBB A;  3W8J A;  4PQ1 A;  4AJ6 A;  1WJK A;  2E2G A;  4PQH A;  1GH2 A;  4BVY A;  4CDO A;  4CW9 A;  4F0B A;  5LCZ A;  1X9M B;  5G2Z A;  3LYP A;  5A4U A;  2JZR A;  4ZL9 A;  2V6O A;  5CRE A;  3F6D A;  3G7Y A;  2JSY A;  3QFB C;  4BPY A;  1PFO A;  1FG4 A;  2X49 A;  1SJI A;  4OO5 A;  5KOX A;  1MEK A;  4JR4 A;  2BTO T;  1K0M A;  3TJJ A;  3H1N A;  4XS1 A;  5B8B A;  3ZFL A;  3TJB A;  2DJ3 A;  1XOB A;  1AUC A;  5JCW A;  2PPT A;  3UIW A;  1O8X A;  1B9X C;  3TRX A;  6GSS A;  2K6V A;  3APS A;  2LV3 A;  5F8B A;  2YJ7 A;  4GQF A;  1VF2 A;  2PMT A;  4POK A;  2K8S A;  2P5Q A;  1K3O A;  1CQG A;  4I5Q A;  4HQS A;  4KSO A;  2MYG A;  4NXI A;  2AUV A;  3UBK A;  2DMM A;  5J5N A;  2GQL A;  3TGZ A;  5F0G A;  2H19 A;  2MMN A;  2GST A;  3IHQ A;  4WR4 A;  4J2F A;  3U5R E;  5FHI A;  5J9C A;  4TW5 A;  3ERG A;  3G7J A;  3N9J A;  2KP1 A;  2O8V B;  5FT3 A;  4FYU A;  3ZVJ D;  2G0F A;  4HQZ A;  4ZL7 A;  5JWQ B;  2OBI A;  4QQ7 A;  3VK9 A;  4JU5 A;  5BMU A;  5IQY A;  1PX7 A;  4Z2T A;  4F0C A;  1GNW A;  2K8V A;  5D8I A;  3VI5 A;  1PL2 A;  3KTB A;  4PTS A;  1TK0 B;  1M2A A;  1F37 A;  2V41 A;  2M46 A;  9GSS A;  3ZLP A;  2L4C A;  5ECP B;  2VL2 C;  5DJL A;  1O8W A;  1QXH A;  3DWV A;  1TI1 A;  4MF5 A;  4AJ7 A;  1O7U A;  2AAW A;  3VWW A;  1K0D A;  2LST A;  2CVD A;  4V2N A;  1DBY A;  4O5U A;  2C0E A;  3KIJ A;  1GWC A;  4MLY A;  1NHO A;  1VGL A;  4IQA A;  2VL9 A;  3HVN A;  2IN3 A;  2DJJ A;  17GS A;  3WGE A;  3LW9 A;  1PX6 A;  1M2D A;  1M7T A;  1LJR A;  1MD3 A;  3A5I A;  2A2R A;  1WWJ A;  2VM2 A;  3QFA C;  3BOA A;  1GP1 A;  1TRW A;  1WMJ A;  5IPG A;  4MJC A;  2O85 A;  3VUR A;  4OFN A;  1FAA A;  1JLW A;  3FRC A;  3TKQ A;  3DVW A;  1G7E A;  1I5G A;  4BIK A;  3F8U A;  2Z9S A;  3CSH A;  2HSH A;  4BVX B;  2AYT A;  4RQR A;  3KP9 A;  2HZF A;  3IA1 A;  3LJR A;  2JSZ A;  5ECK B;  2J9H A;  1XWB A;  4ZL8 A;  3H4K A;  1V58 A;  2LNS A;  4QL9 A;  1NSW A;  1T3B A;  1FB0 A;  4ZXG A;  4EIP A;  4YH2 A;  4EVM A;  3GKK A;  5HFK A;  3IAM 2;  4ZBA A;  1VF1 A;  4NHW A;  1GTI A;  3F9U A;  2RUE A;  2DBC A;  2OKA A;  3MSZ A;  3M9K A;  3ERF A;  4IW9 A;  3EPT A;  4MJE A;  1XWG A;  1K0C A;  3TUE A;  3GUR A;  1SL1 B;  3MWH A;  4KGI A;  4N0Z A;  3HZ4 A;  2GZZ A;  2GSQ A;  3Q74 A;  3TJG A;  4ISD A;  1FOH A;  5D9V A;  4RQX A;  3J7Y b;  3FZ9 A;  5IOW A;  2WUL A;  3DEX A;  3HJO A;  3ZIT A;  4HDE A;  2VCV A;  2J23 A;  1RK4 A;  3I9V 2;  3L9S A;  1AXD A;  3EMX A;  2PVQ A;  2LEG A;  3PH9 A;  4LL4 B;  4BVX A;  3ISO A;  1YKA A;  3ZFB A;  5HR1 A;  1XW9 A;  4MZW A;  2O89 A;  2V32 A;  3D4M A;  2MMA A;  2VOC A;  3TB2 A;  8GSS A;  2CX4 A;  4BWQ A;  3F0I A;  2HFD A;  2H71 A;  4I97 A;  2GQK A;  3EUR A;  5D9W A;  2H70 A;  3UMA A;  4ZBD A;  4TXO B;  3MNG A;  2N5B A;  1T8E B;  2L4Q A;  2DJ0 A;  1O6J A;  4BA7 A;  5IMA A;  5GZZ B;  4JZQ A;  3TDG A;  3QAW A;  2OE0 A;  4OFM A;  4K9Z A;  1TOF A;  3TRQ A;  1HNC A;  3O6T A;  2MZC A;  1VF4 A;  3IOS A;  4MF7 A;  1TRU A;  14GS A;  4G0K A;  1FW1 A;  1N8J A;  2RM6 A;  3U6V A;  2GTU A;  4G19 A;  4BL7 B;  2QGV A;  1EGR A;  2WFC A;  3P7X A;  3KMO A;  3CTF A;  1E6B A;  4PUA A;  2V2G A;  2DJ1 A;  1EWX A;  3ZZX A;  4AF2 A;  5IPH A;  1PD2 1;  4FIW A;  3W8S A;  1B4Q A;  4D73 B;  4TR1 B;  1UVZ A;  3IV4 A;  2A2S A;  3V1W A;  5ABR A;  19GS A;  3F4S A;  4FYB A;  2R5G A;  3KP8 A;  1GTU A;  2HE3 A;  5J41 A;  2FHE A;  1PQN A;  4CY8 A;  4MPG A;  1OC9 B;  3CXG A;  2L5O A;  4K2X A;  1ZYE A;  3KH9 A;  1G0T A;  2DJ2 A;  2PUK C;  5H5Q A;  1V9W A;  2H1G A;  1S3C A;  16GS A;  4AGS A;  1USB A;  1XWC A;  2LJK A;  4Q5F A;  3UBL A;  5ID2 B;  1FVK A;  1UA5 A;  4BL7 A;  2FWH A;  2XC2 A;  10GS A;  1UC7 A;  4KA0 A;  1U6T A;  3QPM A;  4CHS A;  1XBS A;  3DVX A;  5CRH A;  2FA8 A;  2B5E A;  3C8E A;  2CVK A;  1QMV A;  4MH3 A;  4PGT A;  5DBQ A;  4TOP A;  3TKP A;  2LRC A;  3ZML A;  4D73 A;  1JZW A;  4TR1 A;  3ZRE A;  4KUN A;  6GST A;  4NV5 A;  1XXU A;  2C0G A;  1SKW B;  5JWR B;  4OCE A;  1WE0 A;  5CAX A;  1J08 A;  3FKF A;  2F9S A;  2JL4 A;  4K5S A;  4NAX A;  1QK8 A;  3RDW A;  2CX3 A;  1OC9 A;  5ECI B;  4MNN A;  3FR6 A;  1G6Y A;  1RQM A;  2LJA A;  2VIM A;  2WGR A;  1ML6 A;  3FY7 A;  1KTE A;  5FWG A;  5IMC A;  4XTS A;  3ME7 A;  2HRA A;  5ID2 A;  2LRN A;  2TRX A;  4JR6 A;  2A4H A;  4K2D A;  3GHA A;  5A5K A;  1GSF A;  1SKR B;  3AY8 A;  1TW9 A;  2WRT A;  3WGX A;  3NZN A;  1SEN A;  2MMZ A;  1SL2 B;  1EGO A;  5ECN B;  5HFG A;  3TKS A;  3D21 A;  2ZCT A;  1EOH A;  1AQV A;  4MMM A;  2VLT A;  4TR4 A;  1T00 A;  2PN8 A;  3KM6 A;  1XW6 A;  4RUV A;  1JLV A;  1AQW A;  2HYX A;  1XFL A;  5DAK B;  5GSS A;  1XCC A;  2HNL A;  3LEF A;  5LNK e;  2FLS A;  2DIZ A;  1KEB A;  2KP2 A;  2ZUP A;  3HDC A;  1B8X A;  4GTU A;  3L9U A;  2PGT A;  2YWO A;  4ZIL A;  1R4W A;  5E59 A;  4L5L A;  4EL1 A;  5DQS A;  2A4V A;  1ZZY A;  3GL3 A;  3CQF A;  4N0V A;  1YJ6 A;  3UAP A;  2F3M A;  4EF0 A;  1QGV A;  2N5A A;  3MDK A;  1YF1 A;  4LLR A;  3C73 A;  4OCF A;  1GUK A;  5GAN D;  4EIQ A;  1KBN A;  2JZT A;  3LOR A;  1GL8 A;  4E8E A;  4O7H A;  1B9Y C;  3GX8 A;  1PMT A;  3DKS A;  3HVX A;  3HVV A;  3WD6 A;  5KN1 A;  1GRX A;  1U3A A;  1W4V A;  3GN3 A;  2G2Q A;  2V6K A;  4OWY A;  1M3J A;  3FR3 A;  3GUS A;  2YN1 A;  3LXZ A;  3E0U A;  2X4A A;  1XVQ A;  2DSA A;  1N2A A;  1ERT A;  2XBQ A;  2F8A A;  5AIS A;  4EUY A;  2H0I A;  3O3T A;  2HRN A;  2CAI A;  1PKZ A;  1YF0 A;  3VWV A;  4X1U A;  5G5F A;  3HYP A;  4ULX A;  4KCE A;  3WGD A;  2E0Q A;  1A2L A;  1ON4 A;  3M8N A;  5D9T A;  3IHG A;  5F07 A;  4N30 A;  5IO0 A;  4NWY A;  3IC8 A;  1T7P B;  5ENU A;  4L0W A;  2E7P A;  4KE3 A;  2GLR A;  3PPU A;  1GUM A;  3RBT A;  4NPB A;  1KNG A;  1YEX A;  1PSQ A;  1TKD B;  1TRV A;  2H75 A;  4O92 A;  1TU7 A;  1DSB A;  1V57 A;  2FUG 2;  3RPN A;  2NTO A;  3F3R A;  3GIX A;  2JZS A;  4IEL A;  3ERW A;  2VUP A;  1YDK A;  1TDI A;  4F9Z A;  4WF5 A;  1X5C A;  4GRF A;  2JU5 A;  2LQQ A;  3EWL A;  4NMU A;  4WBJ A;  1GUH A;  3GH6 A;  3SBC A;  1EEJ A;  1GSS A;  2GS3 A;  1NM3 A;  1F2E A;  3WYW A;  2E2M A;  1IYI A;  2EIO A;  6GSX A;  6GSV A;  1M9A A;  2WCI A;  4ECJ A;  5D9X A;  4I2T A;  5ECS A;  4ECI A;  3IPZ A;  1ZL9 A;  3APO A;  3VI7 A;  1OVN A;  4KND A;  1BED A;  2B6M A;  4TRX A;  4XRA A;  3HD5 A;  1IYH A;  4TKY A;  3RPP A;  4ECC A;  1OE8 A;  4IVF A;  2EIQ A;  3ZIJ A;  1K0B A;  2PVO C;  1NHY A;  3M3M A;  1M99 A;  2R37 A;  2VAF A;  2PU9 C;  2LQO A;  5CRW A;  4RI6 A;  2YNX A;  4XS6 A;  4TR0 A;  20GS A;  2F51 A;  4WBR D;  1SK1 A;  2GVP A;  1Z6N A;  2HRF A;  3LGC A;  2MBS A;  3PGT A;  1JHB A;  3S9F A;  1GSD A;  3HXS A;  3UVH A;  4K1F A;  3D6I A;  4EXJ A;  3CRT A;  1A2J A;  3VWX A;  2OAC A;  3FMW A;  2FGX A;  2P5R A;  5KN0 A;  4HSC X;  2H8L A;  1AAZ A;  2X99 A;  2WZ9 A;  2QSI A;  2XHF A;  2NVL A;  3D5J A;  5DAL B;  2JAC A;  1HNB A;  4L8E A;  1YQ1 A;  3GL5 A;  2L6C A;  4IP1 A;  3EVI A;  2LNT A;  2C3T A;  3FHK A;  5COH A;  5L71 A;  3C1R A;  4GF0 A;  4ACS A;  4MP4 A;  3L4N A;  2VD0 A;  1T4Y A;  4XCS A;  2FA4 A;  3H79 A;  2X64 A;  4LA1 A;  2DML A;  2H74 A;  1HYU A;  3GSS A;  3IXR A;  4HUA A;  5ECQ B;  1ILO A;  1PL1 A;  2VM1 A;  1PN9 A;  2DKI A;  2IIY A;  1OC8 A;  3A2X A;  2YJH A;  3UVT A;  4DEJ A;  5B6N A;  1TRS A;  1EP8 A;  2HT9 A;  4G0L A;  3F4T A;  5B8A A;  2CZ3 A;  4WEY A;  1XWK A;  4OMV A;  13GS A;  2KLX A;  3I69 A;  4IKH A;  1BYE A;  2UZ8 A;  2I9H A;  3HHV A;  1M0U A;  1XPV A;  1HNA A;  2PBJ A;  4EO3 A;  4K7I A;  3CMI A;  4TN8 A;  3C1S A;  2B5Y A;  4H86 A;  4I8B A;  5GST A;  3PR8 A;  3CRU A;  2CA8 A;  4PNG A;  5CP1 A;  2DC5 A;  1R5P A;  3VPT A;  3GKN A;  1JZR A;  4USS A;  5CRD A;  4HU7 A;  2AHE A;  1LBK A;  1URM A;  4V1A g;  3ZYW A;  2YOI A;  5DDL A;  3K8N A;  3DYR A;  4K7O A;  1X9W B;  1ZYP A;  2MMO A;  5KOW A;  1OE7 A;  2GT5 A;  1OAZ A;  3P8W A;  3KZQ A;  3LWA A;  1K0O A;  3GRX A;  2FNO A;  2H66 A;  5ECM B;  3KCM A;  1A8L A;  4ICY A;  3R3E A;  3ED3 A;  3IK7 A;  3EYT A;  2A2P A;  4MCU A;  3GH9 A;  1YEP A;  2R4V A;  4V2L A;  1FB6 A;  3PIN A;  2WS2 A;  4E8H A;  4Z2R A;  3GMF A;  4IJ3 A;  5B6M A;  4V2M A;  3IR4 A;  5HFI A;  5BRT A;  3A3T A;  3BD2 A;  1W89 A;  1OC3 A;  1TI3 A;  4YKG A;  4ZIJ A;  3ME8 A;  1NW2 A;  3J7Y k;  1JZD A;  3H8Q A;  4TXO A;  4ZB9 A;  1GUL A;  1FHE A;  1GTB A;  3C7M A;  3DXB A;  3QR6 A;  4ZB8 A;  2EC4 A;  2VCT A;  2YCD A;  3BJ5 A;  3FZA A;  1XW5 A;  4BWS A;  1SL0 B;  4PQI A;  2WJU A;  2P31 A;  2PWJ A;  1I9D A;  3D4T A;  5AIV A;  5KEJ A;  2ON5 A;  1GLP A;  1A0F A;  2TIR A;  2N5F A;  2QKE A;  3HZ8 A;  1FOV A;  3TOU A;  2IME A;  4F82 A;  4NV2 A;  3A2W A;  2VO4 A;  3UJ1 A;  4MF6 A;  6GSY A;  3ZTL A;  1Q4J A;  4JE1 A;  1X9S B;  4K8M A;  1ACV A;  3ZMK A;  3HJM A;  1Q98 A;  2CV4 A;  4HZ4 A;  1U3I A;  1R5A A;  2H76 A;  2IL3 A;  2B3S A;  2C80 A;  2GZP A;  4KAE A;  1GTA A;  5G1L A;  3HJP A;  4DSQ A;  2HSM A;  4GST A;  4GSN A;  1BJX A;  4DSS B;  2RII A;  4KX4 A;  2BMX A;  3TKS C;  3VWU A;  2P0G A;  2MBT A;  4I2U A;  4XRD A;  2IWT A;  2ON7 A;  3WT2 A;  2HZE B;  1THO A;  1SD8 A;  3GYK A;  5JCG A;  5EY6 A;  4YAP A;  1PA3 A;  4FH8 A;  1MDI A;  1A24 A;  5ELA A;  3IC4 A;  3QD9 A;  1ZOF A;  4TXV A;  2R0C A;  2RM5 A;  5EVO A;  2DKH A;  1XWA A;  3QOU A;  3C71 A;  2H6X A;  2YAN A;  2IMF A;  3GTU B;  5ELG A;  1G6W A;  5IM9 A;  4Q5N A;  4WXT A;  1EP7 A;  4ILF A;  1V98 A;  12GS A;  1SU9 A;  4ECB A;  4PXO A;  1Y6E A;  3US3 A;  2VLV A;  2YPM A;  2LRT A;  4BVY B;  4G0I A;  1PN0 A;  2ES7 A;  2EIR A;  3IK9 A;  4MPF A;  1PKW A;  2L57 A;  2FWF A;  3KMN A;  2VLU A;  3APQ A;  3LG6 A;  2PER A;  1WRY A;  4GSS A;  4DSS A;  4MJB A;  2B1L A;  5INY A;  5CNW A;  3A2V A;  2X8C A;  2HZE A;  1J9B A;  2DLX A;  3G7I A;  4IP6 A;  1WPI A;  2NBS A;  4IBP A;  1DUG A;  4MDC A;  2H1B A;  1A8Y A;  4JED A;  1F9M A;  1VF3 A;  2YV9 A;  4POL A;  2QC7 A;  2CVB A;  2IJY A;  2K18 A;  3KD0 A;  5DCH A;  2IMI A;  2VD1 A;  4DVC A;  3ZRD A;  5HQP A;  5CRG A;  1PRX A;  3F3Q A;  3LQ7 A;  3IBH A;  4JBB A;  2H01 A;  4IHU A;  3GV1 A;  4O32 A;  1ZGN A;  4G10 A;  1TU8 A;  1V40 A;  1DE1 A;  3EU3 A;  2HSY A;  4DSR A;  3HA9 A;  2X8G A;  1SJZ A;  1O85 A;  1ZYQ B;  1RW1 A;  1ST9 A;  2LS5 A;  4KH7 A;  1BQ7 A;  4WF4 A;  2OAD A;  2HLS A;  4OD7 A;  1SK0 A;  3E9J B;  5D73 A;  4K0G A;  5JWO B;  2H6Y A;  2AV4 A;  4J56 E;  2QA2 A;  3EIN A;  3M1G A;  1BX9 A;  5DAK A;  3TKS E;  5HR0 A;  4K0N A;  2YWI A;  1XVW A;  4EKZ A;  3QMX A;  2OBK A;  1SYR A;  4Q5R A;  2GZY A;  1TTZ A;  4OO4 A;  2AJQ B;  3FK8 A;  4IGJ A;  1QUW A;  2WDU A;  4WKW A;  4MAB A;  3O76 A;  4EE0 A;  3VLN A;  4F03 A;  5H5S A;  3P90 A;  3P2A A;  4AJ8 A;  1OKT A;  3TKR A;  5HR2 A;  1JFU A;  3F6F A;  5A4W A;  1FO5 A;  3NOF A;  2R6K A;  2GDR A;  1BAY A;  3M9J A;  5KN3 A;  5DVB A;  4X0X A;  2RUF A;  4MH2 A;  3D22 A;  2R3X A;  2WB9 A;  4PNF A;  4YAV A;  2DJK A;  1DE2 A;  3A5W A;  1F3A A;  2O7K A;  4KDX A;  5A4V A;  1M3I A;  4TVE A;  2B7J A;  2HRK A;  1AC1 A;  2YWN A;  1XIY A;  5F05 A;  2C1Y A;  4FQU A;  3LFL A;  5IMD A;  4WET A;  1J0F A;  3QAV A;  3E3E A;  3GX0 A;  4JRR A;  3KXO A;  3Q19 A;  2H0G A;  1XZO A;  3W6G A;  6GSU A;  4KB3 A;  4YKF A;  1THX A;  1B48 A;  5IMV A;  5J3R A;  3LXT A;  1U88 A;  2L59 A;  5HR3 A;  1OKD A;  2XPD A;  2R2J A;  3L0H A;  4POM A;  1S3R A;  1A0R P;  1E2Y A;  1XOA A;  1AQX A;  1M9B A;  5ECL B;  4KF9 A;  2TRC P;  4GWR A;  4X43 A;  1SKS B;  2IFQ B;  3HVS A;  5DCG A;  2GQM A;  4HJ2 A;  5DQY A;  5H5R A;  1O81 A;  4MA9 A;  1PGT A;  1YY7 A;  1H4O A;  1C72 A;  5G31 A;  5IMF A;  1Z7P A;  3M0F A;  2R0G A;  2VCW A;  3H93 A;  1H75 A;  1TXX A;  4G2E A;  2VL3 A;  4FYC A;  3DRN A;  1EV4 A;  2DIY A;  1UN2 A;  1EOG A;  1MTC A;  1SD9 A;  4XS4 B;  2F8F A;  2KOK A;  5AGY A;  1ZCP A;  1TP9 A;  1EZK A;  1JZO A;  1M2B A;  3FR9 A;  3ZVJ A;  2H1D A;  3CYN A;  3KJY A;  4MK3 A;  2VL2 A;  3DD3 A;  2I3Y A;  4KDY A;  2M80 A;  1AIU A;  3TCO A;  4EC0 A;  2LKU A;  1AW9 A;  4FO5 A;  4HEA 2;  2H72 A;  2IMD A;  1MDJ A;  3TJF A;  1BG5 A;  1A2M A;  1O73 A;  1ERV A;  2IFQ A;  3RHB A;  4IJI A;  1G7O A;  3IAS 2;  2H1A A;  3EE2 A;  3JCM L;  4O5R A;  1A23 A;  2OA7 A;  4HJM A;  5DJM A;  4XIH A;  5AIX A;  3BBY A;  2C3Q A;  1R7H A;  5G30 A;  2L6D A;  1QFN A;  4LMW A;  4Q5Q A;  2QA1 A;  1S3A A;  4XHM A;  1Z7R A;  3QDN A;  3VFI A;  2M72 A;  5IIZ A;  3TRP A;  3ZIV A;  2X8H A;  1XG8 A;  2JAD A;  4KDU A;  5C04 A;  4XS4 A;  3HY2 A;  3F63 A;  2CZ2 A;  2CAQ A;  2YV7 A;  4O5Q A;  2C0F A;  3I6A A;  2GSS A;  3FEU A;  5DAL A;  2FCH A;  1EV9 A;  2OE3 A;  3ZL5 A;  3D0Z A;  3UL3 A;  1F6M C;  1U87 A;  1GSU A;  2VCQ A;  4Z7X A;  2LJR A;  1GSE A;  5E4W A;  2I81 A;  4LL1 B;  2C0D A;  1FVJ A;  3GA4 A;  3IE3 A;  4HI7 A;  1T1V A;  3GKM A;  4CY6 A;  1OYJ A;  2YZU A;  3Q6O A;  3DGQ A;  3FYG A;  2H73 A;  2YP6 A;  4MZC A;  3BCK A;  1SYX A;  5EPF A;  1V2A A;  1YKC A;  4NHZ A;  4ZB6 A;  3UOM A;  3MAK A;  5C00 A;  5F06 A;  1GSY A;  1Y25 A;  2LUS A;  1K3L A;  1ZMA A;  3CSI A;  3KEB A;  4WR5 A;  7GSS A;  4K6X A;  1K3Y A;  1YZX A;  3CSJ A;  2NPB A;  2HI7 A;  2VCX A;  3GST A;  3LYK A;  4IS0 A;  1Z6M A;  2YWM A;  2ZNM A;  2GSR A;  4GQC A;  2KHP A;  18GS A;  1LU4 A;  5B7C A;  4KW6 A;  3SWL A;  4V1A p;  3CTG A;  5LD0 A;  2B5X A;  1CQH A;  2AB6 A;  4YQV A;  4N11 A;  2ALB A;  3L9V A;  4KSM A;  4ML1 A;  3EU4 A;  5ECR B;  3LSZ A;  3OR5 A;  1TJD A;  2B1K A;  1K0A A;  4LMV A;  3MYD A;  1B4P A;  5CO3 A;  1GSQ A;  5ECO B;  1HD2 A;  1T4Z A;  2BJX A;  3GNJ A;  1GLQ A;  3IDV A;  3FZ5 A;  3DIE A;  4HS1 A; 
#chains in the Genus database with same CATH homology
 3TOT A;  4L0U A;  3QAG A;  4MZB A;  1QQ2 A;  4GXZ A;  2GT6 A;  1X5E A;  1Z9H A;  4TR3 A;  3N5O A;  2KUC A;  3L78 A;  3I43 A;  4ID0 A;  3F4R A;  3RAZ A;  1SK2 A;  4N10 A;  2OE1 A;  1EEM A;  2VCZ A;  2FWE A;  5D96 A;  2V1M A;  4YQM A;  2IPA A;  3VPQ A;  2OJL A;  4YQU A;  1GNE A;  5G1K A;  3G9B A;  4IQ1 A;  3MIX A;  4L5O A;  3UAR A;  1F3B A;  2HXK A;  3IRA A;  4RI7 A;  2FD3 A;  5AN1 A;  4Z2U A;  2C8U A;  1Z5Y E;  3NIV A;  3KTL A;  3BCI A;  1S3D A;  4EDZ A;  1MD4 A;  2K9F A;  5EL8 A;  3EMP A;  4EDY A;  4IN0 A;  2XPE A;  3R2Q A;  2O87 A;  3TJK A;  1TK5 B;  4HZ2 A;  2B7K A;  1WIK A;  4J57 E;  2C3N A;  4QL7 A;  11GS A;  1K0N A;  2H6Z A;  4PX1 A;  3HCZ A;  22GS A;  3DML A;  4PUF C;  3RHC A;  2L5L A;  3Q18 A;  3GFK A;  4KCA A;  1X5D A;  2RLI A;  5IMZ A;  4PUR A;  2R0P A;  4F2I A;  2D2Z A;  1TK8 B;  5JCU A;  1R26 A;  2I4A A;  5D93 A;  3FW2 A;  4OFT A;  5J4U A;  2CQ9 A;  2FY6 A;  5IOX A;  5J9B A;  4ML6 A;  3HKR A;  2I1U A;  1SJ6 A;  4GLT A;  4K5R A;  2GGT A;  4K7N A;  2YZH A;  5CYY A;  5KN2 A;  2NDO A;  4GCI A;  2FWG A;  4MJA A;  1VRS D;  5G5E A;  1ERU A;  5GAP D;  3KGK A;  3KH7 A;  3QCP A;  4HOJ A;  2H30 A;  4A5P A;  1X0R A;  3WT1 A;  4X4J A;  3UEM A;  1Z3E A;  4I6X A;  4P3Y B;  1ZYN A;  2C4J A;  4G9H A;  2H0H A;  3GKX A;  5ECH B;  1ERW A;  3EC3 A;  2LTK A;  3FZ4 A;  2CT6 A;  1MDK A;  2XBI A;  6GSW A;  5IO2 A;  1WP0 A;  3GTU A;  4POB A;  1HQO A;  2IMK A;  3CBU A;  4HU9 A;  1ABA A;  1WOU A;  2REM A;  4ZBB A;  3W8J A;  4PQ1 A;  4AJ6 A;  1WJK A;  2E2G A;  4PQH A;  1GH2 A;  4BVY A;  4CDO A;  4CW9 A;  4F0B A;  5LCZ A;  1X9M B;  5G2Z A;  3LYP A;  5A4U A;  2JZR A;  4ZL9 A;  2V6O A;  5CRE A;  3F6D A;  3G7Y A;  2JSY A;  3QFB C;  4BPY A;  1FG4 A;  2X49 A;  1SJI A;  4OO5 A;  5KOX A;  1MEK A;  4JR4 A;  2BTO T;  1K0M A;  3TJJ A;  3H1N A;  4XS1 A;  5B8B A;  3ZFL A;  3TJB A;  2DJ3 A;  1XOB A;  1AUC A;  5JCW A;  2PPT A;  3UIW A;  1O8X A;  1B9X C;  3TRX A;  6GSS A;  2K6V A;  3APS A;  2LV3 A;  5F8B A;  2YJ7 A;  4GQF A;  1VF2 A;  2PMT A;  4POK A;  2K8S A;  2P5Q A;  1K3O A;  1CQG A;  4I5Q A;  4HQS A;  4KSO A;  2MYG A;  4NXI A;  2AUV A;  3UBK A;  2DMM A;  5J5N A;  2GQL A;  3TGZ A;  5F0G A;  2H19 A;  2MMN A;  2GST A;  3IHQ A;  4WR4 A;  4J2F A;  3U5R E;  5FHI A;  5J9C A;  4TW5 A;  3ERG A;  3G7J A;  3N9J A;  2KP1 A;  2O8V B;  5FT3 A;  4FYU A;  3ZVJ D;  2G0F A;  4HQZ A;  4ZL7 A;  5JWQ B;  2OBI A;  4QQ7 A;  3VK9 A;  4JU5 A;  5BMU A;  5IQY A;  1PX7 A;  4Z2T A;  4F0C A;  1GNW A;  2K8V A;  5D8I A;  3VI5 A;  1PL2 A;  3KTB A;  4PTS A;  1TK0 B;  1M2A A;  1F37 A;  2V41 A;  2M46 A;  9GSS A;  3ZLP A;  2L4C A;  5ECP B;  2VL2 C;  5DJL A;  1O8W A;  1QXH A;  3DWV A;  1TI1 A;  4MF5 A;  4AJ7 A;  1O7U A;  2AAW A;  3VWW A;  1K0D A;  2LST A;  2CVD A;  4V2N A;  1DBY A;  4O5U A;  2C0E A;  3KIJ A;  1GWC A;  4MLY A;  1NHO A;  1VGL A;  4IQA A;  2VL9 A;  2IN3 A;  2DJJ A;  17GS A;  3WGE A;  3LW9 A;  1PX6 A;  1M2D A;  1M7T A;  1LJR A;  1MD3 A;  3A5I A;  2A2R A;  1WWJ A;  2VM2 A;  3QFA C;  3BOA A;  1GP1 A;  1TRW A;  1WMJ A;  5IPG A;  4MJC A;  2O85 A;  3VUR A;  4OFN A;  1FAA A;  1JLW A;  3FRC A;  3TKQ A;  3DVW A;  1G7E A;  1I5G A;  3F8U A;  2Z9S A;  3CSH A;  2HSH A;  4BVX B;  2AYT A;  4RQR A;  3KP9 A;  2HZF A;  3IA1 A;  3LJR A;  2JSZ A;  5ECK B;  2J9H A;  1XWB A;  4ZL8 A;  3H4K A;  1V58 A;  2LNS A;  4QL9 A;  1NSW A;  1T3B A;  1FB0 A;  4ZXG A;  4EIP A;  4YH2 A;  4EVM A;  3GKK A;  5HFK A;  3IAM 2;  4ZBA A;  1VF1 A;  4NHW A;  1GTI A;  3F9U A;  2RUE A;  2DBC A;  2OKA A;  3MSZ A;  3M9K A;  3ERF A;  4IW9 A;  3EPT A;  4MJE A;  1XWG A;  1K0C A;  3TUE A;  3GUR A;  1SL1 B;  3MWH A;  4KGI A;  4N0Z A;  3HZ4 A;  2GZZ A;  2GSQ A;  3Q74 A;  3TJG A;  4ISD A;  1FOH A;  5D9V A;  4RQX A;  3J7Y b;  3FZ9 A;  5IOW A;  2WUL A;  3DEX A;  3HJO A;  3ZIT A;  4HDE A;  2VCV A;  2J23 A;  1RK4 A;  3I9V 2;  3L9S A;  1AXD A;  3EMX A;  2PVQ A;  2LEG A;  3PH9 A;  4LL4 B;  4BVX A;  3ISO A;  1YKA A;  3ZFB A;  5HR1 A;  1XW9 A;  4MZW A;  2O89 A;  2V32 A;  3D4M A;  2MMA A;  2VOC A;  3TB2 A;  8GSS A;  2CX4 A;  4BWQ A;  3F0I A;  2HFD A;  2H71 A;  4I97 A;  2GQK A;  3EUR A;  5D9W A;  2H70 A;  3UMA A;  4ZBD A;  4TXO B;  3MNG A;  2N5B A;  1T8E B;  2L4Q A;  2DJ0 A;  1O6J A;  4BA7 A;  5IMA A;  5GZZ B;  4JZQ A;  3TDG A;  3QAW A;  2OE0 A;  4OFM A;  4K9Z A;  1TOF A;  3TRQ A;  1HNC A;  3O6T A;  2MZC A;  1VF4 A;  3IOS A;  4MF7 A;  1TRU A;  14GS A;  4G0K A;  1FW1 A;  1N8J A;  2RM6 A;  3U6V A;  2GTU A;  4G19 A;  4BL7 B;  2QGV A;  1EGR A;  2WFC A;  3P7X A;  3KMO A;  3CTF A;  1E6B A;  4PUA A;  2V2G A;  2DJ1 A;  1EWX A;  3ZZX A;  4AF2 A;  5IPH A;  1PD2 1;  4FIW A;  3W8S A;  1B4Q A;  4D73 B;  4TR1 B;  1UVZ A;  3IV4 A;  2A2S A;  3V1W A;  5ABR A;  19GS A;  3F4S A;  4FYB A;  2R5G A;  3KP8 A;  1GTU A;  2HE3 A;  5J41 A;  2FHE A;  1PQN A;  4CY8 A;  4MPG A;  1OC9 B;  3CXG A;  2L5O A;  4K2X A;  1ZYE A;  3KH9 A;  1G0T A;  2DJ2 A;  2PUK C;  5H5Q A;  1V9W A;  2H1G A;  1S3C A;  16GS A;  4AGS A;  1USB A;  1XWC A;  2LJK A;  4Q5F A;  3UBL A;  5ID2 B;  1FVK A;  1UA5 A;  4BL7 A;  2FWH A;  2XC2 A;  10GS A;  1UC7 A;  4KA0 A;  1U6T A;  3QPM A;  4CHS A;  1XBS A;  3DVX A;  5CRH A;  2FA8 A;  2B5E A;  3C8E A;  2CVK A;  1QMV A;  4MH3 A;  4PGT A;  5DBQ A;  4TOP A;  3TKP A;  2LRC A;  3ZML A;  4D73 A;  1JZW A;  4TR1 A;  3ZRE A;  4KUN A;  6GST A;  4NV5 A;  1XXU A;  2C0G A;  1SKW B;  5JWR B;  4OCE A;  1WE0 A;  5CAX A;  1J08 A;  3FKF A;  2F9S A;  2JL4 A;  4K5S A;  4NAX A;  1QK8 A;  3RDW A;  2CX3 A;  1OC9 A;  5ECI B;  4MNN A;  3FR6 A;  1G6Y A;  1RQM A;  2LJA A;  2VIM A;  2WGR A;  1ML6 A;  3FY7 A;  1KTE A;  5FWG A;  5IMC A;  4XTS A;  3ME7 A;  2HRA A;  5ID2 A;  2LRN A;  2TRX A;  4JR6 A;  2A4H A;  4K2D A;  3GHA A;  5A5K A;  1GSF A;  1SKR B;  3AY8 A;  1TW9 A;  2WRT A;  3WGX A;  3NZN A;  1SEN A;  2MMZ A;  1SL2 B;  1EGO A;  5ECN B;  5HFG A;  3TKS A;  3D21 A;  2ZCT A;  1EOH A;  1AQV A;  4MMM A;  2VLT A;  4TR4 A;  1T00 A;  2PN8 A;  3KM6 A;  1XW6 A;  4RUV A;  1JLV A;  1AQW A;  2HYX A;  1XFL A;  5DAK B;  5GSS A;  1XCC A;  2HNL A;  3LEF A;  5LNK e;  2FLS A;  2DIZ A;  1KEB A;  2KP2 A;  2ZUP A;  3HDC A;  1B8X A;  4GTU A;  3L9U A;  2PGT A;  2YWO A;  4ZIL A;  1R4W A;  5E59 A;  4L5L A;  4EL1 A;  5DQS A;  2A4V A;  1ZZY A;  3GL3 A;  4N0V A;  1YJ6 A;  3UAP A;  2F3M A;  4EF0 A;  1QGV A;  2N5A A;  3MDK A;  1YF1 A;  4LLR A;  3C73 A;  4OCF A;  1GUK A;  5GAN D;  4EIQ A;  1KBN A;  2JZT A;  3LOR A;  1GL8 A;  4E8E A;  4O7H A;  1B9Y C;  3GX8 A;  1PMT A;  3DKS A;  3HVX A;  3HVV A;  3WD6 A;  5KN1 A;  1GRX A;  1U3A A;  1W4V A;  3GN3 A;  2G2Q A;  2V6K A;  4OWY A;  3FR3 A;  3GUS A;  2YN1 A;  3LXZ A;  3E0U A;  2X4A A;  1XVQ A;  2DSA A;  1N2A A;  1ERT A;  2XBQ A;  2F8A A;  5AIS A;  4EUY A;  2H0I A;  3O3T A;  2HRN A;  2CAI A;  1PKZ A;  1YF0 A;  3VWV A;  4X1U A;  5G5F A;  3HYP A;  4ULX A;  4KCE A;  3WGD A;  2E0Q A;  1A2L A;  1ON4 A;  3M8N A;  5D9T A;  3IHG A;  5F07 A;  4N30 A;  5IO0 A;  4NWY A;  3IC8 A;  1T7P B;  5ENU A;  4L0W A;  2E7P A;  4KE3 A;  2GLR A;  3PPU A;  1GUM A;  3RBT A;  4NPB A;  1KNG A;  1YEX A;  1PSQ A;  1TKD B;  1TRV A;  2H75 A;  4O92 A;  1TU7 A;  1DSB A;  1V57 A;  2FUG 2;  3RPN A;  2NTO A;  3F3R A;  3GIX A;  2JZS A;  4IEL A;  3ERW A;  2VUP A;  1YDK A;  1TDI A;  4F9Z A;  4WF5 A;  1X5C A;  4GRF A;  2JU5 A;  2LQQ A;  3EWL A;  4NMU A;  4WBJ A;  1GUH A;  3GH6 A;  3SBC A;  1EEJ A;  1GSS A;  2GS3 A;  1NM3 A;  1F2E A;  3WYW A;  2E2M A;  1IYI A;  2EIO A;  6GSX A;  6GSV A;  1M9A A;  2WCI A;  4ECJ A;  5D9X A;  4I2T A;  5ECS A;  4ECI A;  3IPZ A;  1ZL9 A;  3APO A;  3VI7 A;  1OVN A;  4KND A;  1BED A;  2B6M A;  4TRX A;  4XRA A;  3HD5 A;  1IYH A;  4TKY A;  3RPP A;  4ECC A;  1OE8 A;  4IVF A;  2EIQ A;  3ZIJ A;  1K0B A;  2PVO C;  1NHY A;  3M3M A;  1M99 A;  2R37 A;  2VAF A;  2PU9 C;  2LQO A;  5CRW A;  4RI6 A;  2YNX A;  4XS6 A;  4TR0 A;  20GS A;  2F51 A;  4WBR D;  1SK1 A;  2GVP A;  1Z6N A;  2HRF A;  3LGC A;  2MBS A;  3PGT A;  1JHB A;  3S9F A;  1GSD A;  3HXS A;  3UVH A;  4K1F A;  3D6I A;  4EXJ A;  3CRT A;  1A2J A;  3VWX A;  2OAC A;  3FMW A;  2FGX A;  2P5R A;  5KN0 A;  2H8L A;  1AAZ A;  2X99 A;  2WZ9 A;  2QSI A;  2XHF A;  2NVL A;  3D5J A;  5DAL B;  2JAC A;  1HNB A;  4L8E A;  1YQ1 A;  3GL5 A;  2L6C A;  4IP1 A;  3EVI A;  2LNT A;  2C3T A;  3FHK A;  5COH A;  5L71 A;  3C1R A;  4GF0 A;  4ACS A;  4MP4 A;  3L4N A;  2VD0 A;  1T4Y A;  4XCS A;  2FA4 A;  3H79 A;  2X64 A;  4LA1 A;  2DML A;  2H74 A;  1HYU A;  3GSS A;  3IXR A;  4HUA A;  5ECQ B;  1ILO A;  1PL1 A;  2VM1 A;  1PN9 A;  2DKI A;  2IIY A;  1OC8 A;  3A2X A;  2YJH A;  3UVT A;  4DEJ A;  5B6N A;  1TRS A;  1EP8 A;  2HT9 A;  4G0L A;  3F4T A;  5B8A A;  2CZ3 A;  4WEY A;  1XWK A;  4OMV A;  13GS A;  2KLX A;  3I69 A;  4IKH A;  1BYE A;  2UZ8 A;  2I9H A;  3HHV A;  1M0U A;  1XPV A;  1HNA A;  2PBJ A;  4EO3 A;  4K7I A;  3CMI A;  4TN8 A;  3C1S A;  2B5Y A;  4H86 A;  4I8B A;  5GST A;  3PR8 A;  3CRU A;  2CA8 A;  4PNG A;  5CP1 A;  2DC5 A;  1R5P A;  3VPT A;  3GKN A;  1JZR A;  4USS A;  5CRD A;  4HU7 A;  2AHE A;  1LBK A;  1URM A;  4V1A g;  3ZYW A;  2YOI A;  5DDL A;  3K8N A;  3DYR A;  4K7O A;  1X9W B;  1ZYP A;  2MMO A;  5KOW A;  1OE7 A;  2GT5 A;  1OAZ A;  3P8W A;  3KZQ A;  3LWA A;  1K0O A;  3GRX A;  2FNO A;  2H66 A;  5ECM B;  3KCM A;  1A8L A;  4ICY A;  3R3E A;  3ED3 A;  3IK7 A;  3EYT A;  2A2P A;  4MCU A;  3GH9 A;  1YEP A;  2R4V A;  4V2L A;  1FB6 A;  3PIN A;  2WS2 A;  4E8H A;  4Z2R A;  3GMF A;  4IJ3 A;  5B6M A;  4V2M A;  3IR4 A;  5HFI A;  5BRT A;  3A3T A;  3BD2 A;  1W89 A;  1OC3 A;  1TI3 A;  4YKG A;  4ZIJ A;  3ME8 A;  1NW2 A;  3J7Y k;  1JZD A;  3H8Q A;  4TXO A;  4ZB9 A;  1GUL A;  1FHE A;  1GTB A;  3C7M A;  3DXB A;  3QR6 A;  4ZB8 A;  2EC4 A;  2VCT A;  2YCD A;  3BJ5 A;  3FZA A;  1XW5 A;  4BWS A;  1SL0 B;  4PQI A;  2WJU A;  2P31 A;  2PWJ A;  1I9D A;  3D4T A;  5AIV A;  5KEJ A;  2ON5 A;  1GLP A;  1A0F A;  2TIR A;  2N5F A;  2QKE A;  3HZ8 A;  1FOV A;  3TOU A;  2IME A;  4F82 A;  4NV2 A;  3A2W A;  2VO4 A;  3UJ1 A;  4MF6 A;  6GSY A;  3ZTL A;  1Q4J A;  4JE1 A;  1X9S B;  4K8M A;  1ACV A;  3ZMK A;  3HJM A;  1Q98 A;  2CV4 A;  4HZ4 A;  1U3I A;  1R5A A;  2H76 A;  2IL3 A;  2B3S A;  2C80 A;  2GZP A;  4KAE A;  1GTA A;  5G1L A;  3HJP A;  4DSQ A;  2HSM A;  4GST A;  4GSN A;  1BJX A;  4DSS B;  2RII A;  4KX4 A;  2BMX A;  3TKS C;  3VWU A;  2P0G A;  2MBT A;  4I2U A;  4XRD A;  2IWT A;  2ON7 A;  3WT2 A;  2HZE B;  1THO A;  1SD8 A;  3GYK A;  5JCG A;  5EY6 A;  4YAP A;  1PA3 A;  4FH8 A;  1MDI A;  1A24 A;  5ELA A;  3IC4 A;  3QD9 A;  1ZOF A;  4TXV A;  2R0C A;  2RM5 A;  5EVO A;  2DKH A;  1XWA A;  3QOU A;  3C71 A;  2H6X A;  2YAN A;  2IMF A;  3GTU B;  5ELG A;  1G6W A;  5IM9 A;  4Q5N A;  4WXT A;  1EP7 A;  4ILF A;  1V98 A;  12GS A;  1SU9 A;  4ECB A;  4PXO A;  1Y6E A;  3US3 A;  2VLV A;  2YPM A;  2LRT A;  4BVY B;  4G0I A;  1PN0 A;  2ES7 A;  2EIR A;  3IK9 A;  4MPF A;  1PKW A;  2L57 A;  2FWF A;  3KMN A;  2VLU A;  3APQ A;  3LG6 A;  2PER A;  1WRY A;  4GSS A;  4DSS A;  4MJB A;  2B1L A;  5INY A;  5CNW A;  3A2V A;  2X8C A;  2HZE A;  1J9B A;  2DLX A;  3G7I A;  4IP6 A;  1WPI A;  2NBS A;  4IBP A;  1DUG A;  4MDC A;  2H1B A;  1A8Y A;  4JED A;  1F9M A;  1VF3 A;  2YV9 A;  4POL A;  2QC7 A;  2CVB A;  2IJY A;  2K18 A;  3KD0 A;  5DCH A;  2IMI A;  2VD1 A;  4DVC A;  3ZRD A;  5HQP A;  5CRG A;  1PRX A;  3F3Q A;  3LQ7 A;  3IBH A;  4JBB A;  2H01 A;  4IHU A;  3GV1 A;  4O32 A;  1ZGN A;  4G10 A;  1TU8 A;  1V40 A;  1DE1 A;  3EU3 A;  2HSY A;  4DSR A;  3HA9 A;  2X8G A;  1SJZ A;  1O85 A;  1ZYQ B;  1RW1 A;  1ST9 A;  2LS5 A;  4KH7 A;  1BQ7 A;  4WF4 A;  2OAD A;  2HLS A;  4OD7 A;  1SK0 A;  3E9J B;  5D73 A;  4K0G A;  5JWO B;  2H6Y A;  2AV4 A;  4J56 E;  2QA2 A;  3EIN A;  3M1G A;  1BX9 A;  5DAK A;  3TKS E;  5HR0 A;  4K0N A;  2YWI A;  1XVW A;  4EKZ A;  3QMX A;  2OBK A;  1SYR A;  4Q5R A;  2GZY A;  1TTZ A;  4OO4 A;  2AJQ B;  3FK8 A;  4IGJ A;  1QUW A;  2WDU A;  4WKW A;  4MAB A;  3O76 A;  4EE0 A;  3VLN A;  4F03 A;  5H5S A;  3P90 A;  3P2A A;  4AJ8 A;  1OKT A;  3TKR A;  5HR2 A;  1JFU A;  3F6F A;  5A4W A;  1FO5 A;  3NOF A;  2R6K A;  2GDR A;  1BAY A;  3M9J A;  5KN3 A;  5DVB A;  4X0X A;  2RUF A;  4MH2 A;  3D22 A;  2R3X A;  2WB9 A;  4PNF A;  4YAV A;  2DJK A;  1DE2 A;  3A5W A;  1F3A A;  2O7K A;  4KDX A;  5A4V A;  4TVE A;  2B7J A;  2HRK A;  1AC1 A;  2YWN A;  1XIY A;  5F05 A;  2C1Y A;  4FQU A;  3LFL A;  5IMD A;  4WET A;  1J0F A;  3QAV A;  3E3E A;  3GX0 A;  4JRR A;  3KXO A;  3Q19 A;  2H0G A;  1XZO A;  3W6G A;  6GSU A;  4KB3 A;  4YKF A;  1THX A;  1B48 A;  5IMV A;  5J3R A;  3LXT A;  1U88 A;  2L59 A;  5HR3 A;  1OKD A;  2XPD A;  2R2J A;  3L0H A;  4POM A;  1A0R P;  1E2Y A;  1XOA A;  1AQX A;  1M9B A;  5ECL B;  4KF9 A;  2TRC P;  4GWR A;  4X43 A;  1SKS B;  2IFQ B;  3HVS A;  5DCG A;  2GQM A;  4HJ2 A;  5DQY A;  5H5R A;  1O81 A;  4MA9 A;  1PGT A;  1YY7 A;  1H4O A;  1C72 A;  5G31 A;  5IMF A;  1Z7P A;  3M0F A;  2R0G A;  2VCW A;  3H93 A;  1H75 A;  1TXX A;  4G2E A;  2VL3 A;  4FYC A;  3DRN A;  1EV4 A;  2DIY A;  1UN2 A;  1EOG A;  1MTC A;  1SD9 A;  4XS4 B;  2F8F A;  2KOK A;  5AGY A;  1ZCP A;  1TP9 A;  1EZK A;  1JZO A;  1M2B A;  3FR9 A;  3ZVJ A;  2H1D A;  3CYN A;  3KJY A;  4MK3 A;  2VL2 A;  3DD3 A;  2I3Y A;  4KDY A;  2M80 A;  1AIU A;  3TCO A;  4EC0 A;  2LKU A;  1AW9 A;  4FO5 A;  4HEA 2;  2H72 A;  2IMD A;  1MDJ A;  3TJF A;  1BG5 A;  1A2M A;  1O73 A;  1ERV A;  2IFQ A;  3RHB A;  4IJI A;  1G7O A;  3IAS 2;  2H1A A;  3EE2 A;  3JCM L;  4O5R A;  1A23 A;  2OA7 A;  4HJM A;  5DJM A;  4XIH A;  5AIX A;  3BBY A;  2C3Q A;  1R7H A;  5G30 A;  2L6D A;  1QFN A;  4LMW A;  4Q5Q A;  2QA1 A;  1S3A A;  4XHM A;  1Z7R A;  3QDN A;  3VFI A;  2M72 A;  5IIZ A;  3TRP A;  3ZIV A;  2X8H A;  2JAD A;  4KDU A;  5C04 A;  4XS4 A;  3HY2 A;  3F63 A;  2CZ2 A;  2CAQ A;  2YV7 A;  4O5Q A;  2C0F A;  3I6A A;  2GSS A;  3FEU A;  5DAL A;  2FCH A;  1EV9 A;  2OE3 A;  3ZL5 A;  3D0Z A;  3UL3 A;  1F6M C;  1U87 A;  1GSU A;  2VCQ A;  4Z7X A;  2LJR A;  1GSE A;  5E4W A;  2I81 A;  4LL1 B;  2C0D A;  1FVJ A;  3GA4 A;  3IE3 A;  4HI7 A;  1T1V A;  3GKM A;  4CY6 A;  1OYJ A;  2YZU A;  3Q6O A;  3DGQ A;  3FYG A;  2H73 A;  2YP6 A;  4MZC A;  3BCK A;  1SYX A;  5EPF A;  1V2A A;  1YKC A;  4NHZ A;  4ZB6 A;  3UOM A;  3MAK A;  5C00 A;  5F06 A;  1GSY A;  1Y25 A;  2LUS A;  1K3L A;  1ZMA A;  3CSI A;  3KEB A;  4WR5 A;  7GSS A;  4K6X A;  1K3Y A;  1YZX A;  3CSJ A;  2NPB A;  2HI7 A;  2VCX A;  3GST A;  3LYK A;  4IS0 A;  1Z6M A;  2YWM A;  2ZNM A;  2GSR A;  4GQC A;  2KHP A;  18GS A;  1LU4 A;  5B7C A;  4KW6 A;  3SWL A;  4V1A p;  3CTG A;  5LD0 A;  2B5X A;  1CQH A;  2AB6 A;  4YQV A;  4N11 A;  2ALB A;  3L9V A;  4KSM A;  4ML1 A;  3EU4 A;  5ECR B;  3LSZ A;  3OR5 A;  1TJD A;  2B1K A;  1K0A A;  4LMV A;  3MYD A;  1B4P A;  5CO3 A;  1GSQ A;  5ECO B;  1HD2 A;  1T4Z A;  2BJX A;  3GNJ A;  1GLQ A;  3IDV A;  3FZ5 A;  3DIE A;  4HS1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...