1SJQA

Nmr structure of rrm1 from human polypyrimidine tract binding protein isoform 1 (ptb1)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
88
structure length
88
Chain Sequence
SGVPSRVIHIRKLPIDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTSVTPVLRGQPIYIQFSNHKELKTDSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polypyrimidine tract-binding protein 1
publication title Structure and RNA Interactions of the N-Terminal RRM Domains of PTB
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 11
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2004-03-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sjqA00
2VODA 2QA4S 1K8AT 1OO0B 1VQMS 1Q7YT 3BO4A 2L08A 5JVHQ 4QQBA 2DB1A 2M4MA 4IUFA 3CXCR 2FC9A 3MI7X 2DNMA 2G4BA 2LEBA 2DH9A 2DNKA 4F26A 4TU9A 3PIPQ 4EGLA 1D9AA 3G71S 2RS2A 3Q2SC 2MQNA 4RU2A 2KM8B 2FY1A 1HL6A 1B7FA 1WEXA 1WG4A 1QM9A 3G8SA 4WFBQ 1H6KX 2KU7A 2MKKA 2OJ3A 3TP2A 3MUMP 4W92B 2JVRA 5LXYA 2M2BA 1FNXH 3RW6A 2DH7A 2JRSA 1M90T 1YWXA 3CMES 2B0GA 5IM0A 3BEGB 2OSQA 2DHAA 2KHCA 2VOOA 1FT8A 2DHGA 2MKJA 1SJFA 2MZJA 2DNOA 3Q2TC 3CCRS 4PR6A 4CIOA 3G6ES 1YIJS 1UP1A 3MD3A 2MGZB 3G9CA 2CQDA 5IFMA 2O3DA 5GADU 2MY8A 2CJKA 3FEXB 3LQVA 3TO8A 3V4MA 3MOJB 2F3JA 5HO4A 4IO9Q 2M9KA 1ZZFA 4CH0S 5GAHU 2K8GA 1JMTA 2MKSA 1PGZA 1WI8A 1WI6A 4CQ1A 1SXLA 2KG0A 1VC6A 4PRFA 1X4HA 2RRBA 1YJWS 1VQ8S 2MKIA 2CQ3A 1DBDA 5LXRA 5DM6Q 2JWNA 4YUDA 5HL7Q 2AYMA 2VOPA 2DGSA 2DK2A 3NNHA 1O0PA 3VF0B 5H1SV 1A9NB 1VBZA 2MZ1A 1VQKS 2LA4A 2D9OA 2XNQA 4TU7A 3TYTA 3VAJA 1OIAA 1U1LA 3VAGA 1QVFR 4WCEQ 1WHXA 5FJ4A 5JVGQ 2KFYA 2AYBA 2LYVA 4FXWA 1H2UX 1KOOA 2CQ4A 2YKAA 3I55S 3VAHA 2DNRA 2CPFA 2GO9A 1VQ4S 2OTLS 2CPXA 3CC7S 1IQTA 1X4AA 3FEYB 1D8ZA 2DNQA 5GVQA 2ZJQQ 3DXBA 3US5A 5GAEU 1SJQA 3NS5A 2KN4A 2MKHA 1VQOS 2HZCA 4IOCQ 1WTBA 4WKRA 1NO8A 2M70A 3IWNC 2E44A 3G96A 1K9MT 2I2YA 1WF1A 2FHOB 2DGUA 1WHYA 2LECA 1FJEB 1U6FA 1WF0A 1URNA 2DO4A 3S7RA 4WFNQ 2Q79A 1W2BR 2LKZA 1R8PA 3G4SS 5CA5A 2LEAA 2PE8A 2DGQA 4PKDB 2OSRA 4U67Q 1OPIA 1S79A 1PO6A 2MB0B 3B4DA 3P6YC 3CCLS 1YHQS 1N88A 2ZJPQ 1G2EA 1WEYA 2EK1A 3G8TA 4Y00A 3CC2S 1X0FA 2UP1A 4A8XA 5LJ5Y 3CCES 2LCWA 1ZZNA 4QU6A 3B4MA 4YB1P 2CQ0A 2DGTA 2MXYA 1VBXA 3J7ZT 5DDPC 3ZZYA 1X4FA 4J5OA 1UFWA 1HA1A 2MSSA 2KXNB 2YH0A 1M5KC 2LXIA 1HD0A 2NLWA 2U2FA 3P49B 5LJ3Y 3CC4S 1HD1A 2DITA 3CCSS 1DHMA 1YI2S 1VQPS 1X4DA 2E5JA 2KRBA 2MJNA 2MQOA 1YTYA 2HGLA 2D3OR 1SJ4P 2HVZA 1WF2A 2RU3A 1VQNS 1WG1A 1P1TA 5D78A 2DNPA 1VBYA 3UD3P 5ITHA 5LSOA 1JJ4A 2RVJA 3THPA 2CPDA 2MYFA 1Q81T 1K73T 3MDFA 2RQ4A 4OZ0A 3U1LA 1SJ3P 2X1GA 2CQ1A 2G1DA 3ZZZA 2DGXA 2RT3A 2WBRA 4OZ1A 2U1AA 3P5TL 5IQQA 1WEZA 2D9PA 2RQCA 1VC0A 2JX2A 3N9UC 1P27B 2SXLA 4LIRA 3UCZP 2MQMA 1VQ7S 1X5OA 1WHWA 1U1RA 2LXUA 2M8HA 4UY8T 4ERDA 5LSLA 2DNGA 1DRZA 3R1LA 3HI9A 1X4GA 2KRRA 2YTCA 3H2VE 2CPHA 2N82B 2CQGA 5DDQC 1DZ5A 2DO0A 2MQQA 2EK6A 2MZTA 1N8RT 1WELA 2KI2A 2LA6A 1H2VZ 3VAFA 3EGZA 2AYEA 2DH8A 3UWTA 3CMAS 3BO3A 3H2UB 1QVGR 1M5OC 2DNYA 1A7GE 4QPTA 2MZRA 3CUNA 1U1NA 2ADBA 4F02A 3K0JA 3MXHP 2DNZA 2L9WA 2GHPA 1X5PA 1Q82T 2CPJA 3BS9A 3CCMS 2PEHA 5DETA 3J7YU 4YOEA 2MHNA 1FO1A 3IRWP 2DIVA 2DNHA 3VAKA 2M8DB 2X1BA 3NS6A 2AD9A 3VAIA 3NNAA 3RW7A 4P6QA 1AUDA 2X1AA 3UCGA 3R1HA 5GMKa 1VC5A 3NNCA 1FXLA 2XNRA 1NJIT 2CPIA 5IM0B 3MURP 1X4BA 2HGNA 3EGNA 5CXTA 2KVIA 4FXVA 3S6EA 3CF5Q 4BS2A 1VQ9S 1FJ7A 2DGWA 2CPZA 2EVZA 3PIOQ 2MSTA 3VALA 2RNEA 1WWHA 2MPUA 3LPYA 2MJUA 4Y0FA 2DNLA 4M5DB 1U1PA 1U1OA 1UAWA 1U6BA 1L3KA 3ULHA 2MMYA 1YJNS 2E5IA 3S01A 2CPYA 2ZJRQ 4Z2XA 3SDEA 2QEXS 3U1MA 2L41A 1F9FA 2OIHA 1KC8T 2AYGA 4IOAQ 5MLCV 1X5SA 2YH1A 2DNNA 2J0QD 1FHTA 1N54B 2MQPA 1NU4A 2E5HA 3D2WA 4ZKAA 1X4EA 1VQLS 3BO2A 2OTJS 2DHXA 5DM7Q 2KXFA 2DGVA 1VQ6S 1U1KA 1H2TZ 4CH1A 1M1KT 3MD1A 1OWXA 1SJRA 2I38A 2DHSA 4W90B 1YJ9S 4QU7A 2BOPA 4TLQA 4V19X 2DISA 1YITS 2FC8A 3CTRA 3CCVS 1M5PC 2MKCA 3UD4P 2N3OA 2CQ2A 2M7SA 1KD1T 3UCUP 2RRAA 2HGMA 3CCUS 2N7CA 1M5VC 2ADCA 3P3DA 4TU8A 5GAGU 2FPHX 2MZSA 3DLLQ 2QFJA 2XS2A 3SXLA 2HYIB 5EN1A 2X1FA 2CQHA 2RUGA 2JVOA 4LJMA 3R27A 2M88A 2G0CA 3CPWR 2KYXA 2K3KA 1RK8A 4WIIA 5BJRA 2VONA 2XS7A 2ERRA 1U1QA 1RKJA 5D77A 3MUVP 3HHNB 1WG5A 3THTA 3MUTP 1BY9A 1XN9A 2RS8A 2LMIA 2M52A 1KQSR 1X4CA 1JJ2R 4ED5A 1U1MA 1WHVA 2J0SD 3UE2A 2MZQA 2KH9A 2MY7A 2MGZA 2MQLA 1VQ5S 5CYJA 1S72S 1U2FA 1N52B 5DDOC 1Q86T 3JB9k 2LQ5A 3L3CA 2M0GB 2DGOA 2YWKA 4C7QA 1JJHA 4WFAQ 2F9DA 1CVJA 2V94A 3CCQS 2BZ2A 4UQTA 3VAMA 2J8AA 2NZ4A 1FJCA 3OW2R 3I56S 3EX7B 3NMRA 2KG1A 4C4WA 2A3JA 3SDEB 2CQCA 3S8SA 1X5TA 2KM8C 2F9JA 2N3LA 2CQBA 2XB2D 4WF9Q 3CD6S 1R8HA 3CULA 2KXHA 1KOHA 1ZH5A 2E5GA 5DDRC 2XS5A 4C0OC 2CQPA 3CCJS 2XSFA 2J76E 4F25A 4LMZA 1UW4A 2KT5A 2CQIA 3SMZA 2CPEA 2DIUA
chains in the Genus database with same CATH superfamily
4QWBA 1HWJA 1VQMS 2I1RA 2M4MA 4B08A 3OR2B 1CJTB 3MI7X 1RABB 4OZJA 5LL6d 4H4OB 5CYQA 5E5NA 4NLVA 5D0RA 2ILZA 5J2MB 1DY3A 1B7FA 3OL9A 1R31A 2JVRA 5J1EB 4MKYA 3FKBA 1FKAF 1YWXA 3QFWA 1B0TA 3IMQJ 4O3QA 1LW0A 3BBCA 3PACA 3EYZA 2OMLA 3PXGa 4B3MF 2X3DA 4CIOA 1HPZA 3MD3A 3WX4A 3SFGA 1DTQA 2YBVA 1MSWD 1WC3A 4H4MB 4PQAA 3GYGA 5HROA 1CS4B 2QMXA 1VISA 1HQUA 2NS1B 2BXJA 2IYGA 3VVTA 2VOPA 3OL7A 4DZ6A 4KFBB 3PFOA 3EPIA 4N47A 1HIYA 4O3SA 1H98A 2PEBA 1VBZA 1CEZA 4JI7F 2HFVA 1KOOA 1KEKA 2W4PA 2CPXA 2XY5A 3CJSA 3FMBA 5C2CA 1SL2A 3I0RB 3OR1B 4ZPCA 3AY0A 3ONQA 2CDRB 2DGUA 1ZM3A 3NEKA 2JHEA 2PE8A 4E98A 2HPUA 5D0HA 4P2FA 1G1XA 3J80U 3FCVA 1Q8BA 1EKSA 2UXDJ 2LCWA 1ZS6A 1YRXA 4J9QA 3MTKA 4JI8J 4KH1B 2EKNA 4I4BA 3QT8A 2QL9B 1SJ4P 5THWA 2BW2A 3IG1A 1RWUA 4JI8F 1DFDA 3J80Y 3D0GE 1Q81T 1NEEA 3EE3A 2E5LF 1RUSA 1FRIA 2ZZNA 3AA9A 4TY8B 5E0OA 2SXLA 1VQ7S 2MQMA 4ZDNA 1OMSA 3BR8A 2OAUA 2HRTA 2M8HA 5KG4A 3HP6A 2HQIA 4IRCA 2DNGA 2G13A 3TA0A 7FD1A 1X4GA 2DR5A 3TAMB 3DYAB 2B6AA 3BPSP 3NGKA 3CD0A 2PFFB 2NPIA 2MZRA 2CUYA 3H5SA 2ZM6F 4ETZA 1HBOB 3J7YU 3PNIA 5KFPA 2M8DB 2AD9A 4DUZF 2XHWA 2LQ8A 1KVIA 3KUEA 5KG2A 1WOSA 1RTJA 1Q0NA 2KVIA 2QE5A 2Z58B 2NSCA 1N6QA 5B08A 3PIOQ 2UUCJ 3ZZPA 4KE5A 4WZMA 4Y0FA 3F56A 1U1PA 3RJMB 2YKPA 1XR7A 2MMYA 2CFXA 2GZOA 3KKFA 2CJ9A 2OIHA 2VG7A 5J2NA 4EEYA 3FK4A 3PJWA 4NLSA 1TZ0A 4ZKAA 1YQHA 3M2UA 1SC3B 3K7RA 1PCAA 5KFNA 2HNDB 1YRTA 1H2TZ 1M1KT 4K5SA 1T9XA 2XBPA 3C3LA 4TLQA 2DR8A 3N0VA 3OVAA 4KKOA 2VQFJ 2YKMB 2ZHAA 3IXQA 3RG6A 3OTCA 4YS2A 5GAGU 1WUUA 2OO4A 3NGSA 3V6KA 1JLBA 4N77A 4M5KA 4TNOA 2HZVA 3SEOA 5DGAA 4DU8A 4B3OA 3FGVA 1WG5A 1NJXA 5J2QB 3MM9B 2ZBCA 3TWZA 3UN5A 3PFEA 3UE2A 3HSJA 2YX1A 1N52B 1I5OB 2I5JA 5HBMB 3BDPA 4ZPBA 2BRLA 1LOUA 3D6TB 1JLCB 3JYTA 4GVBB 3PEHA 3LP2B 3EX7B 4C4WA 3SDEB 4TQRA 5HLFA 2KM8C 4DS5A 1ZH5A 1FFWB 3M4XA 4M8LA 4ECZA 2K2PA 1T02A 5C2GA 3W7BA 2DIUA 2A6OA 1OO0B 1NPKA 5J2PB 1GMWA 4UT4A 2LQJA 3WZ0A 2XSJB 2KYZA 4JI1F 1TAUA 3TEGA 1KONA 3C15A 4UUXA 2RH3A 4FYVB 2ZHOA 3BSCA 1CJVA 3A1YG 3PM9A 1G6BA 4H54A 2JLEA 2HAFA 4DV7J 2FJAB 3PRVA 1IJEB 1O6XA 4LF7F 1YK9A 3G9CA 3W5ZA 1ZBTA 2HQDA 1NSAA 3O1LA 2KTQA 1HI1A 5KG7A 1ZAVA 1VQ8S 8ATCB 1PAEX 3MECA 2W9BB 1DBDA 2VJUA 2CQ3A 2V8PA 1RADB 4J9KA 5HL7Q 1NHKL 1AXQA 2RIJA 5HJYA 1NKCA 4YEAA 1JLAB 2ZUGA 3TYTA 2GJ2A 3HVTB 4RKUC 3VAGA 1IR0A 2CNNB 5EX0A 4DV2J 2PT0A 4FXWA 1KQFB 3DC2A 1VQ4S 2DNRA 2OTLS 1KFSA 1EETB 3I0SB 3HULA 2Y1JA 3EJMA 3ZTSA 4ED2A 1UVIA 1XJWB 2E44A 5T14A 1MNEA 4ES3A 3D54A 3C19A 4PUOA 5KFGA 2HIQA 2Q43A 4IFYA 1UPPA 1E6VA 1UCNA 3P6YC 1S9EB 3P45B 3G8TA 1G4CA 3CC2S 3DRXA 4DV6F 1SKWA 3B4MA 2WVDA 2QIFA 1ICEB 3HHLA 1R8CA 2DY1A 2KXNB 3CIZA 1HD0A 3M7VA 1PJ7A 3DMJB 3TZXA 4JYAF 3GONA 3KNAA 1M1HA 2RF2A 3FUYA 2XZWA 5FLXY 1TVRA 3OL8A 4ZHRA 2RSQA 2ZDPA 1WF2A 1S1VB 4B9NA 1YLXA 4WU3A 5LSOA 1MMNA 2RJZA 3HFZB 3NKYA 5KT7A 3I31A 3U1LA 1FK9A 2GHVC 3RRHA 4K0KJ 1X7VA 2RT3A 2WBRA 5H9EK 3C14B 5E3AA 3MCMA 2ATLA 2V0NA 5IQQA 2FIUA 1UFLA 2YY3A 3EGWB 3AT1B 3GILA 5LSLA 1FTRA 3QLHB 1WSVA 4K0KF 4HYKA 5F3TA 3VWSA 5DDQC 1IKVB 1N5SA 4F67A 1FTCA 2AYEA 3UWTA 4OX6A 2ZBPA 2XMJA 1TTHB 1U26A 3VHQA 3MAHA 3FJ2A 1HMVB 2C3PA 5A6WA 4X65F 2DIVA 4DMZA 5KFWA 5ETRA 3RBDA 4ED7A 1YZ6A 4RW7A 3LH2S 2QSFA 3OQ2A 4B9TA 3BN7A 4YHHJ 1CPZA 1U24A 4RWXA 2ZE2A 5M2UA 1UAWA 1L3KA 2HVHA 2E5IA 1I6JA 1YJRA 3PDNA 5D4LA 4NX9A 1TL7A 1NU4A 4MJKA 3T1YJ 2YNIA 4P2MA 1DQ8A 3QT5A 2DHSA 4N5SA 4F4XA 4FF1A 2W7AA 3LW5C 3OJUA 3QNWB 4YR2A 4C0BA 1OSCA 1S10A 5L1LA 3TEHB 2FHMA 1NBEB 3T1YF 4QWCA 3HZEA 2QFJA 2FZCB 3BR9A 3W2WB 1N5YA 2H4WB 4K59A 2VFRA 5K14A 3CPWR 2HMIB 4C8YA 5A2QY 1NCLA 1RHQB 3I9V9 4DI6A 2JLGA 2R7TA 1NJWA 2A0FB 2UZAA 1DARA 5HQMA 1U1MA 4F3MA 2UUBJ 4ZIWA 3AA8A 3C16A 4DEZA 1TL3A 4KGXB 3CCQS 4CT9A 1W2IA 4G3IA 4FPRA 2ZKTA 1HHTP 1HWIA 4FYYB 2ZH9A 1S5ZA 3R5AA 2BJ3A 5DS7A 1TL1B 1RT4A 5KFJA 2PI5A 1EIYB 2IDEA 2D7SA 2XSFA 1VQSA 4CNZA 2ZNYA 2WOMB 5D4NA 3AD7C 3BO4A 4DN0A 3Q22A 4GO7X 1Y10A 3PIPQ 3QRQA 2RS2A 4HLBA 4MAKA 4MKVA 5KFSA 4KR0B 5C25A 1FFGB 1WG4A 2YQ0A 1QM9A 1UETA 4ETXA 3MUMP 1S1WA 3BBBA 2NXCA 4PCQA 4WK1A 4MH8A 3BEGB 2XTJP 3KMQA 3RGIA 4MTPA 3BQ1A 3OFHA 4OJ3A 3QZ8A 3DOMA 3TVZA 4QWAA 4BLGA 4CO0A 2OKQA 1NK6A 2IDLA 2A2DA 4C2MA 5C7PA 2XGPA 5L38A 2XCPA 3G6ES 2QYCA 4A48A 2X7IA 3PW0A 1ZZFA 2J8SA 3SZ2A 4DR3J 2VIHA 3W9HA 4OMFG 3MM7A 1XMQF 3ET6A 4PABA 2XZDB 1T3NA 5A0YA 4ZVFA 3MEEB 3LP1A 3CJQA 1UPMB 2J7UA 4DX8H 4FS1A 5KT3A 4WCEQ 3IAM9 1MROB 1HYSA 1ZTWA 2IY5B 3Q8UA 1X4AA 3D68A 2FHJA 1EQ0A 1HWUA 5DRKA 2CZ9A 5ETMA 4UZBA 2RRNA 4KO0A 2FJXA 3V2UC 4DFKA 4P73A 3OTOJ 4C8MA 3TNVA 2AHOB 4WU2A 4KT0C 3DRSB 1KS2A 2B5JB 4IDKA 3N5BA 2BE2A 1CJKB 4OHXA 4C8LA 4DV5F 1WKJA 1ZZNA 4FNIA 3POTA 5C5JA 3D1QA 4ZCIA 4DV3F 1C4CA 4IFVB 2LXIA 3JSRA 3H7HB 2DITA 3KLGB 1RWPB 2ASLA 1OPZA 1QE1B 1TUWA 4EMDA 1C0TB 3P96A 4X4QA 2J6SA 4KHRA 2B9XA 4O4GB 3G6VA 2Y9HA 5F0UA 1RA6A 3VGUA 2YQ3A 5JMNA 1GMWD 1V3RA 4OX9J 1DQ9A 3NGRA 1YVFA 2RQCA 5CCLA 3QJPA 4F36A 2V4RA 2LXUA 4KB7A 4NZ6A 4NMXA 3A13A 1YBAA 2RAQA 1ZM2A 1AZSA 3HSZA 1U09A 2C3OA 5IC4B 1N8RT 2LA6A 2M5YA 5B0AA 4DCJB 1S9GB 2HS3A 3N6LA 1SC1B 2B9EA 4IG0B 3HLUA 1Q82T 5IWAF 3TW0A 1IM6A 3NS6A 3LO3A 3R97A 2K1RA 2Q6CA 3K5MA 2HLTA 3M8PB 4QWDA 4EYHB 4Z7CA 1EHWA 5CXTA 4OI2A 3EM1A 2VG5A 1RT6B 4Q2LA 1QD1A 3ULHA 1NXIA 2DXFA 2YWEA 1B0VA 2L41A 3V81B 3W64A 1N34J 4NLWA 2DNNA 4NEYA 4DBQA 2LLZA 2RB7A 2CVEA 3ENVA 2WVEA 2JL9A 3FBFA 2AEJA 2RHQB 1F1BB 1G3OA 2V2QA 1RB0A 1N34F 4R5PA 1RT2A 5KFLA 3EPGA 4RW6A 1QSSA 3CDBA 3UCUP 4N8OA 4A47A 3M2RB 1TUVA 3T6JA 5EN1A 4OLPA 2FJBB 2N7YA 5F8GA 2G0CA 2OPPA 2VD3A 4OZNA 5BJRA 2LMIA 4ZCLA 3HHLD 4LFBJ 2DRBA 1APSA 4PXCA 3KLFA 4K4XA 2QMUB 2VASA 2RKIB 3W3SA 5K5MA 3T1AA 3BN4A 3MGJA 1FJCA 3I56S 1YKWA 3NMRA 1TKXA 2N4DA 2OPRB 1GNKA 1HQEB 3QAUA 4P7TA 1X5TA 1NAQA 2L3MA 3CD6S 4DUTA 3CULA 3PY8A 1SV5B 3AFGA 3CEDA 3MAAB 3MPDA 5F8HA 1N56A 2IPOB 4LMZA 3A3PB 1HNZJ 2P9EA 9RUBA 1EKRA 3ZNJ1 2WSFC 1HKAA 2R42A 3BJYA 3AODA 1ZPVA 4PXDA 2HG4A 1UWAA 2W1BA 5F8JA 3MR6A 4YB5A 4PG4A 3BF4A 4ZCKA 1FNXH 1X0PA 1Y3JA 4CI0B 3KK3A 2DHGA 7FDRA 3IRXA 5KFQA 4WKYA 2YPZA 1WC4A 5GADU 1TU0B 3V6DA 3H4DA 3MPWA 4WTYA 4QIEA 1IBKJ 3MMCB 1FKOB 2KG0A 4DPWA 4IYQA 4R8UB 3ZNUA 4K4ZA 5HP1A 2XI3A 3QAEA 5G0RB 3TZYA 2CADA 2DHHA 1HW8A 3DM2A 3OUYA 1MLAA 1N32F 1Q8IA 4PYAA 3WX8A 4FF3A 1T95A 3H25A 1N6QB 4LF6J 4PEOA 4MKAA 1OIAA 1VLOA 2R7WA 1NRKA 1R8AA 3KG1A 2CQ4A 4NA2A 4UW2A 2YKAA 4OJGA 5J2NB 3KLIB 2WRMA 3MR5A 3U27A 4LF6F 4C9DA 1VQOS 4FXDA 1NO8A 4DL0C 3CSKA 1R0BG 3G96A 1SUQB 2BMBA 1IVZA 3FCWA 3RBZA 3KUGA 3C6UA 3KK1A 2UVRA 1W2BR 4KGMA 3W65A 3R7SB 1FCAA 2WBMA 1K0TA 2RDJA 4C3MA 4UZCA 4C3LA 1T94A 3MFHA 3QT6A 1D0EA 1ULRA 4L75A 2AX1A 2AIRB 2KFZA 4C11B 1LXNA 2OMOA 1YI2S 5K8MA 2E5JA 1SKSA 2ZH5A 4DV0F 2D69A 3SBMA 1N5TA 4CO3A 1VBYA 4JI3J 1R89A 2OD4A 5ITHA 3C66A 2PO4A 4Q5VA 3THPA 5GAEI 2QV6A 2BV3A 1UVNA 4OZ0A 4A4JA 2U1AA 1Q7LB 4HI1A 4DX6A 4JI3F 3TARA 4ZP9A 1HBNA 1VRTB 4IQXA 4ERDA 2NXJA 2B4OA 3NCQA 4HACB 1YJVA 1X31C 1BQXA 2MQQA 3I9ZA 1RCOB 1S4FA 4PWUA 1NHVA 3JAMY 2L9WA 2XWYA 5IOLA 3BS9A 3DLJA 3BH6B 1C0UA 1FO1A 3DHWC 5AXLA 5A8KA 3VAKA 4O3NA 1HBMA 4PWWA 1WC6A 3RW7A 2RDIA 1S4EA 2R8HA 4XPCA 1OY9A 3MM8A 1KHVA 3PYDA 5E41A 1LWCA 2BBEA 2CWKA 1Z2LA 2QLXA 2EVZA 4X4RA 2MSTA 4NXMJ 4YR3A 3CJRA 1U1OA 1GT8A 3BM7A 2EI5A 1B3TA 2O01C 5FDLA 3EZOA 4GC6A 1HHSA 3LAMA 1U25A 1TKTA 1NDPA 2V8GA 4I56A 2ZBQA 2WB1D 1IN0A 2OTJS 1C1BA 1YJTA 2FHJD 4FYDA 4ID5A 5ETNA 3P5BP 1NH8A 1ITPA 4JI6J 1WTFA 5KG0A 4FBUA 4TYAA 1D9DA 3HSDA 1SI9A 4JI2F 4GKJJ 3SSQA 3PYEA 2MKCA 4CRJA 2DR6A 4LSZB 1XBWA 3W2VB 2RRAA 1M5VC 4JI6F 2FPHX 4DR6J 4LJMA 4O44B 2GHWA 3QJJA 5DQHA 3H40A 2AU0A 4ER8A 1YDLA 1KP6A 3MUTP 3IFEA 4USJC 3MPYA 3LA0A 5JUMA 3IM8A 4F2SA 1JLEB 4OZ5A 5FIIA 4DFMA 3Q8QB 4P75A 2LQ5A 2VBWA 2DGOA 4Y2AA 3HKZD 4LR8A 4UQTA 3HPOA 3A3OB 2HHHJ 4LF2A 5RUBA 1RU1A 2ZH7A 1H7XA 3HHLB 2KT2A 2KFNA 3GWCA 2DXDA 3W9JA 3PYGA 2KXHA 1J5OA 3JSBA 1U0HB 3TJ8A 2QZ8A 1W25A 4CM2A 2E1PA 2HHHF 3I32A 3DRPA 3NLCA 5LMNF 4RPFA 3E8OA 3KK2B 2KJWA 1VHIA 5CAAA 4M63A 4DQQA 1RU2A 4AE5A 2UUAF 4OFZA 5L9XA 4LFAF 1Q16B 3KLVA 2IC3A 1LFPA 2OJ3A 5C42A 4I64A 3RW6A 5L1JA 3DOKB 3UN3A 1VQYA 3JQJA 3E3XA 3UDEA 4B02A 3QIPA 1S12A 3CCRS 2E7WA 4H4KC 1UVMA 4X4NA 3LQVA 1S1UA 3D1HA 3ISND 2B4PA 3PR4A 2K7JA 2Y8YA 1FEHA 1WI8A 5KFAA 4JV5F 1X4HA 1B4SA 1ZPWX 5K8NA 3NAIA 4QZVB 2E7XA 2AYMA 3IBCB 2QG9B 3DXSX 1LWXA 2V4JB 2K7KA 4O3PA 3M1VB 1S0NA 3GP9A 1LKZA 3SQOP 1GXLA 1TMMA 1RE1B 1SL1A 1LWFA 3L09A 4DR7F 3GQCA 2KN4A 3K5OA 2I9SA 2YNIB 4P7VA 1K9MT 4LBHA 3KJVB 3DLHA 4CLUA 2HNYB 3NOGA 3NXZA 4DPXA 3G4SS 2R7OA 2LEAA 4G1QA 3KHRA 1N33J 2YWGA 4UF4A 2W2MP 2EKYA 5K9FA 3HD2A 3HXMA 1NJYA 5DDPC 5K14B 4LVNP 1FDDA 3FSYA 4NLQA 1HD1A 2QA2A 1YSJA 2MJNA 1KWMA 5HVFA 2ROGA 5HVHA 2DT9A 5G4DA 2QYGA 5LSRA 2R8JA 5LT5A 4IR9A 3FQKA 2RVJA 1TL3B 3MDFA 3ZZRA 1WC1A 4IQMA 2GIQA 3HJVA 4DFPA 1UWBB 2Q1LA 2FLPA 4YY3J 2ROPA 4ED1A 1NHUA 4C8OA 1X5OA 2WCXA 1WHWA 4J37A 4ED3A 3M8RA 4UQGA 1NLKL 2KRRA 1UEKA 5DQGA 3ZZTA 3KLHB 4OX7A 2P9CA 4OX8A 4QPTA 2XGQA 3CUNA 2DNZA 2HFNA 3I5CA 1Q78A 1Y0HA 1HNVA 2HAIA 1FE4A 5C24A 4DS4A 3R1HA 4YP3A 3OHBA 1S1WB 1WD6A 3MURP 3G82B 1WSRA 5HN0A 4ZVSB 4LF4F 4ZP7A 1R27B 1GQEA 1JJCB 2YNGA 4GKKF 2NR0A 3B78A 3GE9A 4EBCA 3M9NB 4ZOSA 2ZITA 2XO6A 5CABA 4IOAQ 2VF3A 2H9ZA 4ATNA 3S1TA 1S99A 1RAAB 1X4EA 1VQLS 3GV7B 2R2TA 4PG5A 2FD2A 2KZMA 5A0YB 1VRUB 1YJ9S 4EBDA 1B7YB 3IR7B 4M5MA 1VDHA 1VR6A 2FC8A 2M7SA 3RBXA 4OIXA 1R0AB 3W8GA 1HYSB 4ILLA 3DHXA 4NCBA 3RU0A 4IH6A 4U9RA 4M5HA 2FGCA 1J2VA 1N36F 2M52A 4EI2A 2MZQA 2BKPA 4IDKB 1JJHA 2DKOB 4QIFA 1XMOJ 1TV6B 1Y5NB 2NYIA 5DGBA 2J8AA 4RUAA 1RGVA 4F0HA 3GV8B 3DOLB 1I94J 2VV5A 2P6SA 1R8HA 1LW2B 1QTMA 2MLZA 1XMOF 3IA0A 2J76E 1HI0P 2OPQB 4NRUA 4PWDA 3MCNA 2HRUA 2VODA 1I94F 5KG1A 4FDFA 4HDHA 4M95A 4F26A 1ZAWA 1FD8A 1HNIB 3PW5A 2AGOA 1Q4RA 3EXYA 5D3GA 1VI7A 2H3EB 3T6BA 3X3UA 4FYWB 2DH7A 1M90T 1F3FA 2W7PA 1MN7A 4O3OA 2JLFA 3MR7A 5BXIA 1ZOTA 4X4VA 3G6YA 4LRBA 1P8GA 2C1EB 3FEXB 3TUJC 4IO9Q 1JX4A 4RBTA 3GR1A 2K8GA 2XWXA 1JMTA 1VC6A 3KOAA 1IKXB 2K1RB 3NRBA 3R9LA 4MMOA 3H59A 4ALZA 4MKBA 4B9UA 3HHDA 3ETMA 1RT7A 2A1BA 4DPOA 4DV1J 4LF8F 2W4DA 2XNQA 5KT2A 3PW4A 5JVGQ 4JI4F 2KFYA 1VJQA 4USIA 4P74A 3NS5A 1RTIA 2EEYA 4ZPWR 2F65A 1YBTA 1FRXA 2VPWB 3JSMA 1KKHA 1URNA 3PKYA 1C2PA 4R5PB 3N28A 3HDSA 2R7RA 1PIEA 4PKDB 4RW6B 1UZHA 3B4DA 3MZIA 4IG3A 4HDGA 2NUHA 4LSNA 3DI6A 4ZVOB 4RWWA 4KHPJ 1UFWA 1SVDA 5EWFA 1RTHA 5B0FA 4D3GA 1LV5A 3PR5B 1KHWA 5HI7A 4MFBA 1WORA 2BUNA 2HIYA 2Z2ZA 1X4DA 2WSEC 3IP0A 2QT7A 4TKTA 4AL7A 1BUXA 1Y4ZB 2JEFA 1CJUA 3KLFB 1D8YA 4KHPF 1P1TA 3KUHA 3R6LB 4HKQA 4Q0BA 1NK8A 4DV4J 1PJ6A 3MF5A 1FVQA 1RWNB 2YKNA 1REVA 2GAHC 2QO3A 1CULB 3CW2C 1FNOA 1NMEB 4B3TF 2W24A 2FVPA 1IJFB 3TRGA 4OZ2A 1VK8A 4QIWD 3NL0A 2FLOA 1WC5A 4X66F 2CQGA 4HH0A 5CYMA 4PQUB 1R6VA 1WELA 5IT0A 3VAFA 1DTTB 3AJDA 2V5HG 3FBEA 5F8LA 2NQPA 2R7VA 1SPBP 2QN6B 1T05A 3E2EA 3UCGA 4PPDA 2CPIA 4I0WA 3T9ZA 1RI7A 1W7WA 1P6TA 4OYMA 3S6EA 3LANA 2EFPA 3LOUA 3MEGB 4NMLA 1CLFA 1KLMB 4GMKA 4I2QA 3OTBA 2YKQA 5GMEA 3V6DB 3BSNA 2JEIA 1OS5A 4L6V3 2IRYA 4Z2XA 1B0PA 3ILIA 3PKMA 3U7JA 3DLEB 4OZ3A 1CSJA 4ED6A 2HW3A 2YNHB 3D28A 3TZWA 5HP1B 2DHXA 4USUA 2VBXA 4TQSA 1YX2A 2APOA 3VV2B 4W90B 5KT5A 4OYAA 1EP4A 2OPSB 3Q89A 1D3WA 4U6PA 1YZ7A 3V5RA 3DDIA 3BSOA 2XMWA 1GEHA 3UN2A 2BA9A 1MWZA 1S0MA 1M5SA 2HFUA 1XN9A 4MK7A 2FJWA 4AXJA 3C6UB 4LSLA 3L95X 1A0OB 1BQNA 1NPRA 5DDOC 4USHA 5HVGA 2YWKA 1NK9A 3V6HA 2J6TA 4E2FB 4ED4A 1C4AA 4MYTA 4QW8A 1JLFB 3TJ9A 2Z2LA 2ZC3A 4ID8A 2CQBA 4WWSA 3W63A 1N5VA 2LQBA 1IKYA 3D3CJ 5I3UA 2C3UA 2CPEA 3CDAA 3ITHB 3B8HA 1MU2A 1MN9A 1OJ4A 4TY9A 2DH9A 3UR0A 1D9AA 2WVBA 3MM6A 3SFUA 1HL6A 4WFBQ 4ECTA 4A8KA 1HBNB 3UD5A 4NWBA 4LFCF 4YMEA 3G8QA 3SQGB 3J7YI 3R5GA 3D1OA 1FT8A 3VZIA 3OV7A 3LP0A 4FVMA 3AH6A 3GCXP 2RDDA 4DXLA 4PYDA 2F40A 2VQEJ 3PRDA 1S57A 3MHYA 3OLAA 2C42A 5GAHU 3PW7A 1HNXF 1ZAXA 1RAHB 2MKSA 2MTLA 3MM8B 3EGVA 2PC6A 5LXRA 2VQEF 2JWNA 4NLYA 4Q44A 3R2CJ 4B9LA 3G6XA 1U48A 3TAQA 4DX5A 1JKHA 1VQKS 3OJSA 4DPTA 1SC6A 3KTQA 1LFWA 4WJBA 3RZAA 5FDLB 2DD8S 2B3TB 1FX2A 1GTEA 1FKPB 2ZJQQ 3VGTA 2V8VA 3ZXWA 1C1BB 3K5PA 3PCOB 4ID5B 1EARA 4K5RA 1XWLA 5GAGI 2NUUG 3CB4A 3DFEA 1KSPA 3GSIA 1L3TA 1FE0A 1PO6A 1S79A 2IYIA 2IVMA 2K3IA 1QAJA 3TA1A 4NLPA 5LJ5Y 4TN2A 4AXIA 4B3RJ 3ZZYA 4JV1A 4JBCA 1BQMA 2Y8WA 1M1GA 3N5FA 1OYEA 1PYOB 3W62A 2PD1A 3GJTB 3PO5A 3QMQA 4B3RF 1S0VA 4KPCA 2NXEA 2VFTA 1MMDA 3UD3P 3PO4A 3CJKB 3QJLA 1Q8LA 3MMBB 4FYXB 4DR2F 3GPAA 3M2VB 2G1DA 4DUYJ 1L3SA 2PMZD 4U8VA 1N4LA 1GXUA 4OQJA 1YG0A 2JOQA 3UCZP 2JJ4D 3CE8A 1A6LA 2IIHA 2GJFA 4F8RA 1AFIA 2L9DA 4DL2A 3H2VE 5D15A 1Y7PA 2KI2A 2YPYA 4U95A 3EGZA 1WKLA 3CMAS 3GJRB 4G6VB 4FBTA 1DAXA 3C6TA 2AGPA 2GHPA 3BBFA 5DETA 2V67A 3LGHA 4OYWA 2AP6A 2DRDA 2CAJA 3BB5A 3GJSB 2IAJA 1NSKL 4DZDA 3BKFA 3QIPB 1XR5A 2R7QA 1BGXT 3VALA 1WDDA 2V6AA 4OZLA 2XLKA 2B9YA 3TX8A 4OHVA 4CLFA 5D0GA 1FRHA 3MEDB 3T9NA 1PC4A 3Q8RB 5B7WA 3HZGA 4Y3CA 1OYDA 3LGMA 4RW8A 4XAKA 4BWJA 1RDRA 2B51A 1UA1A 4F04B 2DXEA 3EICA 3BYPA 2Z2MA 3KHHA 3C46A 4K4YA 4QBUA 1LWEA 1JLQB 4OV6A 1Q1KA 5KT4A 4QU7A 2YX7A 3TUPA 3WHIA 3OTEA 3VQTA 1M5PC 4H4OA 1RT5B 4PZVA 2W7OA 4X84A 4ECWA 5J2MA 2XS2A 3SXLA 1LWFB 4ZVTB 2B7CB 2UVUA 5J1EA 1QTNB 2ZH4A 2YQ1A 5E7OB 5B0EA 3MUVP 4ECQA 5IC6B 2CA9A 2M3DA 2W2PP 5AE3A 2MQLA 2B4VA 8RUCA 1VQ5S 3P8BB 1Q86T 4F2RA 4H4MA 2B43A 3H90A 3SI8A 1CVJA 1CS4A 4UOGA 2V94A 2VA2A 4A8MP 2Z30B 4B3SJ 4C0HA 3IS9B 3CGIA 4WYLA 2B4UA 1VIOA 1Q5YA 4KFBA 1NPPA 4JV2A 1N48A 3TZZA 3TOQA 4F25A 5CZVA 3CJ3A 1AW0A 1IBLJ 3RR8A 2CQIA 3SMZA 4B9MA 4WIQA 4CO5A 2L08A 1RHMB 2WONB 3GIMA 1X60A 4QR0A 4DG1B 2DRAA 2AZ3A 4DWIA 3I0RA 3OR1A 1EB0A 1IBLF 2FY1A 4WK3A 2ZH3A 3NBPA 2XCAA 2OP5A 4HHUA 1F0XA 1O8BA 2Y0BB 4BC9A 3PV8A 3B6BA 4ZPTR 2QLWA 2DHAA 3T5LA 2UXDF 2VOOA 2MKJA 1RAJA 3TUZC 4RR5A 3AQOA 9ATCB 5EUHA 4DHVA 3BGRA 3V4MA 3TO8A 3MOJB 4CH0S 3R5CA 2BQRA 4O0NA 1T3OA 3Q8SB 1K1SA 3GYXB 5BR8J 5K8OA 3AJ1A 2MEWA 3L7OA 1RBAA 1RT1B 4YUDA 4TVAB 3CCTA 2IHR1 5H1SV 1IQZA 3AXMA 2GS8A 5BR8F 3VAJA 1XTZA 1QVFR 4NLRA 3FEZA 2MLXA 4TY8A 1T9TA 4OV1A 3FEYB 1SJ1A 1NZ8A 4EO8A 3WDOA 3OPKA 4X64J 4JI5J 5GAEU 2ALYB 1F5CA 4RW9B 4RUCA 3NGDA 1QDUB 4Y2CA 4Y34A 5D6GA 3DYAA 3FRZA 2OEJA 1KN6A 1WF0A 4MIBA 5H9FJ 2LKZA 2C2KB 2MB0B 1UJ4A 2F5GA 3GU0A 3CCLS 4Y00A 1HBOA 2IVYA 3D0IE 4NCGB 2DGTA 2F4VJ 4U8YA 3BREA 4ENOA 3FRYA 1VRQC 3FFIB 4DR5J 3AB2B 3DRRB 2UUCF 2OUGA 4CYUB 1BWEA 1FJGJ 5L39A 3N6MA 2XULA 3R7BB 2RU3A 3ZC4A 4DQSA 2O66A 4HEA9 2OD6A 4HI2A 4RUHA 5I42B 4A8YA 4EZ6A 2YX4A 2HWTA 3WC0A 1FJGF 3V4IB 3N9UC 1HI8A 2E1CA 4ES1A 3QWPA 2HNDA 5J1PA 4ECRA 3H5XA 1RISA 1PYSB 4USTA 3H2LA 2VQFF 3A3NB 1LNQA 2OH2A 2YKMA 3EVOA 4DF4A 2AJ4A 1HBUB 5KFIA 4PG8A 2DH8A 4ZJQA 2KT3A 4RZRA 1WOPA 4DL5A 4BCAA 3M30B 4C8ZA 3Q86A 2J9EA 2WZ1A 3IRWP 1W26A 1JXEA 5J2QA 3MM9A 2ZH8A 3NNCA 1LEOA 5CD4H 2BX6A 4LF1A 4DQPA 3I5BA 4NLOA 2KZZA 4ZLNA 2ZHBA 4XIUA 4E8UA 5HBMA 1RWOB 2IM2A 1JLCA 2WAQD 4GVBA 4I7FA 2WSCC 3LP2A 4DN9A 3VCDA 3SDEA 3N4WA 3BDEA 3JS9A 1NK5A 2MQPA 2DY9A 3D2WA 3FDSA 2C3YA 4EO6A 1U1KA 1SKRA 2QLJB 4CH1A 4ZVGA 1XEZA 4NZ7A 5J2PA 3CJ8A 2HWHA 2KO1A 3HSGA 2XSJA 3CCZA 2HGMA 3OD2A 1GTHA 3DLLQ 3KLEB 3W5YA 2IRUA 1S6OA 3T5JA 4J9UE 1UFKA 4DV7F 1NK4A 4K4UA 2HURA 1T03B 4HHJA 5HANA 4XO0A 3MM5B 2RILA 5AT1B 5D77A 3MEKA 2QLFB 2KH9A 2LDYA 4NLDA 3L3CA 2GO8A 4K4WA 2JZ5A 1S6PB 3OHAA 3SCIE 3ZTRA 1NK7A 3H5YA 2W9BA 5DJBA 2V63A 2IJFA 3PJ9A 1YJUA 1VFJA 2N3LA 2H51B 2XB2D 2GVZA 2PA3A 2AEMA 2E5GA 3H98A 1UKUA 2QGFB 3CCJS 1JLAA 4DV2F 2QC3A 2DCUB 4ZITA 1R43A 3HVTA 3EVWA 4Q0BB 2DR9A 4JOUA 4IUFA 1SC4B 3ILLA 5CD4A 3T1HJ 2AJ2A 5E33A 3Q2SC 4ZVEA 2XEXA 4OHZA 3BGOP 3QWUA 3F44A 1WEXA 2BE7D 3KJFB 3TP2A 3M9MB 3MCOA 5ETTA 1N5QA 4A46A 1Y00A 2R8GA 1HNWJ 2GNKA 2K06A 3TQEA 2KHCA 2QX0A 5CQGA 1S9EA 1T0TV 2CG8A 4EBEA 2PFDA 5IFMA 4I69A 2EG1A 4N7TA 4I6AA 4CO1A 2M9KA 1HNWF 4YN3B 2WW8A 4NCAA 3DMJA 2RRBA 4DR4J 2B8PA 4AUKA 3SIPB 2RQKA 2XYHB 1S1VA 4ILMA 1O0PA 2I8EA 5A8RB 4QYRA 1S77D 4USVA 2ZUAA 4TU7A 4GC7A 3CD7A 4PAAA 3C14A 4QWEA 1RWKB 3CC7S 2ZD1A 3Q8PB 2E9TA 5HMZA 2JFDA 3US5A 3WQPA 2MKHA 1ZM9A 3QGPA 3QLHA 1UEVA 1I51B 2Y1LB 3D6MB 1DLOB 2ILYA 4DR1J 4DFJA 2W01A 4E0DA 1R3NA 1FWLA 2CNKB 5F0WA 1FJEB 1FF2A 1RLCL 4N41A 4UY85 1OPIA 2BM1A 4X4UA 4QOTA 4DR1F 1HMVA 5DG8A 3WIVA 2UU9J 4YB1P 1UEUA 1RYRA 2V50A 2XMUA 4YHHF 3QSYB 3THVA 1ROFA 2RU9A 4F3OA 3A8KA 2DTJA 2W8KA 3CJ5A 3K5LA 3HF5A 2MQOA 2F8HA 1HLWA 4CO2A 5EGYA 4OLOA 1BQNB 4A8QA 2W8LA 1VQNS 4OJ1A 3FSXA 1HARA 4RJVA 2H48B 5F41A 4RW4B 2QRRA 2PSZA 2V68A 1RT3A 2HHQA 4K4TA 1AFJA 4ED0A 5KFYA 2VBYA 3TI0A 2OGUA 3EUNA 4LF9J 3BSAA 1HFEL 1FA0A 1V6HA 2MDAA 1T11A 2VPZB 2C2RA 2ZFHA 3W2WA 2CZVC 3K2YA 2C2MB 4ELTA 3B54A 1FFSB 2UUBF 1S1XA 2P2CB 5GADI 2XNRA 2C2DA 4AL6A 4L74A 5KG5A 3PX4A 2EFQA 1FJ7A 1RTDB 1F2HA 4BWMA 3D3BJ 4M5DB 2CKWA 1U8WA 1NB7A 5D4OA 5IS2A 2YKOA 1S6QA 1F9FA 5DQIA 1KNZA 4BC7A 1KC8T 1J27A 2AYGA 2LU1A 3DDKA 1L3UA 3TR5A 1QJHA 4KIAA 1TL1A 2E5HA 4ANEA 4C97A 4IH7A 2QMWA 1F5BA 2WOMA 4CTAA 2I38A 2XMTA 1VHFA 4FF4A 4V1Ak 1QSLA 3J81j 1U49A 2N7CA 4TU8A 4ICLB 3TA2A 1KLNA 2X1FA 2CQHA 2WB4A 4IH5A 1U6ZA 2K3KA 4YR0A 1RKJA 1XNRJ 2YNFA 2KDOA 1Q79A 1U2CA 5J1NA 5KFDA 4LRAA 1SB6A 1TAQA 2BKNA 2R8IA 5D0EA 3QPIA 2M0GB 1XNRF 4DR3F 3PW2A 2MQ8A 3OVSA 4NL5A 2R7UA 1H38A 5KFRA 3RUBL 1BQMB 2ALZA 2F9JA 1NKEA 2BRKA 4WF9Q 1PBUA 2PMWA 3MEEA 2VPYB 4EZ9A 2F7VA 5F8MA 3IO1A 2XS5A 3NCRA 3UW1A 4ZVPB 1UW4A 5F8NA 2KT5A 3UO0A 3K58A 4CCHA 3MMAB 3VGSA 1NB2A 4J9SA 5AXKA 2BE9B 2LFVA 2UV8A 3CXCR 4DSLA 3UPFA 3BKTA 4KV8A 2YXLA 4CDIA 1RAOA 2W9CA 2ACYA 3OTOF 2G2ZA 4KTQA 1K1QA 4CP5A 2DCLA 3DRSA 5I4MA 4KGVB 1CJKA 3QSIA 1JB0C 1SH0A 1YIJS 3RB6A 1KTVA 2MGZB 4WXWA 4KSEB 5CCMA 3C8YA 3IGNA 3PRBA 4Q8FA 3I4PA 4IFVA 2VG6B 1PGZA 1KR4A 4WP3A 3T5KA 5U47A 1YJ7A 5LM7E 2QL7B 3JXOA 3KLGA 5DM6Q 4Z37A 4I6YA 1S76D 1JLGB 1QE1A 5DLGA 1C0TA 3N01A 3J7Z5 4EWTA 3R6GB 4J9PA 4WZQA 1HQ2A 1C1CB 4OX9F 3O6QA 1FRMA 2E66A 3GIIA 1WHXA 5FJ4A 1SIZA 2AMCB 3I55S 2V34A 3X1LB 4RW8B 5CYQB 3WIUA 2MLYA 5ETQA 5HATA 2GMLA 5A8WA 4QCLA 4NPOA 4O23A 2FHOB 2LECA 1EAYC 1Y3KA 2DO4A 2C28A 2Q79A 2ZZMA 4CLTA 4FZVA 5KFTA 3MOZA 1S9GA 1LW0B 2DGQA 4U67Q 1U4BA 4IG0A 3I87A 1S1TA 3FNNA 1YHQS 2ZJPQ 2EK1A 1HPZB 3PX0A 1X0FA 3F0NA 2N4CA 1DTQB 4B3MJ 2MXYA 4ZJLA 1QAXA 1R7IA 3M8PA 5HROB 2VKRA 2H5JB 2XO7A 1DHMA 1HQUB 4DSEA 1RT6A 4MYUA 2DNPA 2XY7A 3KHLA 3V81A 3ZZZA 2DGXA 4FKXA 4JI7J 3P5TL 1WEZA 4DOZA 1D1UA 4ELUA 1CQMA 3W61A 5MAOA 2ZDOA 2ZVSA 3M8WA 4DDFA 3HI9A 2LU2A 2CJXB 3NCPA 1YBUA 3BGLA 4FS2A 1XC9A 4X4OA 3M2RA 4HTJA 3QO9A 2CXEA 3M32A 4QJVA 2BEFA 1EZZB 2ZH1A 4C6AA 2DJWA 2G9OA 4LFBF 2ABYA 3G86A 4P6QA 5H9FK 2JNJA 3NBPB 3A8EA 2WTFA 4JUZA 2RKIA 3TAPA 2V69A 3CF5Q 1TMJA 3MCSA 1WWHA 3QFHA 3K5NA 2OEKA 3IG1B 1TK8A 1GFWB 3BGRB 1YJNS 1FWPA 4NA3A 5DZ6A 4LQ3A 3B82A 3JTOA 2OPRA 2PI4A 1HQEA 1XQIA 2AJ1A 4WTOB 1T8EA 1K44A 4J9LA 1S7HA 1HNZF 1N54B 1SV5A 2E5LJ 3MAAA 4IKAA 2DGVA 2ZNZA 4X4PA 1OWXA 4URSA 3MPUB 2ZH2A 4ZJOA 2PGCA 3KYLA 3CCVS 3BGUA 4IR1A 3PYFA 3UD4P 2B6AB 4DX7A 1RHJB 1RACB 5IV3A 3Q23A 2POKA 2HHTA 2M88A 3HT0A 4WBFA 4WIIA 1ACMB 3W1YC 2VFSA 5KFXA 4XPEA 2ZM6J 1BY9A 3M05A 1X4CA 5KFFA 4NE9C 3FBCA 4DUZJ 1RTJB 4USKA 4AFFA 1IBKF 4ZVUB 3O3LA 4JB8B 3H4BA 4WFAQ 2GVDA 2D41A 3MMCA 4ZPDA 1FKOA 2J7KA 3K89A 4DJBA 4R8UA 3CD5A 2YWWA 5G0RA 2VG7B 1NDCA 1S59A 1RLDA 1XERA 4A8WA 3M2UB 5A76A 3KG0A 2WVFA 3OBIA 4LR7A 2Y0SD 4OI3A 4F0KA 4QQBA 2DB1A 2DNMA 1F9EB 2G4BA 2AW0A 4KKOB 3KLIA 1IKWA 4KH0B 6FDRA 2KM8B 1H0HB 3DLGA 1JLBB 1SUQA 3QRRA 1FESA 4PPZA 5E3CA 1P1LA 3NAHA 2B0GA 2D3O1 5IM0A 4RX6A 1EQMA 2NXUA 4B3OB 2OSQA 4Q7AA 1OY6A 2DNOA 3I96A 1UP1A 2GMHA 2W2NP 2Z2YB 3R7NB 2I5JB 2BANA 3SCLE 3JYTB 3GCWP 4C11A 3LALA 2YVSA 4HH1A 2FTRA 2MKYA 3AD8C 5HLFB 2JC0A 3KDNA 2WW4A 3F41A 3AOCA 1MG7A 3RB3A 1A9NB 3H5UA 4Y2KA 2OLWA 4I7FB 2RQMA 2E29A 2AYBA 4CLLA 2FUG9 1IQTA 2CPFA 2GO9A 3OVBA 2UXBJ 1D8ZA 2EC2A 4QW9A 1VRTA 3FC9A 1HWKA 3D0HE 1SJQA 4K2XA 3C15B 3LAKA 4JI1J 5IT9U 4BDPA 2G2YA 4HACA 3L4BC 3AAWB 2Z57B 2HWIA 1CJVB 1OQ6A 2HQ3A 1U6FA 1SH3A 2UXBF 1DQAA 4LUBA 3ELHA 1VMBA 2DPIA 4LF7J 3CCES 3RBEA 2GIFA 1FERA 1NKBA 1X4FA 2R7SA 5KTQA 5IT9Y 3BV8A 4OHYA 4QIGA 4F4WA 1U02A 1UZDA 3MECB 2OEMA 1PAUB 4HL9A 4NXMF 4NYPA 3HJFA 5AE2A 4Y28C 2GC8A 2HVZA 1B99A 1JNZB 2JEJA 3ZTPA 4DLEA 4X4TA 4NEZA 4B9SA 1ZA1B 2IBKA 2W2OP 3A8JA 2C2ZB 2UUTA 4QIVA 1HWLA 1RHRB 1R8BA 5A6PA 4ZLLA 1BHNA 1Y5IB 2GVZB 4GKJF 3AXKA 3ZZ0A 2PA8D 3RAQA 1GX5A 2YTCA 1R6YA 2NREA 3BQ0A 1UTAA 2V2KA 1P9YA 3D66A 1VIXA 3W2VA 4HVZA 3QYYA 2C2OB 1H2VZ 2IMWP 4DR6F 4PUOB 1VGYA 3PHTA 4IFYB 1E6VB 4ECSA 4ILRA 2EFOA 7AT1B 4O44A 2PEHA 1RHUB 2LQ9A 3VGVA 3LPEA 4JV0A 2DNHA 5ETSA 1AUDA 3UR3C 5M2RA 3A12A 2X1AA 4DV6J 4CLKA 5FLXU 5B0DA 3ADAC 4PXEA 3GMGA 4FXVA 1JLEA 2RF2B 1VQ9S 1TVRB 1OQ3A 3PVXA 4I2PA 4JYAJ 4ZHRB 4ZLPA 4H4KA 1VS3A 4D3HA 2DEJA 4F0MA 3FZBA 4DL7A 3GB0A 2FVRA 4CLWA 2GFFA 1FK9B 5F9NA 2VC0A 2QJ3A 3ENQA 4ZK7M 5DG9A 2GAGC 2EC0A 3TJAA 1U0HA 1RAIB 1S9FA 3R5DA 2XHCA 1EX8A 3UVJA 2V2VA 3MTJA 4L73A 3KK2A 2CVIA 1KFDA 4EFAC 2C2EA 1IWGA 3GG0A 1BE4A 5E3RA 2MZSA 1PG5B 2XY6A 2ZD1B 4KGKA 2O5DA 2JVOA 3HT3A 4MK8A 4URQU 4N76A 3DOKA 4F4AA 3HHLC 4RL1A 3OXLA 3LUYA 4X65J 4RW7B 1WNEA 2MY7A 1N0VC 4DSIA 4IRDA 3JB9k 2VUGA 2EG2A 2ZE2B 4C8NA 3DGPA 3OXFA 4K7QA 4RBVA 3VAMA 1RAGB 5M2PA 1IUJA 2NZ4A 3QQCD 3L9ZA 1CC8A 1WJ9A 1H74A 3NOCA 3E51A 1TR0A 1VOMA 1KDNA 1TL7B 1JNRB 2V4JA 3KMSA 3LTOA 2BJDA 3HD1A 4ECYA 2JEGA 3M1VA 2H5EA 2R3VA 3DRYA 5DO2A 2BJ7A 4DLGA 4YB7A 4EYIB 2VB6A 4LR9A 4EGLA 2H4YB 1UA0A 4LRDA 2CJAA 3U02A 2MQNA 3T19A 5HQ8A 2CJBA 2A2CA 2ZH6A 1RT3B 5A2QU 3PX6A 4XDDA 1N5YB 1H6KX 2MKKA 5DZ7A 5EHHA 1BC6A 1SH2A 5LXYA 5ADZA 3KJVA 4X62J 1N33F 2HNYA 2HKEA 3UDVA 2E9RX 2JDJA 4DF8A 3RR7A 1VLYA 3C16B 4U7UK 2X51A 1TUGB 3AOAA 4X62F 2NPFA 2GQ2A 2CJKA 5HO4A 4ES2A 2AV5A 3OFFA 4PRFA 4HT5A 2MKIA 1KQGB 2GW8A 1S1XB 4KYZA 3ENWA 2HNZA 3O2IA 4K8RA 2QA1A 3CJ0A 2DGSA 4EU0A 1RT4B 2MZ1A 1LXJA 4PG7A 1F3VA 1M0SA 3NGUA 4U96A 2LA4A 5KAKA 2UXCJ 4ZP8A 4YY3F 1IBCB 1UWBA 4X2BA 4I6WA 1S6QB 4HR2A 5BYRA 4FPIA 3DN9A 3M6UA 1OSDA 2EFVA 1FWKA 1VYAA 3DXBA 2IMOA 1R0CB 2P9GA 2RHSB 3ZO7A 5CH7B 4L3KA 2M70A 3MR3A 2UXCF 5C25B 3I5AA 3ILJA 2J0XA 2I2YA 2EBGA 4CTAB 4LQ9A 1WHYA 2IA0A 1UVLA 2B8QA 4OL8A 3KLHA 1VCTA 1TK0A 1R8PA 2IRXA 1F9HA 1S49A 2OELA 3DOMB 4ZMMA 1N88A 2UUWA 1Q95G 4FNHA 3FSIA 1YGYA 3J7AN 4I67A 4G1PA 1HR0J 3AHPA 3ZTOA 3G82A 2ZC4A 3MM7B 2YNFB 4WFYA 3ET6B 3GFZA 2BJ1A 3GIJA 2RD5C 4P9SA 2VL1A 2IM1A 1XMQJ 1HR0F 4NOHA 4LREA 4M5IA 2ZVIA 3LP1B 2J9DE 3NGTA 4DU7A 4CM0A 5D4PA 4R25A 2RMLA 2ACMA 4RO0A 4CO4A 4USWA 2F4FA 2W4CA 5T7LA 1RJJA 2H54B 1U1RA 1VRUA 5BYQA 1RZMA 4KO0B 2XMVA 2N82B 1DZ5A 2VICA 2MZTA 2VH7A 4ANDA 2C3MA 2FJDB 1R0AA 1UJ6A 2Z8QA 2GJIA 4KV8B 2BE2B 4F02A 3K0JA 1JWWA 3MXHP 1X5PA 2CPJA 2W9CB 5SUHA 3POTB 1NJZA 2X1BA 3ETOA 3T5HA 1V3SA 4R0EA 3UQSA 4DV5J 4ZVRB 5AJ3J 2NYHA 4DV3J 1X4BA 5GAHI 1ZYQA 4BS2A 2CPZA 5EDWA 3SYZA 2NZCA 4F4YA 2FVSA 1F60B 5IQ6A 5KT6A 1F5AA 1TV6A 2HZAA 1ZA2B 2BJEA 1FNMA 3JQKA 1NSQA 3CIMA 5AJ3F 2ZJRQ 2QEXS 4KY3A 1WACA 4QYZJ 4LBPA 3DOLA 3HMJG 2UVWA 3GIKA 1X5SA 1LW2A 5HQLA 1PILA 1V5IB 1RAEB 2OPQA 1U7LA 2R2UA 4C8KA 3GV5B 2DISA 4RUBA 4BBYA 4NLTA 1LK5A 3D4JA 4Q43A 1AZSB 2BM0A 2CG4A 2ZWPA 1HNIA 3CCUS 2CNLB 3AQPA 3P3DA 3M8SA 2JFKA 1OY8A 5F3ZA 2HBYB 1T7PA 2HYIB 3SSRA 3KXDA 2QTWA 1PC5A 2KYXA 4K2JA 1U1QA 5A8WB 2ZBIA 2R7XA 2HQCA 3THTA 5IWAJ 3UI3A 2JSXA 5AXMA 1KQSR 1CG2A 5ETOA 3MR2A 4DSKA 2HK3A 4C48A 1CBKA 2W9AA 2WK4A 3CDEA 3BPDA 3PZPA 2VG5B 2XM3A 1BXNA 1S1TB 3IR6B 4ELVA 4F7VA 1M5HA 1IKXA 2BACA 4I1TA 3M8QA 3NS7B 3VR1A 4Q45A 5JJBA 2AJ0A 2A18A 1NSPA 3BKUA 1RQ0A 4UOCA 1BMQB 4DV1F 5IXUA 5IZHA 3Q8VA 4WE1A 2HBRB 2BABA 2AZ1A 2LEPA 4HTIA 1HHQA 1JK9B 4FKYA 4OJHA 4PXBA 5L1KA 1JIHA 2H5IB 2HLUA 5JVHQ 2KJVA 2OFGX 2J9CA 1RT2B 4CT8A 2LEBA 2DNKA 1SQGA 1TQLA 2J9DA 3K8WA 1Q8KA 4GVLA 4A8FA 4TYBA 1K0VA 2ZOFA 1S97A 1QAIA 2GMJA 2OPPB 2JRSA 3W66A 4AT1B 1NK0A 3EDQB 4DSFA 3FQLA 5L8RC 3O8WA 2MZJA 1QLNA 3Q2TC 2O1PA 3ISNC 4WFZA 3G87A 4FVCA 3QO9B 4XTTA 2ASDA 4J90A 1V3ZA 3QZ7A 1AA1B 3M32B 4GRSA 3ZZUA 2KL8A 1WI6A 3A4TA 2E1AA 2HFZA 1E6YA 3R5JB 1T9WA 1TKXB 3HCXA 3WBZA 3EWGA 5KFKA 2FB0A 4DV4F 5HSPA 1Z2ZA 1FDAA 5K8PA 3GJQB 2D9OA 3IBFB 5JXSA 2LYVA 4NA1A 2Z0GA 1CULA 4A8OA 3VAHA 4NRTA 3TVKA 5GVQA 5HJXA 2CRLA 1SCJB 3VZHA 3MAQA 1CQNA 2V9WA 1DJ0A 4WKRA 4MT1A 1WF1A 4PQUA 3W60A 3OXGA 1DTTA 3KK3B 1V5VA 1RKIA 4KHMA 3IRXB 2KB2A 3QRPA 2Y1RI 2UP1A 3ISZA 4ZIVA 4N56A 4CLYA 4EUVA 3IR5B 2YWFA 2MSSA 2KHDA 2NLWA 4ZVHA 3HK2A 2L48A 3PHEA 3DLKA 3CC4S 1UW9A 2GCFA 3MEGA 1KLMA 4W98A 3PG9A 4RBUA 1N0UA 3DM2B 3OUYB 3N79A 1WG1A 4OYBA 2EPIA 4DL4A 2DYAA 5KOWA 3TX0A 1AYEA 4C98A 1N32J 2P6TA 2GVDB 4XDCA 2FY8A 2V4QA 2UVVA 3DLEA 3TVYA 2BQUA 3CVKA 3Q0AA 2F63A 2YNHA 2D9PA 1P27B 4LIRA 1WDTA 1KVKA 3ZTQA 4UY8T 4M5JA 5L9NA 3JTPA 2OI2A 1DRZA 2OPSA 2B56A 1AROP 2HRYA 1U2RA 2G0JA 1AUSL 2G1HA 3KK1B 5B0BA 4RNNA 3K59A 2CJYB 3RB0A 3E01A 1M5OC 3H2UB 1A7GE 1NDLA 1NUEA 4L72B 4WXOA 4F4ZA 1IKWB 3HHKA 5KFHA 3WC2A 2HVIA 4YOEA 4M5NA 3DLGB 4LIWA 1L3VA 3NNAA 4L76A 3CJTA 5GMKa 1UVKA 1FD2A 2NSBA 3ICLA 5IM0B 2FHKA 2HGNA 4K4SA 3RRKA 4M1KA 3GG1A 2DBBA 2NXNA 2PDAA 3Q24A 3CJ2A 1FXRA 4OHWA 4F4KA 4DV0J 5HMYA 2FZKB 3D9BA 1JLFA 2AEFA 2BANB 3IWXA 4NLGA 2AWZA 3CWJA 4UUWA 3HO1A 4J7CA 5EWEA 3BO2A 2F1FA 3RYLA 2G0IA 3A8IA 3V6JA 2HEKA 1SJRA 3ITHA 3I6PA 1YITS 2XZTB 4HT7A 1RTZA 4W4MA 3I4HX 3OFGA 4DCPB 2CQ2A 1KD1T 3JAMU 2FYXA 2GGPA 4DQIA 4WP9A 2ASJA 3P4UB 1IBMJ 3IAS9 2C2NA 3M6VA 2Z56B 2BJ8A 5F8IA 3LF0A 1C0UB 2VONA 1PSDA 3L7UA 5A8KB 1XIQA 3O5TB 4M94A 1HBMB 2XMKA 3SQGA 2Q6BA 1IBMF 2HQGA 2HVEA 1UVJA 1LWCB 5EX3A 2V9KA 3HX9A 1S72S 2HFOA 1VBKA 2F9DA 3GLJA 1LK7A 4DQRA 1T9VA 3OW2R 4B17A 4WP8A 2AQ4A 2HFSA 3OFEA 2HHWA 4M5LA 5B0GA 4O0IA 3EXCX 2FDNA 1TKTB 2BVZA 1O5JA 2FGOA 2CQPA 1UL3A 1UMJA 3CO9A 3OSNA 1FRJA 1REGX 1RA7A 4LRFA 2QA4S 2BW7A 3J7A1 1Q7YT 4RNMA 2FC9A 5I3QA 2GQCA 3JQMA 4CLZA 4TU9A 1GH8A 4TLRA 3G71S 1FKPA 4JI2J 1RYSA 1X9MA 2VFVA 3GFYA 4W92B 3K8VA 1Y5LB 4RLEA 2QL5B 2EFNA 4BHQA 4NLUA 3T3FA 1FEEA 1RAFB 4Y2IA 4NI2A 5KFZA 2EWHA 2F3JA 1SQEA 3F73A 1MMLA 3CMQA 5ETPA 2RE1A 4CQ1A 1GAOA 3LGNA 2FJVA 1YJWS 2ZZTA 2EW9A 1EJ7L 4P10A 1J5OB 5LOQA 3CJKA 3GYNA 4DUYF 4I2PB 1LQ9A 1RWXB 2AJFE 4RNHA 3MMBA 3M2VA 1U1LA 3DRPB 1ZETA 2P5VA 1H2UX 1U0SA 2CNOB 4NZ0A 5LMNJ 3IN5A 3M6XA 1U47A 4KBIA 2E9ZA 5HAOA 2IC3B 1WTBA 2UUAJ 4LFAJ 1B70B 3RAMA 3KJNB 3UVJB 3HFVA 5C42B 2AKWB 1RBLA 4Y65A 5E3QA 1TKZA 5CA5A 3W5XA 3W9IA 3CCWA 4OI1A 4GO5X 1V9OA 1AB8A 3CO0P 1G2EA 5AXNA 2EXUA 2NCKL 4DL3A 4P71A 1S1UB 1TFYA 3J7ZT 1G7CB 3NY0A 1FRKA 2U2FA 3OL6A 2IM3A 2GV1A 4ZPVR 1T9YA 3D5MA 4JV5J 2HGLA 3HFKA 5D78A 3MEDA 4NXNJ 4EK2A 2FLNA 3OR2A 1CJTA 3UFCX 1H73A 2RQ4A 3DGPB 4AD6A 3OT9A 3QT7A 2R2SA 1KVJA 4NXNF 2VKZG 5KOXA 3DNCA 1JLQA 3SV4A 2R2RA 1JXVA 4DR7J 3R3TA 1O51A 3IBWA 2CJQA 1RT5A 3HKWA 1PYTA 2HBQB 2HS0A 4LBIA 2WVCA 4G1QB 4K50A 4DSJA 2I6WA 2ADBA 2PN6A 1MW7A 5KG3A 5DLFA 2QSWA 2BR0A 2MHNA 4JI0J 1FDBA 4ZLJA 5KFCA 3SV3A 3M6WA 3UNGC 1F2GA 1TK5A 2J7WA 2CZ4A 3DLBA 2ZOGA 4JI0F 4B3SF 3LPYA 2MJUA 1X9SA 4ECUA 1U6BA 3O44A 3D6HB 4ED8A 1QY7A 2VU5A 3IS9A 4G1IA 2CPYA 4V19J 3K17A 4OYOA 3KDOA 3TQ1A 1RSCA 3NMAA 4ECXA 1VJWA 2J0QD 3RRGA 1FHTA 2IM0A 1TFWA 2HNZB 4DL6A 2HHUA 2HHSA 2KXFA 2LVWA 4CZCA 3OTDA 3BZQA 4IOBA 2QA4G 2YWHA 2WONA 4DG1A 2LXFA 2D3ZA 2N3OA 3DDNA 4RNFA 3IGVA 4OYPA 2DEIA 3DU5A 2CYYA 4J9NA 4ZPAA 2AGQA 3D67A 2VZ9A 3AOBA 1RK8A 5BYSA 5F9LA 1HNVB 5C24B 3CDWA 5L1IA 3RB4A 2J0SD 4NYOA 4O3RA 3PEJA 1RBOB 1U2FA 1URRA 3TANA 4C7QA 2YNGB 2J5AA 4LVOP 4LF4J 5KG6A 2EFGA 4DCOB 3KWMA 2R4FA 4GKKJ 4USMA 3MFIA 2A3JA 2F8MA 2IJNA 3FZ2A 1RT1A 2CWXA 3H0PA 4P2XA 2FVCA 2JC1A 1UJ5A 4C0OC 3LWLA 3TAMA 4I68A 2E1RA 3CJ4A 4J9RA 2FZGB 2IJRA 4QYZK 4X64F 4JI5F 4KGZB 1U8SA 1RWVB 4RU2A 4RW9A 3QIDA 2Q66A 2H1YA 2V8DA 3DGVA 2J6UA 1TP7A 2KU7A 2C22A 5T7LB 5ETVA 4K4VA 1IR2A 2VC1A 3KNGA 1GMVA 2M2BA 4OI6A 3CMES 5DG7A 2V8HA 2DPJA 5EWGA 2Q3PA 2IBOA 4ZN1A 1N36J 4PR6A 2CQDA 2F4VF 2O3DA 2R8KA 2MY8A 4QR2A 4NCGA 3OLBA 4DR5F 1MWQA 3NWGA 2ZOMA 4ZA1A 5KFOA 3FFIA 4AYBD 3BYRA 1SXLA 3DRRA 1FDNA 4CYUA 2IFXA 4OYIA 3TUIC 5LMUJ 1RWWB 4P2SA 2COLA 1XMBA 6AT1B 3M8YA 3CDUA 4N8NA 5I42A 4ECVA 4OYXA 3MPVA 4PWDB 3DKDA 4FP9A 4DPUA 1PKUA 4AQYJ 2XYPB 3K57A 4F3QA 1VK3A 4G65A 1F6TA 5LMUF 3V4IA 2HHXA 1SL0A 3M8ZA 3KG4A 2B9WA 1Y9OA 2DNQA 3CT9A 4YQWA 1PBAA 1CC7A 2HZCA 4IOCQ 3KHGA 3IWNC 4AQYF 5D3GB 2GQQA 1SIWB 2KKHA 4ZN3A 4FN5A 4ITSA 1HBUA 3S7RA 2ZWOA 1D9FA 4KAIA 5HK4A 3H42A 1QUVA 3M30A 2DVIA 4A8XA 2BDPA 4LT6A 2CQ0A 1SQFA 4J5OA 4P72A 3VQSA 3GFHA 1M5KC 1WKKA 2BYCA 4RU9A 4Y2MA 3P49B 4J9OA 2PIIA 3CCSS 3J81U 1VQPS 4UOFA 3DU6A 3BQ2A 1PJ5A 4KJIA 1BWVA 1RT7B 4MIWA 1JJ4A 4Z7YA 3SCKE 2BQ3A 2X1GA 4LF8J 3M8QB 3DCAA 3UDCA 4JI4J 4RNOA 1U45A 3J81Y 1RTIB 4WE1B 1WOOA 1KRPA 2P8IA 2RUSA 1QSYA 2DO0A 3JSMB 1TELA 2L9NA 2HHVA 4LF5J 2QLBB 1SKUB 3BO3A 3KLEA 1QVGR 1U1NA 2VA3A 1RP5A 4IG3B 1T03A 4LSNB 2CIMA 2DR7A 1NH7A 3DI6B 3N6NA 3SCJE 3MM5A 3VAIA 4LF5F 2ROEA 1J5EJ 4Y6IA 1FXLA 1BD6A 1RTHB 4OI0A 3I82A 1JXLA 2FQQB 4L3NA 2PMHA 4MFBB 2VHGA 2DGWA 2JH3A 1Z1ZA 2MPUA 1S6PA 1CJUB 2DNLA 3FMWA 1J5EF 2F8EX 5B0CA 4ZVQB 4HHHA 2HVDA 4YDXA 2HQFA 4CNYA 2X3GA 1EETA 3I0SA 2BKOA 5MLCV 3QGIA 1GK8A 1E6YB 1K47A 2YKNB 1REVB 3CNQP 3GTYX 2VJVA 4URGA 2O67A 3GR0A 1VQ6S 4YFUA 3MD1A 2D1CA 1QUPA 3D6FB 5I3PA 2BOPA 4B3TJ 3T1HF 2BJ9A 3H20A 4UOHA 3CTRA 2GIRA 5KFMA 1FI4A 4WFXA 3HM9A 5CYMB 4WYWA 4X66J 2ADCA 3OSPA 2ASYA 4CLSA 2XG8A 3U1NA 3QGHA 2RUGA 4XK8C 3GFXA 2GX8A 3FCHA 3PTWA 2A6MA 2XS7A 1T05B 3GZ7A 5KFVA 1FVSA 3NG8A 2Y3YA 4ZS6A 2RS8A 2ATCB 2VDHA 1WHVA 1ELOA 2B7BB 1XK8A 5D8HB 3AB4B 5CYJA 3MWBA 1JQGA 1Q53A 4I2QB 4DR4F 2E1MC 3VVUA 3G2XA 3EZUA 2KG1A 2D74B 5L46A 1MWYA 2CQCA 3S8SA 2E7VA 4B9VA 2W25A 4TXSA 1H7WA 4J9VA 3ILOA 1KOHA 3DLKB 2XLJA 1RXOB 5A8RA 1I3OB 1IWAA 3GSDA 1IKVA 1P9QC 3UNYA 1EP4B 1K8AT 3RAXA 3ZZOA 1H3DA 2XQCA 3FBBA 4X4SA 3VTIA 2WHOA 4R0JA 4A8SA 3KJQB 2VDIA 3IM9A 4CLPA 1DLOA 3G8SA 1RWMB 1ZTTA 1B64A 4PG6A 2XYGB 3EZ5A 1H72C 3SSSA 4ANCA 2CDQA 3H8YA 5SZTA 1Z4UA 1IM4A 1SJFA 3L7PA 2UU9F 4JP8A 3AD9C 4OI4A 4LSLB 1Y11A 4LRCA 1Q5VA 3T41A 3E01B 4KRWA 2V2ZA 1NDKA 1TKDA 2G2OA 5E3PA 4P52A 3ZFVA 4M5GA 1RHKB 1I1GA 4Q8EA 3KFWX 1KQKA 3QGGA 5H9EJ 2AJQA 3W8PA 3EDRB 3HVAA 4Q2MA 4IRKA 2DK2A 1S48A 3NNHA 4NASA 3VF0B 1IKYB 4KPYA 4RW4A 5I3UB 5KFBA 3R2DJ 5GMDA 2H65B 3NP5A 4J91A 1MU2B 2Z4PA 2HS4A 1T9UA 4LF9F 2HMIA 3GIRA 2Y1IA 3IWLA 5FD1A 8AT1B 3MM6B 2HBZB 3QATA 2OFHX 3JTNA 2ZBRA 2FJEB 1RCXB 4WFNQ 4F50A 5ETKA 4NYZA 4LFCJ 2OSRA 3LP0B 5IT4A 2I0XA 2GGPB 1WEYA 4YB6A 4QU6A 2UV8G 3M9OB 1ZM4A 1VBXA 2AT1B 3R8YA 5HMXA 3Q8YA 2XMAA 1HA1A 1NZAA 2VPXB 4O4RA 2YH0A 3FVYA 2AF6A 2VFUA 1HNXJ 5LJ3Y 1TL4A 1S0OA 4AL5A 6FD1A 1RTDA 1HW9A 2KRBA 1YTYA 5E2QA 4CWBA 4CH7A 2D3OR 2IA6A 4M5DA 5HMWA 1KTQA 2AX0A 2CPDA 2MYFA 4U7CA 1JKHB 1K73T 4U7UD 1SJ3P 4KC5A 1NNDA 1YRUA 2CQ1A 2MHEA 4OZ1A 4OYZA 1VC0A 2JX2A 2A10A 2D3UA 4QR1A 3LWMA 3NWRA 1IXKA 3R1LA 2CPHA 4IO1A 2EK6A 3R5BA 1FX4A 2FVQA 4NLXA 4ICLA 2QFIA 2DNYA 1L5UA 1AT1B 3CCMS 3AJ2A 4YDDB 5KFUA 5ETLA 1QAYA 2FLLA 2XMMA 5IV4A 3IC1A 2ZKUA 1VC5A 1NJIT 3ENAA 3EGNA 1KBRA 2HSEB 4QPXA 1GMUA 4DPYA 2RNEA 4MK9A 3HVRA 2HHPA 1NM2A 3BGFA 2IVFB 3UDLA 4C3KA 4NI2B 3S01A 1MROA 5CZXA 3EVMA 3U1MA 3C2PA 1X9WA 2XLIA 2XI2A 2EBEA 2YH1A 4DR2J 5T41A 5DM7Q 1D09B 3Q83A 3MMAA 1BLUA 4MIAA 4V19X 4UTGA 1SBRA 2B5JA 2XC9A 1IR1A 3HHEA 4ZCMA 5KFEA 1XR6A 1X8DA 2KVQE 1TL5A 3C6TB 3R27A 3JSYA 1DURA 2ERRA 1S7IA 2J0WA 3HHNB 3BH7B 1GXTA 2IAJB 1JJ2R 4S0MA 4ZP6A 2R9LA 4ED5A 3QBCA 2MGZA 1XNQJ 1TKZB 3D7SB 2BOAA 5AE1A 4WPAA 2VBZA 4O4GA 4KQZA 1WC0A 2OHDA 2ZEJA 5K20B 3HVWA 2BZ2A 2VG6A 3EMTA 2LDIA 1S6UA 1FRLA 1XNQF 2GA7A 2LP4A 2HK2A 5B09A 1FXDA 1JLGA 3PJXA 2W2QP 1GX6A 4J9MA 5DDRC 3RTVA 4FF2A 5CHCB 1C1CA 1LWEB 3MMJA
chains in the Genus database with same CATH topology
3NLCA 4PXBA 5LMNF 5L1KA 1JIHA 4QWBA 4Q0BB 1HWJA 3E8OA 1VQMS 2DR9A 2I1RA 2HLUA 3KK2B 5JVHQ 4JOUA 2KJWA 2KJVA 2M4MA 4B08A 4IUFA 4M63A 2OFGX 3OR2B 3MI7X 2J9CA 4OZJA 5LL6d 1RT2B 4DQQA 4CT8A 2LEBA 4H4OB 4AE5A 2DNKA 5CYQA 5E5NA 2UUAF 4OFZA 5L9XA 1TQLA 5E33A 2J9DA 4LFAF 3K8WA 1Q16B 3Q2SC 4NLVA 3KLVA 4ZVEA 2XEXA 2ILZA 2IC3A 4OHZA 4A8FA 4TYBA 5J2MB 2ZOFA 1K0VA 1S97A 1QAIA 3QWUA 1B7FA 3F44A 1WEXA 1LFPA 3OL9A 2OJ3A 2GMJA 3TP2A 1R31A 5C42A 3M9MB 2JVRA 5J1EB 2OPPB 4MKYA 4I64A 3RW6A 2JRSA 1N5QA 1YWXA 1Y00A 4A46A 5L1JA 1FKAF 3DOKB 2R8GA 1VQYA 1B0TA 2GNKA 1NK0A 4O3QA 1LW0A 3E3XA 2KHCA 4DSFA 3FQLA 4B02A 3QIPA 3PACA 3O8WA 5L8RC 5CQGA 3EYZA 2OMLA 2MZJA 3PXGa 1QLNA 1S9EA 4B3MF 3Q2TC 3CCRS 4CIOA 1HPZA 2E7WA 3MD3A 3WX4A 4EBEA 2O1PA 5IFMA 3ISNC 4WFZA 3SFGA 1DTQA 4H4KC 4I69A 4FVCA 1UVMA 2EG1A 4X4NA 1MSWD 3LQVA 1S1UA 3QO9B 4I6AA 4CO1A 2ASDA 4H4MB 4PQAA 2M9KA 3D1HA 3ISND 1HNWF 1V3ZA 3QZ7A 3M32B 5HROA 3ZZUA 2B4PA 2WW8A 4NCAA 3PR4A 2K7JA 1FEHA 1WI8A 1WI6A 5KFAA 2E1AA 3DMJA 4JV5F 1X4HA 2HFZA 2RRBA 1E6YA 2QMXA 1ZPWX 5K8NA 1TKXB 3NAIA 4QZVB 3WBZA 1HQUA 2NS1B 2BXJA 4AUKA 5KFKA 2IYGA 2FB0A 2E7XA 2AYMA 2VOPA 2RQKA 3OL7A 4KFBB 4DV4F 1S1VA 3PFOA 4ILMA 3DXSX 3EPIA 1O0PA 2V4JB 2K7KA 4N47A 4O3SA 1H98A 2I8EA 1Z2ZA 4QYRA 4O3PA 5A8RB 1VBZA 3M1VB 1S77D 1S0NA 1FDAA 5K8PA 1CEZA 4JI7F 2D9OA 4TU7A 4GC7A 1LKZA 3CD7A 5JXSA 1GXLA 2LYVA 1KOOA 4QWEA 4NA1A 2Z0GA 1KEKA 1SL1A 4A8OA 3VAHA 2W4PA 2CPXA 3CC7S 2XY5A 2ZD1A 1LWFA 3FMBA 4NRTA 3TVKA 3Q8PB 5GVQA 1SL2A 2E9TA 5HMZA 3I0RB 2CRLA 3L09A 2JFDA 3VZHA 3GQCA 3US5A 4DR7F 3OR1B 2KN4A 2MKHA 1CQNA 1ZM9A 3QGPA 4ZPCA 3QLHA 1DJ0A 1UEVA 3MAQA 2V9WA 4WKRA 1DLOB 2ILYA 3K5OA 2I9SA 3AY0A 2YNIB 3ONQA 4P7VA 1K9MT 4DFJA 4E0DA 1WF1A 1R3NA 4PQUA 2DGUA 5F0WA 3KJVB 1FJEB 3OXGA 3DLHA 2HNYB 1FF2A 1ZM3A 3G4SS 1DTTA 2R7OA 2LEAA 4N41A 4G1QA 2JHEA 3KHRA 2PE8A 4E98A 3KK3B 4UY85 2HPUA 1OPIA 1G1XA 1RKIA 2BM1A 4KHMA 1Q8BA 2YWGA 4X4UA 3IRXB 2KB2A 2EKYA 4QOTA 4DR1F 1HMVA 5DG8A 2Y1RI 2UP1A 3ISZA 4N56A 2LCWA 1YRXA 5K9FA 4YB1P 4J9QA 1UEUA 3HXMA 1RYRA 3MTKA 4EUVA 5DDPC 1NJYA 3IR5B 5K14B 2XMUA 2YWFA 4LVNP 4I4BA 1FDDA 4YHHF 2MSSA 2KHDA 2NLWA 3FSYA 3THVA 4ZVHA 3HK2A 1ROFA 2L48A 2RU9A 3PHEA 4NLQA 3DLKA 3CC4S 1HD1A 2QA2A 4F3OA 1YSJA 2GCFA 2DTJA 2W8KA 3CJ5A 2MJNA 3K5LA 3HF5A 2MQOA 3MEGA 1KLMA 2F8HA 4RBUA 4CO2A 5EGYA 1SJ4P 4OLOA 5THWA 2ROGA 1N0UA 2BW2A 1BQNB 3DM2B 3OUYB 3IG1A 4A8QA 1RWUA 4JI8F 2W8LA 2DT9A 1VQNS 3N79A 1WG1A 5G4DA 1DFDA 2EPIA 4OJ1A 3FSXA 1HARA 4DL4A 5LSRA 3J80Y 2R8JA 5KOWA 3D0GE 5LT5A 4IR9A 5F41A 3FQKA 2RVJA 4RW4B 4C98A 2P6TA 1Q81T 1TL3B 1NEEA 3MDFA 4XDCA 3ZZRA 2E5LF 4IQMA 2V4QA 1FRIA 2GIQA 3DLEA 3TVYA 2BQUA 3CVKA 4DFPA 2UVVA 2ZZNA 2QRRA 3Q0AA 1UWBB 2PSZA 3AA9A 4TY8B 2Q1LA 2YNHA 5E0OA 2D9PA 2FLPA 1RT3A 2HHQA 4K4TA 2ROPA 1P27B 2SXLA 4LIRA 1VQ7S 2MQMA 1NHUA 4ZDNA 4ED1A 4C8OA 1AFJA 1X5OA 2WCXA 4ED0A 3BR8A 5KFYA 2OAUA 1WHWA 4UY8T 2VBYA 2M8HA 5L9NA 5KG4A 3JTPA 3TI0A 4J37A 3HP6A 2HQIA 3M8RA 4ED3A 4IRCA 2DNGA 1DRZA 2OPSA 3EUNA 2B56A 2G13A 3TA0A 7FD1A 4UQGA 1AROP 2HRYA 1X4GA 2DR5A 2KRRA 3TAMB 1U2RA 3BSAA 3DYAB 5DQGA 1HFEL 1FA0A 1V6HA 2B6AA 2MDAA 3ZZTA 3NGKA 3KK1B 5B0BA 2VPZB 4RNNA 3KLHB 3K59A 2C2RA 3RB0A 3CD0A 3E01A 2ZFHA 1M5OC 3H2UB 4OX7A 2P9CA 2PFFB 2NPIA 4OX8A 1A7GE 4QPTA 2MZRA 3W2WA 2XGQA 3CUNA 4L72B 2DNZA 2HFNA 4WXOA 3I5CA 4F4ZA 1IKWB 3H5SA 3HHKA 5KFHA 2CZVC 2ZM6F 4ETZA 3WC2A 2HVIA 1HBOB 1Q78A 3K2YA 3J7YU 4YOEA 4ELTA 3PNIA 5KFPA 1Y0HA 3DLGB 1HNVA 4LIWA 2M8DB 2AD9A 1L3VA 2HAIA 3NNAA 1FE4A 5C24A 4DUZF 2UUBF 2XHWA 4DS4A 1S1XA 3R1HA 5GMKa 5GADI 4YP3A 3OHBA 1S1WB 1UVKA 2XNRA 1WD6A 2C2DA 1FD2A 1KVIA 2NSBA 4AL6A 5KG2A 3ICLA 1RTJA 5IM0B 3MURP 2FHKA 2HGNA 4K4SA 5KG5A 3PX4A 3RRKA 4M1KA 2KVIA 5HN0A 2QE5A 4LF4F 2EFQA 1FJ7A 1RTDB 4ZP7A 2NSCA 1N6QA 1R27B 5B08A 3PIOQ 3ZZPA 4BWMA 1GQEA 3GG1A 2DBBA 2YNGA 4GKKF 4KE5A 4WZMA 2PDAA 3Q24A 2NR0A 3CJ2A 4Y0FA 3F56A 4M5DB 2CKWA 1FXRA 3B78A 1U1PA 2YKPA 1XR7A 2MMYA 4OHWA 4F4KA 5HMYA 1NB7A 3GE9A 5D4OA 5IS2A 2CFXA 3M9NB 4EBCA 2YKOA 1S6QA 3KKFA 1JLFA 2CJ9A 1F9FA 2OIHA 2BANB 3IWXA 4ZOSA 2VG7A 5DQIA 1KNZA 4BC7A 2ZITA 1KC8T 5J2NA 2AYGA 2LU1A 4NLGA 2H9ZA 4EEYA 2AWZA 3CWJA 3DDKA 4IOAQ 4ATNA 3PJWA 3S1TA 1L3UA 4UUWA 3HO1A 3TR5A 1S99A 1QJHA 4KIAA 4NLSA 1TL1A 1TZ0A 2E5HA 4ZKAA 1YQHA 1X4EA 3M2UA 2QMWA 2F1FA 4IH7A 3K7RA 4C97A 5EWEA 3GV7B 2R2TA 3BO2A 3RYLA 4PG5A 1F5BA 2HNDB 2WOMA 1YRTA 5KFNA 3V6JA 1H2TZ 2FD2A 4CTAA 1M1KT 5A0YB 2KZMA 4K5SA 1SJRA 2I38A 2XMTA 1VRUB 2XBPA 3ITHA 3I6PA 1VHFA 1YJ9S 4EBDA 3C3LA 4TLQA 2DR8A 3N0VA 4FF4A 1YITS 3OVAA 3IR7B 4HT7A 2FC8A 1QSLA 3I4HX 3OFGA 4KKOA 2YKMB 1U49A 2CQ2A 2M7SA 2ZHAA 3IXQA 1KD1T 3OTCA 4OIXA 2GGPA 2N7CA 1R0AB 4DQIA 2ASJA 4TU8A 1HYSB 5GAGU 3IAS9 2OO4A 4ICLB 3TA2A 1KLNA 3V6KA 2X1FA 3M6VA 2