1SK8A

Crystallographic snapshots of aspergillus fumigatus phytase revealing its enzymatic dynamics
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
435
structure length
435
Chain Sequence
b'CDTVDLGYQCSPATSHLWGQYSPFFSLEDELSVSSKLPKDCRITLVQVLSRHGARYPTSSKSKKYKKLVTAIQANATDFKGKFAFLKTYNYTLGADDLTPFGEQQLVNSGIKFYQRYKALARSVVPFIRASGSDRVIASGEKFIEGFQQAKLADPGATNRAAPAISVIIPESETFNNTLDHGVCTKFEASQLGDEVAANFTALFAPDIRARAEKHLPGVTLTDEDVVSLMDMCSFDTVARTSDASQLSPFCQLFTHNEWKKYNYLQSLGKYYGYGAGNPLGPAQGIGFTNELIARLTRSPVQDHTSTNSTLVSNPATFPLNATMYVDFSHDNSMVSIFFALGLYNGTEPLSRTSVESAKELDGYSASWVVPFGARAYFETMQCKSEKEPLVRALINDRVVPLHGCDVDKLGRCKLNDFVKGLSWARSGGNWGECF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 3-phytase A
publication title Crystallographic Snapshots of Aspergillus fumigatus Phytase, Revealing Its Enzymatic Dynamics
pubmed doi rcsb
source organism Aspergillus fumigatus
molecule tags Hydrolase
total genus 154
structure length 435
sequence length 435
ec nomenclature ec 3.1.3.8: 3-phytase.
pdb deposition date 2004-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00328 His_Phos_2 Histidine phosphatase superfamily (branch 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 1sk8A01
2EKBA 2HHJA 2OWDA 4D4MA 2H0QA 1DKNA 1NT4A 1SK8A 2DWOA 3K4QA 3PGMA 2P2ZA 3HJGA 2P6OA 1UJCA 4FDTA 3OI7A 4D4KA 2ENWA 4ODIA 3E9DA 1DKMA 2P79A 3EZNA 4ARVA 2H4ZA 1SKBA 2H52A 2P30A 2HPAA 1DKLA 4HBZA 1YJXA 2PA0A 2F90A 3EOZA 1V7QA 2I1VB 5AJYA 3ZHCA 3GP5A 3IT0A 2A6PA 4JODA 4TSRA 4AROA 4EMBA 1DKPA 3FDZA 3LL4A 3QPWA 5HR5A 1CVIA 2YN0A 1BQ4A 2P6MA 2P75A 3IT2A 3NFYA 5HTKA 4ARUA 3NTLA 3C7TA 2EKZA 4FDUA 5AJVB 3KKKA 4JOBA 2QNIA 5AK0A 1ND5A 2BIFA 5CX4A 1RPTA 4PGMA 3D4IA 3K4PA 4PZ9A 2WNHA 2WU0A 1ND6A 3BIFA 2AXNA 3IT3A 1SKAA 5PGMA 4MA4A 3D6AA 1IHPA 4D4LA 4IJ5A 4GPZA 2P77A 2P9ZA 2GFIA 3QPUA 1UJBA 3F2IA 4JOCA 2P78A 1QWOA 2H4XA 5AJZA 1QFXA 3GW8A 2DWPA 1V37A 4E3WA 1DKOA 1E59A 1FZTA 2A9JA 1RIIA 3MXOA 3FJYA 1QHFA 3D8HA 1RPAA 3E9EA 1BIFA 2OWEA 1E58A 2ENUA 1YFKA 2RFLA 2YN2A 3IT1A 5AJXA 2P9YA 1BQ3A 3QPVA 1SK9A 4IJ6A 1H2FA 1C81A 3FDZB 3O0TA 1K6MA 3LG2A 4D4JA 3F3KA 1TIPA 5CU7A 1FBTA 1C7ZA 3DB1A 4ARSA 1EBBA 1H2EA 3LNTA 4GPIB 2P2YA 3E9CA 4EO9A 1C80A 2P9FA 1T8PA 1DKQA 5AJWA 2WNIA 3MBKA 4QIHA 2EOAA 3DCYA 3GP3A 5CDHA 4PZAA 3R7AA 1XQ9A 2IKQA 2HIAA
chains in the Genus database with same CATH superfamily
2EKBA 5IPFA 4AAYA 3KJNA 1V6AA 1R6XA 1Z4OA 2VDWA 4QQNA 4XVHA 3DXYA 1T9GR 3C5VA 1Q1ZA 3RYIB 2W8ZA 1EUZA 2O7QA 2ZOSA 4XWAA 1UBNA 2GN9A 4ZQBA 4E1AA 3HY6A 3OWXA 2BFBB 5LBTA 1HNWB 2VNHA 4PPQA 3U3DA 1R6VA 4UOZA 3ND7A 1U2QA 1F5SA 2LBPA 3R7WA 3ZCSA 1DX4A 4B9AA 1A7KA 2CB0A 3CIOA 3I3SR 1GGMA 2WYWA 4H59A 1SKBA 1L9KA 4OAOA 5JJCA 1EM6A 1GPH1 5AQEA 3KSDO 2O2ZA 3LQRA 3IQXA 2XCSB 4GR9A 2H5IA 1NKSA 1X1QA 2ETVA 1GR1A 4E5DA 1S3GA 2WSSA 4WBXC 1OY1A 2O0MA 2OK7A 3OQ1A 1QFYA 3C74A 3D0OA 2JGEA 3GGSA 4JEUA 1TNDA 1XTPA 4Q21A 5NULA 1GA1A 3ONFA 2NZWA 4NE7A 3T9CA 2AC2A 1N0IA 2HGZA 1WBJB 1IIBA 3PUVA 4WW0A 3TOZA 2HWXA 4FE3A 1SZCA 1MGOA 2RKBA 3DPIA 1RQPA 1Z6QA 3FFTA 4PWZA 3DBIA 4L4YA 1E6KA 5AI6A 2JLVA 4TLMB 3NWEA 4UE2A 3KR2A 3KQQA 5P21A 1NP6A 2H0AA 2ZJ4A 1XLVA 1DNPA 1YJQA 8OHMA 4P9NA 3STXA 1R0ZA 3R0XA 4OK6A 3FM9A 4HOYA 5IC4A 4L85A 1BX0A 2VR1A 5JZMA 1T9CA 2Q1WA 1X7WB 4ZV9A 1U28C 2R6CA 4UEOA 3TL6A 3RKUA 1A7JA 4D0NA 2DWCA 5I5EA 2ZSKA 4QVGA 3RRNA 5CEFA 5DLDA 2WSMA 3G2NA 4B6SA 1QGYA 16PKA 1OH7A 1I32A 1UUFA 2VTBA 3ABSB 3UKDA 1PJZA 3UJDA 1Q11A 4J0HA 2UUPA 4E33A 4YRGA 3FPEA 3DKRA 3T7RA 4P32A 1PZXA 1N2OA 3LYLA 4RCZA 1Z2NX 4FYYA 2F1OA 3G9UA 1OWOA 1CETA 4EMSA 1RXSA 2IX9A 3V5NA 2R6AA 2BWJA 3S40A 5K51A 3CCFA 3L7DA 3D2AA 4GP7A 2BGGA 3BGDA 1OLXB 3TN7A 2EKDA 4M1EA 5KTSA 2IC5A 2BM9A 3P9PA 4OX9B 1WIWA 4GWKA 4BP9A 3LUJA 4FNOA 4TT3A 4YRBA 4E30A 2ORIA 3ESQA 5ADWA 4E07A 5FOUA 2JKZA 1P1CA 2CWWA 3C4JA 4OQXA 5F3DA 3Q7EA 4PGFA 2II6A 3RC1A 3TEFA 4B73A 2CBZA 3HA7A 4J1SA 4R8MA 1RXEA 4PIVA 2CL7X 4G9BA 1Y48E 3FKJA 5AKKA 2I4LA 1XP8A 2EZUA 3GFPA 3GJXC 4ZMRA 3HDYA 3ZIDA 1C7ZA 2X4LA 3PHIA 4G36A 4OB8A 2HOQA 5AOAA 1HO3A 3VNAA 5AK5A 2V6GA 3B12A 4AQYB 1WXDA 4LDQA 5AK6A 1C80A 2C1XA 5IAJA 2HADA 3AHHA 1D8TA 4ZT3A 4UHDA 3TLYA 4X3PA 4D5EA 4PTLA 3T7TA 5GJBA 2HZBA 1M6EX 3MWYW 3L05A 3WLKX 4DA6A 2BHTA 3FZYA 3AY7A 1J20A 4MR7A 2IKQA 4NZZA 2WP0A 3B1XA 4UTZA 1OXSC 1JL3A 4ZAVA 3U5ZB 1XNRB 4RZUA 2JGAA 1ADGA 1YOVB 2A7QA 1NU6A 1TPYA 5HP4A 4GP6A 2Z08A 2PSHA 5CX1A 8ATCA 3KIPA 4JYZA 1J4AA 3MLBA 2G1KA 4CIYA 1E77A 4Q4AA 3ZTYA 4G37A 4LWPA 5TPWB 4UTRA 2HN9A 3FCYA 2Y0DA 4Y1EA 3RSCA 2B7BA 1FQJA 2PS3A 2QW0X 3Q11A 5AW1A 2BBWA 2X0FA 2YZNA 4KXWA 1SAYA 2CF6A 1M2EA 3OKFA 1WVGA 3C3BA 1MGPA 3LWNA 3NBZC 4CDMA 1ZMXA 5IJ0A 4XKJA 3JWHA 4QDZA 1T4CB 3QVJA 4O4HB 2G77B 1EVLA 1RQRA 4L8GA 1UQTA 3DMTC 3GEMA 5BR4A 5LDHA 1E66A 1WUTA 3QFHA 4Q6WA 4CU2A 1NBAA 2DQSA 1P81A 2PYDA 4NYIQ 2VZ8A 3N0TA 1BQ4A 4HQ0A 3Q7PA 5E1MA 5J1TB 3SGLA 4HP8A 5HFNA 2RGXA 2P9BA 3ZCRA 3IUJA 3MWFA 5T8KA 2IOFA 3HDHA 4ZMBA 3CQ9A 3SLGA 4V3CA 1WXIA 2BEWA 2NM0A 4WZAB 4EJ2A 3NHFA 4HDNB 4BNWA 1EWYA 4R6WA 4BO8A 1P75A 2WHYA 3UZUA 4BECA 4E3ZA 4H7EA 4CQLB 4L07A 5L7TA 3VC2A 4DEVA 2JFUA 1UC8A 1NQUA 3GEHA 3UGQA 2H1FA 1ANKA 3PFFA 3AEKB 4KE8A 3N0RA 1XTIA 3TRDA 1RCFA 3W8DA 4BLQA 2AXNA 1T2DA 2O54A 3BHMA 3ZI4A 5C81A 1V39A 2F1JA 2F3RA 2W2PA 3VNQA 4EHLA 2BEJA 2IHKA 3FB4A 3CF0A 4IIFA 4L9RA 4JMPA 2XTJA 1XPJA 1WY5A 1YE8A 2HF9A 2XKAA 4HY3A 3ZHSA 3CVYA 1MHTA 4KR3A 3G0GA 3VJRA 2ZYSA 3KT3A 1F6DA 3A4VA 2C03A 1OILA 5B7QA 2XAAA 5DGTA 1V5GA 2CFSA 1XLTC 2RGWA 1JKMA 1PKEA 1UP4A 2FSGA 2XE4A 1V37A 1R9JA 3BMCA 3DLIA 3LYAA 5J5AA 1MPXA 4YJGA 4CLOA 5DNVA 3KNZA 4OYLA 1YVPA 2UXCB 1SXGA 5JY1A 1J56A 1VHJA 3BSWA 3DTNA 3KJIA 2D7DA 3DW3X 1T3LA 4YNBA 4RMIA 5CAEA 5JI3E 1P1HA 2YJNA 1CS0A 3QY0A 4DY4A 1P62B 4C7VA 5LNK1 1I9GA 5LKAA 2ZYDA 3DFMA 3C39A 1QIKA 2O2HA 1SK9A 4L3OA 1ICIA 1U7TA 3KJEA 4MKHA 5FL3A 3FG9A 3SF8B 1GN9A 1GTL1 4MQBA 1N1GA 4KBGA 4Q1AA 5KNDH 4LHVA 2P2CA 4CLDA 2XADA 2EGGA 3OM0A 4UVGA 5AUNB 1P9WA 1QX4A 4ARCA 2HRQA 4L76A 2WSBA 3E4DA 5F4ZA 4Q12A 3S5UA 4HT3B 2CNLA 5E8RA 3JQAA 4KO4S 4S1TA 3QE3A 4BGDA 3PL5A 1U7ZA 5CIYA 3GLIE 4Q37A 5KTPA 3TJMA 2LIVA 1WCV1 2MOKA 3OJEA 4DV6B 1WP4A 1L7XA 3RVLA 3U0VA 3J81k 5HJ7A 5KHOC 4QOGA 1OGIA 1T0HB 1Z88A 2ZBEA 4MR9B 3R7AA 3IERA 2WBLC 4YMHA 5H0IA 1MMFB 2W93A 4KIWA 4KWTA 4JKIA 3ESYA 2GVDC 4MUIA 3EAGA 3H6GA 5FQNA 4DQVA 1ZIPA 1YNOA 3BKWA 3WK5A 1VPEA 5EJAA 4FYVA 4D3XA 3IOYA 3OZUA 1LA2A 2C99A 3FZEA 4IJKA 2QUBA 1DWQA 1ENZA 4URVR 4K9LA 5HZHA 4MVJG 3A1CA 3FFAA 5EXSA 5FL7D 1NXXA 3AIOA 3BRWD 1HE1C 2QD1A 1YQQA 1M2NA 4GKBA 5DZSA 1G63A 5EP2A 4PR0A 3QEJA 1ZRNA 5KQMA 5J3JA 1VI6A 1T3SA 3HP7A 4AIRA 1DCMA 1P7ZA 4XUDA 3EIHA 1E99A 1YFZA 3MMPA 4S1WA 3U1BA 2WOOA 3JQ6A 2Y1GA 1MG0A 3EZLA 3OLXA 1CX9B 1TMKA 1T8RA 1Y4AE 2VF4X 3DBLA 3NHPA 4DKJA 2XMCA 2BE9A 2WG2A 3NWJA 3THXA 4RW0A 3SMVA 3QF4B 5BVGA 1THMA 1YDEA 2H4HA 4YCBA 1YT5A 3FMGA 3IE0A 3E5HA 2CXNA 4MMYB 3K0AB 5HHTA 2IHZA 1KZ7B 2FOXA 3RSGA 3WQBA 1NFQA 2VATA 5FR2A 4KPYA 3RBAA 1SPXA 5DNDA 1XQWA 1M2JA 1IBMB 1L5WA 1NA5A 2RI0A 2VTEA 3ITNA 3OHMA 3IDSA 1VHTA 2Y3IA 2EGHA 3GJ6A 3TAXA 1NF2A 1B43A 2QK4A 2GAOA 3T95A 4PHHA 5LDGA 5K09A 1EGAA 3O9VA 2X2PA 4BASA 1RP1A 4NAHA 5MN6A 2FV8A 3SBEA 5A5DA 5ED4A 3NJ4A 4JYPA 5JBQA 5C9ZA 4ALIA 2BP7B 3CH5A 3T3MB 3NYRA 4JL8A 3OOYA 1ZGJA 1DAIA 3WLAA 4TVBA 3TINA 3AJRA 1Y3DE 5KTRA 4KUHA 3D8UA 1G0NA 4PYMA 5DXAA 1QHYA 1I01A 3KTAA 5J5VA 1IEVA 5KVSA 3KTOA 5EZQA 1H9BA 1NV9A 3OM9A 4L74A 1TM5E 1RR6A 2IQ5A 2BSQA 1V26A 1PGPA 5HRCA 3PTAA 4O4JB 5TIIA 2HLDD 2IYWA 3MGKA 2PIAA 3IBCA 3RVJA 3L7NA 4C20A 2ZSIA 3MTIA 4O4IF 3OZVA 4HGPA 3I28A 1Z6XA 2H7VA 5DTJA 3UHJA 5LMUB 1K0FA 1IQRA 1XD8A 1XZDA 3IR5A 1XP5A 1UC4B 3QG5A 3I9NA 5JEEA 2SECE 5H8WA 2R7KA 5KBYA 1GNPA 4Q16A 1JHVA 2YYZA 3JWIA 1RYBA 5LOVF 2REBA 2XH8A 1CFZA 1ESCA 3ZY5A 1QB8A 3DBHB 2O8NA 2WG0A 2UXBB 4HRYA 4RPKA 2J67A 4YRDA 4HQKA 5H3CA 5DLEA 5KAPA 3G9XA 3I37X 8AT1A 2XRYA 3T8YA 1GNTA 3RYCA 4MB2A 2IIPA 4UVEA 4J7AA 2IX3A 3PRYA 3MZ0A 1S4MA 2WYUA 4R2IA 3UWOA 3EIQA 5JXHA 1QE3A 1Q57A 1SO8A 2DULA 3AH8A 3LDGA 5AKYA 2VPQA 1GUBA 4Q3OA 3MHTA 4PXSA 3VR0A 2OQRA 3B6IA 5IBRA 4D3DA 1N5IA 1FDTA 2GCEA 3B70A 2HK9A 1RWXA 5LLDA 4XPIB 2C9MA 4MS3A 3VM6A 4B17A 3E84A 5I47A 4UHEA 1IJBA 1NWCA 1WQ1R 4IVNA 2DLDA 2IS1A 5JG7A 3X0DA 4OGGA 3SX0A 2ISCA 2LP4Y 1SQFA 1J0XO 2P2ZA 4FQ7A 4HYYA 2GSWA 1EK6A 3WLSA 2V54A 4RFSA 4BBPA 1E8MA 4FMPA 2QZPA 1CJCA 4HH4A 5G41A 1SCJA 2RG7A 2YWJA 3A6FA 3PHGA 4BO3A 1KAOA 2C98A 3EZNA 1DEKA 2DJ5A 4NIMA 5KTNA 1YI1A 4LN1A 4TYWA 3MTAA 4HBZA 1FS4A 1L5FA 4ND4A 3MWLA 1H0KA 4QULA 5IWCA 4J29A 4J7UA 2EP5A 1TJPB 3M0EA 2OV1A 2WF8A 4UM9B 3UHPA 1N2ZA 4BQNA 2VSQA 4RHCA 4R1LA 2HJHA 1M0TA 4HD8A 5FIUA 4BU0A 4EGSA 2IEGA 3OD5A 1FK8A 2VHVA 3IH5A 4WLOA 4YV1A 2ZUEA 2MSNA 1NZFA 3K1YA 2GRAA 3Q2OA 1AM4D 3QBDA 4KUEA 1F2DA 5CYFA 5EXDA 5P8WA 3SLKA 4ZQEA 5BXYA 2V8OA 1RJGA 3OZIA 4BO6A 3K71B 1J2YA 2W2LD 1P0FA 2YFQA 3BWYA 3OP1A 5TPZD 4BQRA 2IDKA 3WJ2A 3DKKA 3BFPA 1OBFO 1JAXA 1U0TA 1JXAA 3PITA 4YECA 1Z68A 4Y3UA 1PD0A 1MFZA 4OQEA 1J1ZA 4PLFA 4HZGA 2FGJA 3ORRA 3D8SA 5IS2A 3F98A 4IDHA 1W19A 2GN6A 3ZE2B 2AOUB 1HDIA 3BAFA 2ZUUA 4P92A 4CJXA 1KZGB 5F1PA 2GK4A 1EIZA 1YIAA 4C0SA 4DL9A 3HNRA 3PEEA 3TPCA 3LU1A 1PEAA 5JZOA 2RKWA 2Y68A 1LLFA 4ZVVA 2HIHA 3OIYA 3P0FA 5DK4A 5H5JA 1T3GA 3KQPA 1C1DB 3GWGA 3VHRA 5BYKA 3ANNA 4PLPA 3KB8A 2QX7A 1CE8B 1RWBA 2R8ZA 3JARB 2FSUA 4KUGA 1HFJA 3IRVA 4MPPA 4LDRA 4RSGA 1KJIA 2E4ZA 2FR8A 1G5QA 2JGFA 5ELXA 2FTKE 3CPSA 1IYZA 2Z3ZA 4OH7A 5EJ5A 2XHZA 4K87A 3CKYA 2GS9A 1QIFA 2RFLA 2AFIE 4E5VA 1S89A 4X94A 3LK6A 5IG2A 4LF6B 2WHQA 2H17A 2JJYA 1X38A 3ORQA 3QPDA 1DG1G 4DREA 4ZD6A 3T15A 2OVBA 1SBQA 2CMDA 4NPCA 4XD7A 2QBYA 4D8XA 1N2JA 3L1VA 2QJFA 2YWFA 3ZEAA 2XOKD 4EWLA 2P91A 4N5LA 4BE9A 4UDOA 3FDJA 4OFXA 4KXLA 4YBZA 4DWJA 3LFUA 1H2EA 2P7HA 1Z9BA 5HEKA 1OI3A 4EUHA 2QT9A 1AMNA 2R1VA 2WSLA 1X7WA 1I2BA 4P08A 1ZR4A 1ADYA 1N2IA 1PK7A 2A59A 3GRUA 4QRIA 2XMGA 3DCYA 3C5EA 3DPSA 3DTVD 1Y9EA 4IEFB 4Y6GB 3A31A 2VYVA 2CNNA 1ISPA 4KOAA 4EMUA 3WZMA 2QAGC 2QT1A 3USZA 2DQ4A 4BYGA 2FEXA 3AC0A 3KSMA 3RUAA 2CF5A 3E6AA 4RKFA 4Y0VA 4P4NA 3TIVA 3SICE 3VH1A 4XIYA 1UH5A 2GJ8A 3N8HA 5FTKA 1VI2A 1O57A 1RZUA 5DHRA 4G81A 3KZMA 4H18A 5E6UB 1F7VA 5LC1A 4EB8A 1U0FA 2SBTA 4CGZA 3GFBA 2ECOA 1MOZA 4R8LA 2FMIA 2PGXA 5BNFA 4U9IS 1EPUA 4CN8A 5CFNA 2VAXA 1GEEA 2RONA 4H7PA 3RV3A 4G5SA 2Y1OA 3TRKA 2G1PA 4OFWA 1ISSA 1GGKA 4GX0A 2KBEA 1IQ0A 1BE1A 2FLVA 5BMOA 1ZD3A 1N7JA 2E4WA 3LK7A 4ND8B 2XA9A 5JOQA 3GLTA 4WCVA 2IPOA 3JATA 4TLAA 3U4HA 1E4EB 2Q0HA 3BIOA 4FGUA 2Y0CA 4TTPA 3ZNOA 2AYZA 2C5AA 1Q3HA 2B30A 2IQIA 3C87A 3CZ9A 1JW9B 4KVAA 2CHQA 4KRFA 1E92A 3O74A 1RYMA 4TUYF 4UUOA 4UCXA 1E69A 4E21A 4FFVA 4Q15A 2XW6A 1A4UA 1EIWA 5E6SB 1Z75A 3GQVA 3TW6A 4GXRA 1V5WA 2BGUA 3GPLA 3PDJA 3T3HA 3RNLA 1SHJA 2LKDA 3AEQB 1T9BA 3O1LA 5CDYA 1NVKA 1O95D 1VL2A 1A1SA 2PKWA 3QU5A 2B1JA 1H4TA 3AKEA 3R9IA 4AF8A 1Z63A 4RSRA 1KEVA 1RAHA 4LDJA 5JNLA 3WL4A 3CNQS 2UVQA 2QRLA 3OZAA 3V80A 2AHOA 1H23A 2FQ1A 3DOHA 4MKXA 2W8BB 2VJNA 4C0BA 1EHIA 2ZITA 4AW9A 5JCXA 3FWNA 1N2CE 2KWIA 3CIFA 4IIUA 5C0OE 1J49A 1OC2A 1XTVA 3UB3A 2QQEA 3R6LA 4U5QA 3T5GA 2I76A 2JASA 3RBZA 5A4KA 4AUNA 1ORTA 5I9LA 1HRDA 3PNSA 4KJZA 5U1PA 4FXOA 3IAM1 5K8LA 4WESA 3WIEA 5KDDA 1MC1A 2ZJ5A 4YAGA 2WMDA 5EHIA 5FBKA 3N70A 5FWYA 2I7VA 4NZ9A 1P1FA 2R7MA 3C4VA 3SKXA 3ZUPA 4CDRA 2H8GA 1N4DA 5BOVA 3QJGA 1QTQA 5KVCA 2BY4A 2GFHA 4BC0A 3Q6MA 1M1YA 2HJWA 4G3XA 4KPEC 1USWA 1BW9B 5K4GA 2WB2A 2E87A 3QU4A 4O4HA 1TEVA 3A0UA 4JB8A 5C31A 1LJ8A 3NATA 2KQUA 5REQB 2PUEA 4LJ4A 4OB6A 1OW3B 3EY4A 1J09A 4Y2UA 3F4BA 2QGZA 2VXBA 4ZZ1A 5A04A 1ECCA 4ZV4A 5CBPA 1B14A 4WT7A 4Z49A 1BU5A 2ZKLA 4RJTA 2BVNA 3R7LA 1RWWA 3ILXA 4MV3A 2XGOA 3BM5A 3PNPA 3PPWA 1QDUA 4MAAA 1E5XA 5DJ5A 4E6PA 5CBKA 1ZCJA 3GVPA 5EHXA 5I3CA 4YUAA 5F3WB 5LIRA 1D2CA 3WLPA 1BDIA 1BGWA 1X1AA 1OXMA 3LUCA 3I76A 3SKVA 2GD6A 4CM4B 1O8BA 4IUDS 4ZDJA 1CT9A 2JI9A 5KDOA 1LQUA 3KEFA 3UENA 2I3GA 4A8TA 1UBKS 4J2OA 5ALLA 2P9HA 3A1VA 3BGWA 3WMEA 4BKPA 3LHKA 3QUCA 2Z2IA 2HA6A 2C8VA 4K86A 2C9ZA 5CM2Z 1DRVA 4K2AA 4FOLA 4W1SA 4B6RA 1IK4A 2O2IA 2QMOA 2QN2A 3WB0A 1NT4A 3LHIA 4HPJB 1E2GA 4C6TA 2JGKA 4L02A 2RGUA 1DAHA 1BG6A 5AW5A 3C6MA 4DNFA 4B85A 1GPLA 1QZ3A 4XX0B 3TQCA 4S2EA 5AKZA 1JZSA 2DPXA 3V9AA 3A9VA 2WJZB 3EWSA 4TWJA 2FAXA 3C7DB 1TF5A 1AN9A 4HEA1 4IDAA 3UCFA 4MR8B 3MELA 3W8NA 4ZYUA 1IJKA 2IYFA 3ZWXA 4DLRA 2PV7A 2A1IA 3DWEX 2BW0A 2ZU0C 3EH1A 4Q19A 3V8VA 1DKMA 3OZGA 4U2FA 2Z5FA 3QITA 3IPCA 4YAWA 4YCNA 4I1OA 4K9NA 1U7UA 4Q24A 3VSCA 2ADMA 1TCBA 2E2WA 1PDWA 3VO2A 1LEHA 1JDPA 1WKCA 2P0YA 1XU7A 1TO6A 1DO8A 4MS4B 4BJ3A 4KIGA 4F7WA 3RODA 5KO2A 3X1YA 3VYUB 4TKZA 4ANFA 4I3HA 4BX3A 5LXTA 2DM6A 1ZRSA 2ZXFA 4QPNA 1PVDA 3HS3A 3RJMA 4EQZA 1FDVA 4Y98A 4WBNA 4A4DA 1ZHHA 1S8NA 3I2JA 3G7NA 3W5HA 3IT2A 4M0MA 2OYSA 1V8DA 4OHUA 2Q5LA 3C7TA 4YJFA 2EKZA 4M1SA 1MB4A 5DCWA 5GM1A 2ORED 3FPGA 1W0KD 4X91A 1Z3CA 3ULKA 3G2MA 1I4DD 1CK4A 2ZSBA 3IBGA 2CJWB 3ABQB 1TCUA 4AYTA 4QZVA 5BVHA 1N57A 4O8ZA 3V46A 1VFPA 3EMBA 2ZRAA 1IHXA 1AY0A 2O05A 3GELA 3KZVA 1F2UA 3F73A 3UBTA 4GI5A 4JI7B 1A8HA 2ZYHA 2ZI4A 5KKNB 4MR9A 4IJVA 2IHJA 3TI9A 1MW9X 2X8LA 2ACEA 2Z9BA 2ZCUA 3OCXA 4FMDB 4H9GA 1JG4A 2XYHA 4GZMA 4MQ4A 1YZFA 3E3MA 5ICFA 3TNDA 2AQIA 4C0AC 2Y1XA 3WZ2A 3G2HA 3IQGX 1DCKA 2V1XA 4U5XA 2VCYA 3KOZA 1TQ4A 3URKA 4RACA 1C2TA 1G7SA 2UKDA 1TT7A 3H05A 4C3UA 3WA7A 4NCAA 4EKIA 2PT7A 3IMFA 4TVKA 3VTFA 3MOIA 4TTTS 2X9GA 3KDSE 2WQ6A 1GFWA 2GTHA 3P97A 4ZARA 1JLMA 4LZJA 4ENRA 4WXRA 3MOSA 4BWFB 2FFRA 5HQ3B 3LSTA 2FUCA 1Q0LA 3AFNA 1U0EA 1PCXA 1W35A 3PRJA 3KE8A 3ODPA 5FTWA 4WNAB 1Z73A 1HYEA 4KYVA 5EJ6A 1HQKA 1QHHA 2OILA 2R8OA 3D6JA 3L8CA 1U65A 4FEYA 1HE8B 4BNDB 1RPAA 1RZ3A 2QMZA 4D43A 4D98A 4PLHA 4LGCA 2L17A 3CVJA 3W9YA 5JALA 2BD0A 1YMUA 5JZ9A 3OTQA 1NVXQ 1PUXA 1VYTA 2VP0A 3QOXA 4HQ6A 3EGEA 2WW8A 3L0CA 1Z0ZA 2DFDA 4AICA 3CXUA 3H0EA 4ZQCB 3BMQA 4COOA 2VYND 1GHTA 2WABA 3RFCA 4O2BA 2CE2X 4KLZA 4GKKB 1PR2A 2OHOA 3IPXA 3LCJA 1MEEA 4KR0A 4IXWA 2QTLA 2YIVX 4EPXA 3I9V6 3PHHA 1UM9B 1Q0RA 3VGJA 7MHTA 5C4GB 5EWJA 3ZS8A 5BMVA 1XR3A 1T1RA 2WRZA 2FWMX 3R3UA 1JHRA 3C2QA 3DAOA 2WMNB 2AOTA 4XTRA 1QBGA 3WBBA 4DSNA 1RD4A 3ZDEA 5ADVA 5IAKA 4JASB 2B8WA 2C59A 3IUQA 4R51A 1G20E 3MCWA 2WB4A 4NS1A 3G5MA 1IATA 2GUWA 2FPGB 2YWXA 1W8DA 2ZT5A 3QXGA 5DIFA 5AW7A 2NU7A 2WV9A 3P2MA 4Q1DA 5KTMA 4DIFA 3H4IA 1G21A 4E7PA 1P0IA 3MCUA 3TQTA 3LCUA 1WXWA 4QA9A 1KQGA 2XJ4A 2ZAGA 4QUIA 4PYNA 3BMXA 2F6RA 2OYRA 2OXIA 3V8EA 1BFDA 2IW1A 1I7SB 2B0JA 1CVRA 1KSHA 1NLMA 4OM8A 5TRTA 3W9SA 2OSBA 3C3EA 4BO1A 2Q9BA 4QBGB 3C5HA 5DX0A 4KTTE 3GUUA 2Q3BA 1V8OA 1K0UA 1RWMA 1QGZA 4FZRA 1PNTA 3DNMA 3JZMA 3OIDA 4QHYA 3WX0A 1U1DA 5BV7A 1T8SA 3IEVA 3T9FA 4TXMA 3DWGA 3QNWA 4NBNA 4X8OA 3GAMA 2ZRJA 2P0EA 3QVVA 2OY0A 4OFBA 4NNJA 4TSRA 4LBYA 5I9MA 2XUFA 2R84A 1NVVR 3D8NA 5AKGA 5DHTA 1L1EA 4DZZA 2BBSA 2QUHA 2EERA 3UAGA 4C06A 1FX0B 2OBMA 2SNIE 1TYZA 2YIMA 1EFVA 3C41J 4BMCA 1YU6A 1A96A 1YACA 2BZ0A 3N1UA 3QYFA 1OR8A 3O82A 3GJ4A 1N5JA 4ZJUA 1J2UA 3ACCA 4B6EA 5F78A 1E2JA 3ZLJA 5FBLB 1RKBA 3AYZB 3DDSA 3SEFA 3PJDA 2VJPA 2I8CA 3DLTA 3O38A 3IP6A 1I1OA 3B3QA 2GCOB 2HPHA 1GNLA 3ANLA 3SHVA 4KREA 3Q0IA 3HVUA 4HWOA 2YJ5A 3WLFA 4AMYA 4JP1A 3HNOA 3NAQA 5JLAA 2QY9A 3AM1A 1ACMA 1LW7A 4JJAA 2NSYA 2INGX 1W2GA 3ORSA 1H93A 4I9HA 2WWTA 4MQFA 3WY9A 4D4LA 2UDPA 4QUHA 5JRJA 5I3ZA 1XK7A 5AK4A 1UPAA 5K4AA 3GV0A 4QVKA 1V1RA 3K05A 4LK3A 1ESDA 4EM6A 5BN3A 5LPNA 5TLSA 3GHYA 2FZ4A 2Z2XA 1A3CA 3DZFA 5EKDA 2PGOA 2D0PB 2V8BA 3DOUA 3NNNA 1FVXA 3QOWA 4MVJD 3VR2A 2P40A 3T5DA 2IYEA 3I6QA 2OUIA 1GPMA 1RHQA 2GSDA 3HV2A 4I5FA 4UUNA 4EQ6A 5JO0A 1W44A 2XCRB 3PNOA 2RGRA 2AOXA 1N5MA 3HBAA 2G4CA 2QMEA 2W0MA 3L7JA 4L8FA 4QXAA 1XYYA 2YHIB 4OQDA 4R8VA 4CMEC 5C51B 3TQQA 1WUYA 3KQVA 2E5FA 4HFMA 3WHKA 1E0JA 5AXAA 1ZZEA 3PQEA 1G5HA 2P6NA 1T2UA 2R97A 3JU3A 4JKYA 1EUDA 1GU0A 1R8YA 1ZH4A 2VPPA 4UHHA 3SQLA 3FIUA 2N9UA 1AHHA 2LNDA 4N54A 1B6GA 4H7KA 4GRAA 1BHJA 2DXIA 2JARA 2V0NA 3WA6A 1I5EA 4JR2A 2YWRA 3HUTA 3EA5A 4GL2A 2C2KA 1T5SA 3GDOA 5LYJF 1HE3A 1NASA 3DVSX 5E4FA 3HMKA 4CKBA 3ADPA 3A3KA 3IBFA 1TL7C 5LMZA 2VF2A 2OCAA 1N1EA 3GVXA 1QV9A 2QTRA 5CB4B 1KORA 4N47A 1LDEA 1YD7A 2X9NA 2AOUA 3C14C 4Q82A 4N7BA 2WJ3A 2XCLA 4TLLB 4DIKA 2AFHB 2IKSA 2X6TA 1E1CB 1MB0A 1YJ5A 4K6CA 5FNVB 3UK2A 3ZDQA 3UAXA 3IALA 3FIJA 4EVQA 1FNNA 3AERA 4RQTA 1V3TA 2ISQA 5A0FA 4PHGA 1U2ZA 2OGUA 4CTKA 1CE8A 4Y9SA 4C0LA 3UYKA 1VIAA 3IB3A 1U1IA 3JARA 4F11A 5CFQA 5EHZA 3TG8A 1GG9A 2HF7A 2ZYRA 4MRPA 2FFAA 3MC1A 2QD2A 3C5WP 1EK1A 2B35A 2WA1A 2G4VA 3QVTA 3O8RA 2C96A 2QQ0A 1GL9B 3IPRA 4WHMA 2M1ZA 1O5IA 3NEYA 4ZZ3A 2CXSA 5DN9A 1C4KA 2REXB 4TM7A 3EODA 3MG9A 5C3UA 3MSXA 1HF3A 4EO7A 4H4CA 4GZLA 1F48A 2DH6A 3GFFA 1OGJA 4CIAA 4NU0A 2GO7A 5IJZA 2AD5A 3GUYA 4UEQA 1UMDB 2V3VA 2HPVA 1KEKA 2QZZA 1K8YB 2VT3A 4O6VA 5KYUB 1CEQA 3D6UA 4I4LA 4XJVA 2XCTB 521PA 4PZDA 5AI0A 2BFEA 2JIQA 3HEBA 4FN5A 4K3VA 4H6WA 4Q0MA 4A27A 7MDHA 1KVSA 2NP7A 2RK6A 1OKKA 3I30X 1Y3CE 4R7ZA 4Z3DA 1U2TA 4DCNA 3KVVA 1JEQB 1EK2A 2CXTA 3OECA 1QPZA 4W8HA 5A0TA 1QG4A 2P3QA 4ZT5A 3VNUA 4R1QA 3S2ZA 1IEQA 1I2AA 2Q5QA 3DEHA 4JI5B 1Y7TA 4BBAA 1EX7A 2FEKA 4GVXA 2QW1A 2B8TA 2PWAA 3L0IB 3SOZA 5EQDA 1GTMA 1R12A 4IOJA 3IA7A 4DRZA 3CEHA 4X7BA 3BVPA 1ZMTA 1U0RA 2YOGA 3CBQA 3LPMA 3CX4A 1K8ZB 3EMKA 5IDYA 3L7LA 1LKZA 3G2QA 1J0AA 2QR5A 1MAAA 3I9FA 1SUWA 1YR3A 2FETA 5KDLA 3GLVA 1EP3B 4P31A 4YRCA 5A4IS 3FSEA 1C9EA 4G1MB 3WGNA 1CBUA 3RSQA 3E5NA 3VJLA 1O97C 1IU9A 3OEYA 1T0PA 4JJKA 4BFCA 3DVQX 1FDUA 2QRNA 4H7FA 2FQXA 4CTNA 3DZKA 2IBTA 4JGIA 1YB4A 2J7PD 3ESAA 2JD1A 1OB5A 3R44A 4B43A 3HK2A 2R68A 4ABTA 3R7FA 3AVXA 1P4RA 3IDQA 4I5IA 1ZNZA 3OEHA 1BAPA 2ZRLA 4IWNA 4IIDA 4UAVA 1VG1A 1P74A 5K3EA 2A14A 1R4AA 1ZD5A 3WGJA 3ZBTA 2D5IA 1G2OA 2ZATA 4TS3A 4KQWA 4BNLA 1XGKA 1VMEA 3AEQA 3BHIA 3GXBA 3E0XA 3TIFA 1T5BA 3BIWA 3MWKA 2IHYA 2Q0XA 3ZEIA 4NABA 4D0GA 3R74A 5JCJD 2ZT8A 5CH8A 1VL5A 3G0DA 2WWRA 1BFKA 2F43B 3BWBA 1ZS9A 1CIJA 3FHOA 4D57A 2O8FB 2W8BA 1LDYA 2YV4A 2PCJA 2CMFA 1HC7A 4NYJQ 4X9XA 3K5WA 4X97A 5EQFA 3OJXA 2OCYC 4DYVA 3FKSA 2YXPX 5A3QA 1MC5A 4M1KA 4RD0A 1XWIA 1A88A 4WINA 2ZSDA 4YI5A 1TK9A 3WL5A 5IDWA 3RUDA 2JFFA 5LM3A 3GZTB 3NOQA 5TGZA 5K0JA 2ISSD 1DI0A 2YIDA 2AR9A 1Y3BE 2C00A 2PTGA 2WIBA 4FGLA 4RY8A 3T1OA 4DA4A 4DJ5X 4R2HA 1XPOA 4IHJB 4IWYA 3EQ6A 1BDMA 3G5UA 5LVAA 4DIEA 1P2GA 1JIXA 4C43A 1K8XB 2VPTA 1WA5A 1R37A 2HJ9A 2WT8A 1II8A 2FDRA 1ODIA 4P3XA 4AWAA 4OQPA 4P3YA 5REQA 4RGBA 5IZ4A 3AI1A 3CB2A 1L1FA 4C5BA 4PYRA 4PZEA 1ZFNA 1GG2A 5HXAA 4S05A 4KK4A 4RZXA 1I2DA 3M6FA 4RLQA 4YACA 3ZE8A 3ICQB 5BN4B 4NDNE 5JMTA 4ITUA 2P69A 5HK9A 5L3SA 1NLFA 3OQPA 4IFIA 5D7NA 4IX9A 1KMCA 4DC0A 3KHTA 2WF7A 4NR0A 2DBRA 4J3NA 1QF6A 1EH5A 3RVOA 2G71A 2R48A 1WB4A 4LHWA 1OVGA 3HUEA 2WE7A 2J87A 4HAWA 3EVFA 3DAYA 1PL8A 4JY7A 3GT7A 4PF1A 4QBKA 2HAEA 4CM4A 1N5DA 5JXJA 2GCGA 3I4LA 4BIMA 4OD0A 1GL7A 1P9OA 1A97A 1OLSB 4JBLA 3TNFA 3ONVA 4OO3A 4P58A 3RS7A 3ZHUA 3K4PA 1IY0A 1PEDA 2VHTA 2V7UA 3HV0A 4ZCPA 1JBQA 1SKYE 3I1IA 1MX3A 3OX2A 1JDBB 4KLRA 4DGQA 2EFDB 5IH7A 3E0QA 3OU2A 4IO0A 1SCAA 4QUJA 2OV2A 3SX4A 3T9DA 3U56A 1SIUA 4M60A 4YAUA 2CYAA 1ZJYA 3NHKA 4L7QA 1TYCA 2J0UB 3N0XA 4DMKA 4AZ3B 5FV4A 1FXWA 1ZNXA 1V1JA 3ZKWA 5ELMA 1EZ4A 4FFOA 3JR7A 3CB4A 1Z36A 1W30A 2J30A 2WIAA 5KNLA 2GPSA 4I9NA 1QWOA 4JP3A 8ABPA 3EJWA 1H6DA 2EEPA 4Y67A 1KJQA 3GDFA 2RAFA 1XTRA 3S8MA 3PJRA 2Z1MA 4QGHA 1A2BA 4Y30A 1XXHB 5HIJA 5JADA 3FHJA 3OH8A 4JLDA 3RTEA 2BMVA 1NVUQ 2BCEA 1P7YA 4IO1A 5DB4A 3WL7A 1WEKA 1S9HA 1XC7A 3UXMA 2WYOA 1OU0A 4FE7A 1LNSA 2A2ZA 3GVCA 3VMMA 2QP9X 4FILA 3EC1A 2G9QA 4TTVA 1W36C 3FSJX 3PQ6A 4DDWA 1QH8B 4QGGA 4LHEA 1OFVA 1WZNA 2AEEA 1F8YA 3TOSA 5THXA 1Q12A 1NN5A 4HR7A 2CJWA 5SY4A 3C70A 4MUEA 1N5LA 3EVCA 5F76A 2I1QA 1PTJA 5BSKA 2VHWA 3CF4G 3H16A 3DB2A 4E2WA 1KPHA 3Q7RA 5GV8A 4Y6RA 4RO0A 3LFHA 1GQYA 1LV7A 1NYRA 4I50F 4B33A 4F3TA 2BFPA 4D8TA 3LX6A 3TLXA 3U4IA 2C2OA 1F2VA 2I34A 1X2BA 3K1AA 1LDGA 3NTUA 3IIMA 4JL5A 4NHOA 3LKBA 1DJOA 4X20B 1G98A 2IVFA 4GOKA 4N5DA 4GOLD 5EQJB 1DJPA 1MT3A 4HWGA 1QS0A 1NXTA 3E1KA 3JD0A 1ENOA 2G36A 1X6VA 4WZ6A 1USVA 2FA9A 3C8UA 3QVWA 4Q7JB 4DV2B 5AM3A 4BN0A 2NX2A 3AG6A 4RTJA 2X9LA 1NT2A 2P1RA 4WLVA 1DG3A 2PMWB 4HYTA 1R7RA 1AH2A 4UAUA 5CB0A 1POWA 3MRTA 2QAGB 1WXHA 3RFVA 3GLGA 5AVVA 4ZV7A 4PVDA 2JD0A 2QGNA 1Y7HA 2YMLA 2P5UA 1FP2A 3O7WA 5FBHA 1WSWA 3PJGA 4BMXA 1P2VA 2WVAA 3UMYA 1GZ5A 1X9HA 4XX1A 3C3CA 4GDMA 4GYWA 3KEGA 4FWIB 3R0IA 1BA3A 2FWBA 4G5GA 1C4WA 2ZREA 3B3GA 5FOXA 1J9GA 1RM5A 2OXRA 3KUCA 4ZZIA 5LQJA 3GPIA 2RGDA 4H15A 5G0WA 2VAMA 4FGZA 1RRKA 5B7GA 2ZBRA 4Z4IA 3Q6NA 3ITDA 1NOJA 2QI9F 1JF8A 1UM9A 2ZJ8A 3FMOB 2FI1A 2GEVA 3MGCA 3H83A 4B4UA 3DFUA 2A5FA 4YWJA 5L4LA 4UC0A 4XZ3A 3LBYA 4MIKA 5IC5A 4B7XA 4DWVA 5GZ6A 4RVNA 2ABWA 5GINE 2CKDA 4X44A 2VSOA 1Q6ZA 2XB8A 4QQFA 3G0CA 3OESA 4V0SA 2Q7OE 4QOHA 4KMRA 4L6AA 5FBZA 4TX1A 1IM5A 3UICA 3UC9A 1YSCA 1PT8A 4KIJA 1NYTA 2XMDA 3D6AA 1W5TA 3CF2A 1XRNA 1P1BA 1U9IC 1EDBA 3HMQA 2YHSA 2Q29A 1NJSA 3E18A 1FVHA 3BH7A 4FSXA 5FPSA 4F2GA 3GJRA 4HWTA 5ALJA 4HYEA 4Q47A 4Y2YA 2DR3A 4HI0E 4PZZA 1GPAA 3ETJA 5A4MS 1PW7A 2IWRA 4C4AA 4AJKA 1NZDA 1KH1A 1QCYA 5ICSA 2FVYA 1G66A 4Q9LA 1ZYUA 3HA5A 3W77A 4R9SA 1XF9A 4BXOA 2ZXUA 4YRFA 4DQ0A 5KWEA 1WM1A 3M1IA 1A9SA 1FS5A 2PEYA 2VJAA 1MAWA 2GEJA 4N5IX 2RH9B 4ZHQB 1CZUA 2D5LA 2GN2A 3D4NA 4PG7A 1L5RA 4EGAA 6NULA 1KFBB 3OIGA 4IZOA 3WGLA 1JNYA 3PNMA 1Y6QA 2DFPA 3ECCA 3PR1A 2YY6A 4JQCA 2ZKIA 3OTHA 1V4NA 3KU1A 4MPJA 4ND6A 2G25A 1V5FA 5EHGA 4AY5A 2EJTA 4EJFA 5JV5A 1H1LA 4QEDA 4Z0NA 2IU6A 3M34A 3QIVA 3DZ8A 2C7GA 4TRRA 4DBVO 3LD9A 4R05A 3SX2A 3Q4GA 1OFTA 4AO6A 2Q27A 4Z1MA 4ZJYA 2HDHA 1X7GA 5F33A 1E0AA 2BKXA 3GQBB 1OXKB 1R16A 2FH5B 3NI2A 3RRFA 5HCUA 5LZ9A 1DSSG 4P4TA 1K1EA 3HR7A 2WKPA 2X7HA 3I73A 5JSKA 2XB9A 1XLUA 3FGPA 4B3MB 2RHJA 1RYEA 1OMOA 1YUBA 1ZH0A 2WKQA 5JJ5A 3K70D 1YS4A 3D8TA 5B1HA 3CRVA 4EB6A 1E6LA 2YBEA 3I83A 4MOWA 1NHWA 2AKYA 1WJGA 4YLYA 5KNDD 4CIWA 4HDSA 5IM4F 3AESB 5F52A 3WGZA 2P5TB 2OEPA 3ABZA 4ASUA 1NDUA 1O4VA 1MJHA 3OQIB 3W0LB 2GVNA 3R76A 3CX7A 2B94A 3WYCA 3FXAA 1OI2A 1PNRA 5JYEA 3JQBA 3PD1A 3RU9A 2H0RA 1D4AA 2G6TA 5GJCA 5BN5B 2H00A 2O2CA 2HQRA 4FC6A 1FYXA 3FBGA 3TW0A 3NBAA 2E55A 1KZYC 1LPOA 3E7FA 4IH9A 3V8MA 3ZWPA 5EIOA 4DLZA 3QKSB 4RH1A 3AFOA 4TMZA 2V3WA 1JECA 4I5EA 4ALNA 1VI5A 1E3LA 4OHKA 4B5LA 5FI0B 4W5NA 1LSSA 5J2TA 1Q0UA 1PSDA 3DOEA 4EI7A 1PFVA 2AG0A 1QPGA 4TKLA 2VDVE 4LMBA 3RIXA 3EXAA 3T3DA 4WJLA 1DKUA 2VJOA 2JAUA 2F9LA 1X80B 4LJ5A 5M5BA 2F3UA 4YLGA 4BVFA 5ANRB 4DG8A 4FX2A 4ER7A 1ZMBA 3IEUA 3K1TA 4UMEA 3LUKA 3AHCA 3HFSA 1WPQA 1HLPA 1Z12A 2HA2A 4E03A 1DWOA 4D97A 2VL7A 3GJ3A 1DX6A 2BMDA 4XSVA 5B6IA 4LYAA 4PLVA 1E1CA 1JDVA 3A4NA 1UJ4A 2QE6A 3WRYC 3KSBC 1O0BA 5K03A 4KQEA 4BY9E 3FMFA 3ELWA 1GQOA 1PSZA 1Q7CA 1ULBA 2QPAA 3DM9B 2IOYA 3M89A 3PLNA 1EP1B 4KSYA 4LXYA 2B37A 3WKBA 4P4LA 4BWVA 3N87A 2P4HX 1RLJA 3WB9A 5IF3A 1TVKA 1QIHA 1MO6A 3O4FA 1I6KA 1Y0BA 2ZB2A 4J76A 2LXNA 4XQ9A 3FGNA 2XB2A 1NNSA 2GK6A 3P0RA 5ALGA 3SBOA 2J08A 3CY6A 3HCNA 3PC3A 3LCCA 3OT1B 1U2GA 1UBJS 3L0SA 5EAIA 1UMCB 2I4TA 1JJVA 1GU1A 2CCJA 4Y7CA 4EZIA 2ZB7A 3SJAA 1YUMA 4CCSA 3O8BA 2VSYA 2ZI5A 3F1LA 3WMWA 3HKBB 2YZKA 4I1YA 2EZ8A 4UMDA 4XQEA 1FTSA 3LDHA 4F9GA 2P2GA 3MJEA 4YXFA 5B3LA 1XL1A 2AH5A 3LUGA 2H2WA 3KX2A 2NW6A 2V7BA 5IT0A 1E2DA 4C2TA 1W48A 4FM9A 1K9VF 4FLMA 3PUWA 4X7RA 4W1RA 4F86A 1GLGA 1C1HA 2GERA 3FVQA 3I62A 1UT5A 3O3CA 2C07A 4Y1RB 2C8KA 3FLEA 2GDJA 3A27A 3EBLA 2ZSAA 1RAGA 1FFXA 4QYIB 4CQMA 4DDHA 1GPYA 1U0SY 3BILA 3L8EA 2NTYC 2H1LA 1F06A 3QKIA 4NP6A 4X71A 5L4NA 1X94A 5HGJA 5U4QA 3ZE9A 2CHUA 2I2BA 5AJWA 3S2FA 3D0RA 4NWIA 3UMSA 3VZDA 4DA9A 4WXMA 1BD3A 2PMDA 4MQ5A 1N7IA 4J4TA 1RSZA 3ZX4A 4R0MA 2Z1NA 3A1EA 3AJEA 1NBEA 1D4OA 3WBKA 3K8OE 4C7MA 4I2NA 4R0NA 3O8LA 1NF3A 1IN7A 1ZUD1 3AKCA 4OGWA 1SCIA 2Y77A 1SOAA 4DXDA 4BKMA 5F7ZA 5B4VA 1W0JD 2MMCA 4HHEA 4REQB 1FA9A 3BULA 3LLCA 4DA7A 4X7PA 1ECLA 5IF9A 3HCEA 2Y05A 4HGZA 4QRHA 3Q87B 3UHOA 3VUFA 1ID8A 2IZ7A 1GV1A 4LE0A 4Q3NA 4TTQA 4CWAA 3KKPA 5DHFA 3NT4A 4OMFG 4GXQA 3N5KA 4J3FA 4XB1A 3UB4A 2XZPA 3WMXA 4TWRA 1VJGA 1JAIA 5JS7A 2JI8A 1VJ1A 3IT0A 4M6WB 3ZE7A 1PR6A 1QVWA 4WKBA 4Q7KA 2AYXA 1XEWY 2ONCA 4PZPA 4GD3Q 4YK7A 3HJRA 1NAIA 2O0HA 4DV4B 2C8JA 5ESRA 5B55A 4NBKA 5GVRA 5KSOA 3PDCA 2RBGA 4R71A 1SKMA 3ANSA 1OGYA 3EGVA 1KR2A 4AZVA 2K7FA 3F47A 1F9AA 3ZCQA 3CE6A 1VLHA 1RXIA 3HWRA 3IPLA 3WRVA 4DT1A 5F4BA 2REQA 4KHZA 3VDQA 4CM9D 1T5OA 3BXHA 4FBLA 3KQSA 1DDOA 4L50A 3WWCA 4LW8A 1G5RA 4RWEA 4DLLA 2IS6A 3P0JA 2O8FA 3HB0A 4G1CA 3TZ6A 4X85A 4AQ7A 4LFCB 5B2FA 1XCJA 2RIRA 4XFJA 2BKAA 4DAOA 1GTSA 4KKVA 1VLVA 4OP2A 1BXRA 1QOQB 3KUXA 2YQ4A 4QUEA 4MIEA 2FUKA 4EHIA 3S6JA 4G2NA 4DCCA 1D6MA 2PX2A 3B7WA 2XIJA 2EF1A 1W1UA 2DWUA 3H6KA 4M0KA 1GU7A 4HDRA 2FPLA 1C7IA 4CHGA 1JQEA 2AW5A 1X1DA 2JFGA 2WSSD 3EIFA 3WFZA 4DF3A 4WD3A 2SKCA 5CA1B 2Q46A 3HA2A 1UAGA 1G9SA 1A95A 3Q9LA 3HB4X 3QOFA 2WU4A 4QPCA 4JOSA 5CP8A 3B85A 5EJEA 3RIYA 2HDWA 2ZM6B 4PSVA 5BN4A 3O6VA 1UZNA 1QMPA 5KJEA 4ZKEA 2VK8A 5AOVA 3NC4A 3MVEA 3ONDA 3BX1A 3IV7A 4O08A 1E20A 4E5NA 2AN3A 1STOA 4WFIA 1A2QA 1SNYA 1B8VA 2IEZA 2RHLA 3DXFA 5FBWB 1M0EA 3WGVA 2QMQA 1NSFA 1MDFA 2JAWA 3TSYA 3OY7A 5DTEA 3ZWCA 2H8KA 4WKCA 3PFNA 2B3TA 1R74A 4CUJA 3HM2A 5ERGB 3LSYA 1ACJA 2UYGA 1L5VA 1VGRA 4XDZA 1JPNA 1OX4A 2WIDA 4TLBA 2C54A 4BMOB 2JI7A 4Y6LA 4JVMA 3QE0A 4GPIB 2O4UX 4D4HA 2IZZA 4R3WA 4IIEA 3QELB 5F51A 1FP6A 3JQPA 1U1CA 4KPGA 5D87A 4CL8A 2OXEA 3E1SA 5IKPA 1NJ2A 5LDDC 1SHUX 1ULHA 4I7EA 4ZI3A 1M6HA 2EU8A 2CHGA 2C7RA 1QGAA 1JQBA 4C88A 4URXR 2OESA 3OJWA 4RDIA 1RPJA 3ISJA 2J0UA 3MCZA 5DV9A 4MHOA 1SZJG 4DWWA 3M5WA 2LCFA 3Q9NA 4BNVA 3H2JA 1FRZA 2DWOA 5EE9A 1WHSB 4U8HA 4MPRA 3O4RA 3VOTA 5C8XA 1T3TA 4MI1A 4RIIA 4BNZA 5CJJA 5G02A 3TWOA 3AQIA 4C78A 2R00C 4YJ2F 4D3FA 4LMAA 1XXHA 5C18A 5KJFA 4KB5A 5AKIA 1UFKA 4LBZA 5IULC 4QFCA 1TTTA 4OKNA 1Q50A 2AG1A 2PAAA 2Q0SA 3TCKA 3WNDA 1ILEA 4MPDA 1LF0A 1R64A 3CEPB 3FI0A 4M3NA 4Z9XA 2PSSA 1TCVA 2WTEA 1CC1S 1CZRA 3BD8A 4G0YA 4GS5A 4KSBA 4TMKA 1I6WA 5EZYB 2PL1A 2EX0A 2IHUA 1I36A 3VR3D 1BFUA 4PYIA 2J5RA 1SWWA 1A8QA 4IXNA 2OLJA 1NBMA 4JB3A 4QXRA 3SSMA 2XUJA 2C83A 2PANA 3QK7A 3KOMA 1T5LA 4MXDA 2IDZA 5I51A 8GPBA 2H1IA 3QVGB 5K2MA 5GIPE 5BSUA 2NXJA 3NTRA 5SY6A 4DTIA 3BE8A 3RO7A 2WLSA 3WADA 5L95A 4RMHA 4HH1A 2BCGY 4YQZA 5HIIA 1U6JA 4BUCA 5B3KA 2BFFA 4OHMA 3SBDA 1CG6A 1GITA 4B3DA 2BGNA 4J0DA 2BFDA 1C14A 3P1JA 3NIDB 4JJEA 4NJMA 2X58A 3W4IA 2Q2QA 3PS9A 5M04A 5KWJA 1YAHA 1MJ5A 4HDQB 1WZ2A 4M54A 4J4BA 1QGOA 2BI4A 2YZ7A 1RWNA 3JV7A 1ZA2A 2HMAA 3UF0A 2GRJA 3F3SA 2M6KA 5K0GA 4EJSB 3BIJA 2VTVA 3IIIA 1M2FA 2ZWAA 3TNLA 1E2EA 2FSHA 3DDUA 2PD4A 3D2LA 4JQSA 4L75A 2P2NA 5AHRA 4DYHA 4RETA 2IIQA 1HNNA 4B48A 1C4OA 3HBJA 1SZPA 3LLUA 1ZKMA 2BGLA 3A9CA 3ETLA 2CLSA 3G68A 1IUPA 4IVPA 1B0AA 2WWGA 1ZGGA 2VUSA 5AJTA 3KHUA 3TW8B 3LOQA 2EARA 3X1MA 4QD3A 4ZI7B 4IY1A 1LC3A 3VZCA 2Q5IA 1YFKA 2YZMA 2CLCX 4DLUA 4QSMA 4W7HA 5CXXA 2BM1A 1YH3A 2QYHA 3AVQA 2EC5A 2Q4BA 1KI6A 2CV0A 5FQOA 5G1NA 1TCCA 2WR8A 3HB5X 3HKEB 4OJQA 1E60A 2UZ0A 1OZGA 1R0SA 1U94A 1AKNA 4QU8A 2XNDD 2HNAA 3CNHA 1ZD9A 5C5EA 3AY3A 5CH5A 3T34A 1Z7YA 7ABPA 4CETA 3GIDA 4LOHA 3CXRA 4MI3A 3M4YA 4JC4A 4NJOA 2V1UA 4XRGA 3CLTC 5K0LA 3SNKA 5C80A 2DHCA 3FPHA 3W9UA 1E1RD 5KYXA 4OG2A 3MS2A 1KRHA 2RIPA 1APBA 1RQGA 2C3MA 4FN4A 3JQFC 1KVTA 4K28A 1MVLA 1Y6ZA 4CXMA 1M7BA 1BA2A 2O8DA 1PRYA 1R00A 4CL0A 4ZIRB 2UUCB 4HQLA 1EFHA 3PBKA 4MITA 3TIGA 1XEAA 4JT9A 1RT9A 1AS3A 3N8NA 2B20A 2F1KA 4ZEXA 2NUTA 3WJ7A 1CTQA 1Z45A 2NXEA 5JEDA 3I3OA 1Y4SA 4GOOD 4YPFA 5EJFA 2Z2JA 3L1HA 1HA3A 1CJTC 1GRQA 5IT4A 4YMUA 1H6BA 4EVSA 5HJEA 3HJGA 5J4KA 4G4IA 2P3LA 2B2XA 4M22A 3AM4A 1JHZA 2AQ8A 4Q9IA 3NG1A 3A1FA 4D4KA 1BGVA 5LR6A 1VBNA 4I6EA 4FFSA 2I2WA 3JPWA 2H52A 1EFPB 1EQ2A 2JANA 1O5OA 3JAKA 3SQMA 2JIOA 3SC4A 3P0IA 4TV9F 3TVYA 2A3RA 2FU5C 4N7RA 3BL5A 1KQNA 3GJ5A 1TKRA 4JGBA 1O6ZA 5LLSA 1WB5A 3GZNA 3NFYA 1XMOB 4JQZA 4DPKA 1X7ZB 4G5HA 2C5SA 4ZVNA 2OM2A 2TECE 4RTQA 1GCUA 3BTOA 1IN8A 2HA7A 4ZQFA 5A4DA 4H3VA 4OXNA 2H5LA 2R1TB 3VXKA 3PSHA 3OF5A 4MGKR 4V0LA 1SXPA 1IM8A 2D4HA 1TQ6A 2QSYA 4J94A 5T67A 2IELA 4OP3A 3PC2A 1CJKC 3ELUA 4TYNA 1M7HA 4YYEA 2EX4A 1T29A 3NHWA 4HDOB 4Q1VA 4R83A 4DNOA 4B8ZA 1B93A 1KYYA 1E9VA 1NUQA 2BM0A 3N6RA 4X1IA 1N2CA 4C3OB 821PA 1YA6A 2ID4A 2IUEA 3H04A 2F64A 1WMBA 4MDYA 1K7YA 4EPVA 1Z7EA 2OG2A 4PAMA 5LP6F 3AESA 1E0SA 3R8XA 1J2EA 5AM2A 1L8LA 1ZIYA 1YZGA 2RG1A 1A0OA 3EGIA 2Y9PB 1KDPA 2WUDA 2ZBVA 4Q3KA 4F93B 3HYNA 1I4LD 4D79A 1KOJA 3CV3A 3T1YB 4FNGA 4PO1A 1CY4A 1ZD8A 3CX8A 1IWOA 2HSZA 3KLBA 3SIRA 4DSUA 3LNCA 4E22A 1F8XA 1KDRA 2G0AA 2ZJ3A 2VQ6A 1A9TA 3T3OA 1BIFA 3F3MA 2YL2A 4UEKA 3U80A 1J5PA 3SZUA 1S6YA 4KK3A 4MPTA 5J59A 3T0IA 4TXHA 1LPMA 4MLDA 3BXGA 3DE3X 3IUPA 4LYGA 1CUCA 1X1BA 1I6LA 4W5QA 2FEOA 4O02B 2IYTA 2WY2D 5JD6A 2FPPA 4ENPA 1IHUA 3GEIA 3RD5A 1FW8A 2ZT7A 2EZTA 4XTCS 4NONA 4LRWA 3Q12A 4KQ6A 1J8MF 4OHWA 5A9SA 1JDNA 1I10A 2XGMA 3BMNA 2CHEA 4DC1A 7GPBA 1V35A 4KQHA 2B7CA 4R2KA 5JY6A 2CFOA 3ZPXA 5JPDA 4NEGA 3UFXB 2DFKB 3UATA 1I7NA 1NYQA 5IDXA 4LY3A 4XEHA 3FF4A 2X3UA 5PNTA 3PDIB 1UBMS 4DDTA 4O3MA 1QXSA 2QSJA 2GD0A 2VHEA 2WEKA 2GJ9A 3HYTA 4A8JA 5CG2A 1F9EA 3TF5A 4MUXA 1SOWA 1J6UA 4EUKA 3ETDA 3IAS6 4N82A 1CUBA 4QUKA 4I4CA 4Y2QA 3JQQA 1SQ5A 5H68A 3O3OB 5KAMA 2JK0A 4PGHA 2ZWVA 3FSGD 1C3OB 1QP8A 1NQOA 3WP1B 3P0EA 4EAQA 1RC8A 1CF4A 2HHAA 2JBAB 4LQ4A 3OT1A 4MI6A 2EL9A 4M37A 4Y8VA 4DC9A 1UMCA 2JGIA 3DXXA 1U9YA 2HHLA 3OFND 3KD3A 1S7CA 3P9NA 4QXPA 4EFLA 3BCRA 4KIUA 2XD9A 1N0HA 4JLSA 4YB8A 3EAFA 3HKBA 1XQVA 1G2PA 3WNQA 5C53B 4IICA 4PR3A 1MF7A 2YW9A 2JIZA 5I7VA 2C2ZA 2QAIA 3LP5A 3NOXA 1Y1PA 4RHEA 1E18A 3AF6A 3K09C 4KDEA 1GJRA 2AT1A 4FB5A 3GEGA 1KY2A 3SE7A 2QRQA 1T0JB 3CEJA 3F9RA 3LUPA 2J6HA 2AC7A 1CHDA 1Q84A 1U2EA 1XEXA 2OZLB 1L5HA 1T6BY 2R6R1 4M1QA 5SZIA 2SKDA 3A11A 3ERCA 3QKRA 4OY3A 4Z54A 2V65A 3C1OA 2LPMA 3DBVO 3DDZX 3ZJUA 3H5LA 4HNHA 3E48A 4QUBA 2YV3A 5B1YA 3KPUA 3JZIA 4JV5B 1TYBE 3PKZA 3T6KA 1T1EA 1OBCA 3CH7A 3VHXB 2WYVA 5TGTA 4D7AA 2V97A 4HDKA 1U80A 4HUJA 1J99A 4I9GA 4QAQA 5DMHA 1XTJA 4PGMA 4U2CA 3ZXYA 1X14A 1N9GA 4H0FA 4PE5B 1IXRC 4Y2PA 2B6HA 4P83A 4M1YA 4INPA 1CUXA 3RVSA 3SMQA 1PG5A 5DBHX 1XZ8A 3REFA 2YMMA 1V11A 4WRRA 5PGMA 5AVQA 2NSHA 1VMIA 3BORA 1HG1A 5DTRA 2OAQ1 2WHPA 2C94A 3KVRA 4RVSA 1IN4A 1NJ5A 1R2QA 3GYBA 1UDWA 4YMTA 5KPDA 2RH4A 2VAPA 1BS9A 4NCHA 4Z7JA 4QTUB 4MS1B 5GGYA 4QGSA 5ESWA 3AL0C 3QV2A 4KLNA 4OOFA 4RABA 5EE0A 3BOSA 3HDQA 4XLLA 3WK6A 1RKQA 3FJOA 1EWQA 1EFDN 4QXOA 4BLSA 4ETWA 4ZYZA 5F2EA 3D9QX 3O47A 4L6CA 1VHWA 5TT0A 1K4KA 3AMVA 1KTIA 2HA4A 3WAGA 4UUQA 5JSQA 1C1XB 2YN2A 2QZJA 1V95A 1J25A 4CEHA 1MX9A 3R0VA 4L27A 4W6QA 4DR3B 1QQ6A 1I14A 4LA4A 1P5HA 5BPFA 3SSNA 3D3NA 4M0UA 4N49A 3FLMA 3OKCA 3KKEA 1D9ZA 1ESZA 2YR0A 4KACA 2OFWA 3SNHA 4EYKA 1RWPA 5EEHA 1KH2A 4FNMA 4URYR 4JUAA 4C14A 2DBVO 4RS4A 1HYBA 1J0CA 1WCIA 2R6JA 3F7TA 4LRQA 3RV4A 3ZNNA 3LZDA 5KYGA 2WE8A 3FZQA 1MEOA 1THTA 5L51A 4KR9A 1VRCA 3JRWA 4EB0A 4EHBA 1CKEA 1VPVA 1KK3A 3NANA 4I8IA 1UDAA 1C9MA 2RI1A 1P2FA 5C1BA 4YCDA 2VP9A 3BFXA 2PZBA 2QN8A 2CNWA 2FJUA 2GF0A 2G9VA 3G59A 3H4VA 1J90A 4KODA 5CXUA 4J1TC 1NLUA 1E3DA 1JFFA 3U17A 1U7OA 3TX6A 1QH1B 4TSFA 4WN9B 3SVTA 2WAMA 3TTSA 2B5WA 1E9CA 2JAXA 2FP4B 3HO8A 5JD4A 5B36A 5H70A 4UBKA 4F5EA 1H2AS 4F8YA 2XKKA 1KPGA 4H1UA 2ASEA 1GP2A 1UT6A 2FZGA 2DPLA 3FUXA 4CF5A 4C2AA 1EJ0A 3L18A 3N2LA 1UJ5A 2ZYUX 2QZSA 3H7AA 4GZ5A 2YWBA 4MW9A 4P86A 4X6UA 4J16A 3R4CA 4Z7QB 4F8EA 1N8KA 4NARA 3LYHA 3N7UA 3P9IA 1KEUA 4J9UE 4ZJPA 2QG4A 3AM3A 3KT6A 3FHCB 2Z1DA 4P3OA 3ZWNA 4JA2A 1R4MA 5A5GA 2EKQA 1ZI8A 4LWOA 2YJGA 3BL6A 3ZDCA 4ZPXA 3WWZA 4YXWD 3NAZA 1CF9A 3G49A 3EXFA 2VYQA 3G5AA 2ANBA 3LM8A 4DJFC 4INOA 4JEIA 4R4JA 4M9ZA 1QF7A 1V16A 2FSSA 4L8VA 5K1ZA 5TMDA 4MP3A 3RYHA 1CY8A 2FPIB 3TRIA 4BMSA 2IS2A 2NVOA 1VXOA 3U3JA 1UXJA 3JXEA 1KI3A 2FZEA 3BXPA 3ZJVA 3RANA 5ERYA 3GLFE 2PH5A 1X1RA 1F0NA 3UCXA 3A1UA 3MK31 2KE5A 2JLUA 2QRJA 4OATA 1DQRA 2C4KA 4I3FA 1VG0B 5EPEA 4CRWB 2YRFA 4DRYA 3BH0A 5BWBA 2WU8A 5KNCD 4UHBA 4HF7A 1QLHA 1AKEA 3I01M 3ZY6A 421PA 2OP0A 1FXUA 1SU8A 3IVGA 1IUNA 3U3RA 2Q9AA 3PNYA 2O23A 2H92A 1ECPA 1SMKA 2WIJA 5A3RA 1U0HC 3AW9A 3X2SA 4JWTA 2DP4E 3MB8A 3VTAA 1WSDA 3DWFA 2NV2B 2YUIA 3PVSA 2ZRDA 3CVOA 4G4JA 1WHSA 4OBXA 4O4IB 1Q20A 3HHPA 1HTTA 3V7FA 4YAIA 3LUDA 1K5PA 1VGQA 3V1MA 4BQQA 3VZQA 5J23A 3QIAA 1PBTA 2PN1A 4BJHB 1JJ7A 1MUUA 5LOVB 2FZ5A 3TLAA 2VJYA 3QVUA 4DHWA 5L40A 4KE9A 4WK0B 3TZQA 3JQ7B 3ESBA 3K0FA 1JHUA 4PBSA 5L3RA 4CF7A 2N47A 4OXYA 3OCCA 1EFKA 1TMOA 2WZCA 1QCDA 4PLWA 3V2HA 1ZC3A 2BHNA 3WNBA 1Q7TA 3HDTA 4LF4B 3CEAA 3U7FB 3TLZA 2IGTA 3HB1A 2HA5A 2C3UA 1WY7A 4IVRA 4IZHA 3WLQA 5H9WA 1X7YB 2Y4NA 4B79A 2CZGA 3NCTA 1I51A 1VA4A 2XNSA 2YZ2A 4ILKA 4R6XA 4ZVTA 1P1JA 3L2OB 2XRFA 2VCHA 3G2LA 4QWWA 4BNHA 4EF4A 4MZXA 4K81B 1ZJWA 5CMLA 3HJTA 4Z4CA 2I4IA 3ZVMA 1B8UA 1FNCA 4WXEA 5AOBA 3M1AA 1EAMA 3ST7A 3WMFA 4DTCA 4MEAA 5J4LA 3AP3A 3GYGA 3QI2A 4E51A 4RCYA 3ZK8A 4G9EA 4U7DA 1XRPA 1Y98A 1DDIA 2C4WA 1JAHA 3EEBA 3EUWA 3I45A 3M6AA 1QOPB 4JJZA 3EEIA 4RZSA 2FE1A 2D1RA 3AUTA 4M83A 5TY0A 2DFTA 2YQZA 2TYSB 5AHXA 5ECWA 3NNSA 1Z6YA 1P7VA 3P9CA 3UAVA 5JNVA 3IQHX 1IZ0A 1KVRA 1R0LA 4IIVA 2WU3A 3CPEA 4UUAA 1VHLA 1S2LA 2B8NA 1W76A 3GUVA 5LQAA 4IIBA 1E2NA 1Y7IA 2CDAA 2QL6A 5JHHB 3RS8A 4G5OA 5BNIA 3LA6A 3PKJA 1LDBA 1QCZA 2W42A 3K0EA 1DXQA 1QWSA 1IRIA 1ZEJA 3RRXA 5ITZB 3KTDA 1Z33A 3CX6A 2OMEA 4Y6PA 5DYIA 3SSOA 2J3IA 1VLZA 4HNQA 3S2EA 1Z6PA 3PDHA 4KVZA 1H2RS 1EBUA 3KL2A 2CZCA 3N58A 1FTNA 3P9SA 3Q3EA 2FSPA 4FKMA 4MA5A 1SBYA 2W4MA 2IGBA 3RTCA 5DEIA 1FFBA 3AKYA 4ZXPA 4AULA 3HVRA 5I9IA 1VKHA 1YE3A 2B8EA 3RYFB 1A27A 2QENA 3VX3A 4D9FA 5AD1A 5T7BA 1CQPA 2VJQA 2C4HA 2FPUA 1FXSA 1VG9B 1VLJA 2DH5A 3N2KA 5C8YF 2H1WA 2JGJA 3MAJA 2C4UA 1KKLA 1RBZA 3NLLA 4G86A 3UJ8A 1AIPA 1DZIA 1P1KA 2HSJA 1L5SA 3IP5A 1NDHA 4PZ9A 4HNTA 1QV6A 3GCXA 2I87A 3K92A 4TL8A 3JCZA 4V0OA 2IXEA 3T41A 2XF8A 4YCJA 3A6EA 1K97A 1IVYA 4F45A 4XQGA 3PX3A 4Y2HA 1XA0A 5CIQA 2L69A 2YH2A 3OCVA 4JR1A 3I4CA 4O4JF 3ZWQA 5UKDA 5ALEA 1JQ5A 4HAZA 5LMNB 2P77A 4YRMA 1GCGA 3SEQA 4TRMA 4KFCA 3DHYA 1TTHA 3MJHA 1JUDA 2H4XA 3ILHA 5TQJA 1NQ5A 2VF7A 2YQ5A 3JQGB 4FUQA 2M9MA 4HSGA 3JAWA 3RKSA 3TLCA 4WEQA 1UAAA 4KHPB 1EFPA 3L40A 3E61A 2XUQA 3EOBI 4XCVA 4G8DA 1PBNA 3EA0A 4GLLA 1E2FA 3NFRA 3E23A 4ZVQA 2VSXA 3BBPA 1D2AA 2GPAA 3KQYA 3HM9A 3HKDA 5AVZA 2VNAA 2A94A 2I2DA 3PLRA 4DEXA 1GO2A 2W5UA 4XVUA 3L4KA 1QRUA 4F9FA 3QEAZ 5DK6A 3MRSA 4MEJA 1EX1A 2WIKA 5D3MA 2RCNA 3QWBA 1V8FA 3FPFA 1HT0A 2BF7A 4UOQA 5ICGA 2R1TA 4MWSA 1EZZA 4DPMA 4X66B 5FOSA 1J2RA 1ZPDA 2ZUWA 2Q3EA 2A4MA 3OZSA 3P5SA 5JJKA 2G83A 4BP3A 2GHQA 1QYRA 2HEIA 4LC1A 3E2MA 1TJ5A 2NU8B 4LSWA 3VR5D 1C30B 3GJTA 1TRKA 3ETEA 1SU6A 2EIHA 2WWYA 1SD2A 2G04A 2NXWA 5CYGA 3GLIA 3V4SA 3ZC3A 3SCZA 2R86A 1YUNA 4R84A 4WOBA 3PUXA 3L7AA 3VUEA 3A3NA 3K4HA 4GR5A 4RIGA 1N34B 5JDCA 2XA1A 1U04A 3ES9A 3IHKA 1W85B 3KZNA 4WOKA 1PW5A 1GUFA 1Z2AA 3P2YA 5FJJA 3E22B 1M3SA 3DHEA 1FNBA 1ULSA 4MKIA 5CDUA 1VJ5A 8LDHA 2W37A 4EZBA 1J23A 3L6CA 5KREA 1F2TA 2A1TS 1ZN8A 2QTCA 5B1EA 1K4YA 2PBZA 3PHLA 4LVCA 1E63A 1TU3A 4JUIA 3EX7C 1SN7A 4LJLA 5KUTA 1BTOA 2Q6LA 4BNTA 3G9ZA 4FJ1A 1B74A 2XZDA 4D82A 4E5MA 2O0KA 4F4IA 4KXYA 1IZYA 3GL9A 1R3UA 4L9SA 1Q3KA 4G5YA 3FFWA 1U1FA 3VRHA 4F96A 4MDEA 1VDMA 4A9AA 2QD4A 2NZ2A 3CLKA 3OEWA 2CNKA 2HUNA 3WE7A 5J1SB 1PK9A 1TJYA 4AT1A 1Z82A 1HX7A 5E4YA 1I9CA 1GPWB 4JU8A 3GVIA 3RGGA 1NQTA 1W4AA 1F0KA 4KXFB 2H7CA 3N0WA 3C43A 2V6BA 4OL0A 4EJ0A 4F12A 2X0EA 2XDYA 4KW7A 4Y2SA 1QYXA 2FPOA 1U0LA 2O7RA 3HFRA 5EXEA 2OOSA 4OHFA 1GD1O 2WC1A 1JKJA 1T5DX 3LXUX 3G0BA 4IV5A 4LVOA 4DMRA 1JN0A 3C16C 1II9A 1VOTA 2IBMA 3FDIA 3QLJA 3PDIA 1Z6ZA 4Q1CA 3BRWA 2E6UX 3H2ZA 2DTXA 4RPIA 3TOVA 3WP0A 2RMKA 3KOOA 1PGJA 4GVPA 5TJ9A 3IO3A 4QFBA 1JLLA 2GLTA 2WICA 5JHGB 1IHPA 2DHDA 5ULLA 1Y6JA 2OAEA 4FBMA 1LFDB 3OLZA 4U4AA 1ZBQA 1FJXA 1EUCB 2O8BB 4E3WA 2VDLB 1Z62A 2I6QA 1A8PA 1KH3A 2JBAA 2YJTD 4BEVA 5A7GA 1ATIA 1RZVA 3CT6A 3HXTA 2GKSA 2FWJA 3P45A 4DAEA 5J43A 1E64A 4MWZA 3AR8A 2XYGA 5DGIA 1RQNA 2VQ3A 3CKMA 3UEOA 2IEYA 4B44A 3R3YA 5U9CA 1DBQA 1ZJZA 1Q2UA 3RE1A 2QTNA 4TXJA 3RS3A 3SYTA 1XTUA 4AJHA 1Q14A 4L95C 2GXAA 1T25A 3CLSC 2ZK7A 3LI2A 2FPMA 2EG9A 3T4PA 3DKIA 4F3YA 3ICWA 1KKUA 5T4HA 3AXSA 1OYOA 1Y8CA 2XUPA 5IAAA 5F23A 3ADCA 3C7KA 2FLWA 2C5BA 4NYJR 2EJBA 3EIOA 5GP1A 3IA2A 4N76A 4D96A 3N8GA 1ZW1A 2PFKA 3QJ5A 4BVGA 4X1YB 1EA5A 1TUGA 5FPQA 4DMGA 1KZ6A 1E2KA 4TV8A 4CCYA 3T7JA 4LC0A 3D0KA 4PQEA 2QTFA 1DXOA 1USIA 3JQ9C 3UAWA 3GR6A 1L4GA 5BR7A 4P0PB 1URPA 3QLTA 1GYQA 3C98A 3MXTA 3UK0A 2G40A 4F3KA 4KPFC 3PWSA 1IBCA 5C7OO 4LECA 2HLDA 2GA8A 1UKZA 1NYLA 4MUYA 3TW4A 2FPWA 3VR2D 4C87A 3H9GA 4JJFA 1SVOA 3GT4A 3H8JA 1NW6A 2X2OA 2HT1A 3WIDA 1SXJB 2GEUA 2YASA 4ZK6A 1VB3A 2ZS7A 5MFZA 4MGIR 1HZJA 1Q0TA 3UMCA 2H06A 3UTCA 4MS1A 1U9JA 4E94A 1XCOA 3F8TA 2XGJA 2PZKA 4DCSA 5LSAA 2X0KA 4DCOA 4YLEA 2KPOA 4UM9D 5FP0A 3RT7A 3RSFA 3SYLA 4XA8A 4BNFA 1SQ6A 2HIGA 2R8YA 4OLJA 2OFPA 3CO5A 2YICA 3PEVA 1S7GA 4M0DA 1KO1A 2AMYA 2FYTA 2Q3DA 3HZHA 3JTMA 3P2EA 4PY2A 3FTDA 2VDNB 1LZKA 5ALXA 4RHTA 2A1UB 4JI1B 2YNMD 4DQKA 5BUCA 5GOZA 5JSZB 2JHPA 2QN6A 1I4EB 3MJRA 4L5IA 5ENDA 3PR3A 5JCZA 4BDSA 1KI2A 1N9KA 1UKBA 3VI3B 5JVDF 1A4XA 3ZYCA 2O3JA 3A14A 2DT8A 3VZPA 4NATA 3T3EA 2ZJ7A 1SULA 4NEQA 4OQ4A 2QRZA 5HR5A 1BWPA 1NURA 5G4LA 3DC2A 2AXPA 2IHTA 2C2YA 1NUPA 2JA2A 3U3MA 3L5KA 4ZOBA 5DNCA 5JTUA 2CUZA 4F6RB 2JPDA 3COZA 1BWSA 5ECDA 2GWHA 2PQ2A 2ZPUA 3FLBA 1KEZA 5E8JA 4PPNA 4ARBA 3CPJB 1DAPA 2DZDA 3I01A 4FR2A 4DNXA 3L6UA 1WW2A 2YYSA 4ZK2A 2XNJA 4I2VA 5KYWA 1RACA 5EUQB 1BCRA 2CJPA 2RGEA 4JJIA 3WGUA 4EGQA 3RS2A 3PC8A 3FR7A 4KI0A 3RUCA 5EJGA 4DCVA 5F98A 4F1KA 3FUUA 2BBOA 4WOJA 4WN9A 4RNDB 5CT4A 4G09A 5LL6P 1YF3A 2FP4A 1N6RA 2H4FA 1XB2A 1T8WA 2JHGA 3OE4A 3EFHA 1WV1A 4J0CA 4YRSA 2QLLA 4L5JA 3I0MA 4TRJA 5K3OA 5IM5A 1KU6A 3TMYA 3VKFA 4XM1A 4RK0A 5HILA 3TZBA 4X65B 2IH5A 3JQ8A 4LE1A 3CSUA 5ALDA 1QAOA 2FFBA 1QIJA 1JDUA 2B5OA 2Z8ZA 4B82A 3LQ1A 4FZVA 1FP4A 5CJ2A 3H11B 4AXBA 1Y34E 4Q00A 5LZ5A 5CPFA 2PH3A 1OUMA 2VJCA 1K7XB 2WUWE 2ZRCA 3CLRD 3CZCA 3KKZA 3L1IA 4QAJA 5C7IO 4A15A 1A9QA 4JVLA 4MDHA 1ZICA 5K99A 3I5YA 1ORDA 2GR9A 4LTMA 2CVPA 3PFGA 4ZQGA 4C3VA 5JSUA 2W2LA 1SBHA 3A1NA 5KQGA 1Y9DA 1JQLB 3QX8A 1NW3A 4LKRA 1CV2A 2FOIA 4AS1A 5TPZA 3RVDA 4M49A 3S2YA 3PC4A 3GVHA 2ORWA 3NHYA 2DETA 2D74A 1PIWA 4GI2A 2MSDB 1UDXA 2ZRFA 3NHLA 3HWX1 2FZLA 2H07A 3QUBA 3QUQA 3SDBA 5HPYB 3CUUA 2IYRA 2AW3A 2AR0A 4MRMB 3HN7A 5ECYA 1B4DA 2R4QA 4UZSA 1QZUA 1ULZA 4IXMA 1KEEB 1N7HA 2IYYA 2ZUTA 1MB3A 3C3YA 4Q1BA 1YZUA 3BSYA 2JLRA 3PA6A 2JLCA 3AR6A 4IJQA 5AKXA 4D9GA 1YL7A 5JDCC 2CV1A 2EV9A 3TYXA 4LOIA 2BMJA 2CNDA 3OZCA 1ISJA 1OTXA 2D2IA 2F4VB 4FFWA 4MVJM 4BJ6A 3DFFA 2MSKA 4XASA 3A7DA 2FMKA 2R65A 2R6GA 1LI5A 1IEWA 4JP8A 1JILA 4HEQA 5IFLA 1Z0JA 1FCJA 4QJIA 3E9ZA 5EJIA 4FVTA 2VLBA 3W6PA 3WMGA 3EC7A 1LPPA 2ST1A 3C6KA 3HI6A 5LOVA 4HLNA 1T2EA 4OLHA 2GCIA 1P0PA 5BW4A 2R8EA 2Z8XA 1E2MA 3DA8A 2R5NA 4JIGA 5COBA 5AYVA 4FT2A 5H3HA 1ODTC 3MTBA 2C7BA 2PKXA 2XOKA 4IHKA 1H8HD 1D04A 1Z8HA 2ZUBA 5B6JA 4J0FA 1E3WA 3VPDA 2Z43A 4R2MA 2RK4A 1TU4A 3EXIA 4GOJA 3S2IA 5KU1A 4QLOA 1O6CA 5KNBH 1X7YA 3QXHA 1MC4A 3LPCA 3AWDA 1C9YA 1WPXA 4Q9HA 2PFGA 2CMGA 2PUWA 2ZUSA 1CJSA 1G0OA 2CLFB 3SQWA 2Z2KA 4LV6A 1P2BA 3A26A 3DTVA 3NYQA 3QVSA 2UYQA 2DQKA 3FVTA 3UT5B 4HWKA 5JQGF 3LDFA 1P1RA 1T8TA 4WTOA 4BCDA 3NBXX 1ESMA 3O0DA 1XCLA 3JTEA 4RD2A 4KCGA 5CFOA 2J0SA 2WK1A 2UXDB 1OHHD 4OLAA 2AXQA 3LY5A 1L3CA 1QGUB 2XR1A 4ETNA 1O96B 1NVBA 4JFRA 1WOMA 4WKOA 4EI9A 5A9RA 1S2DA 2RHMA 4D26A 1QRRA 3N2IA 2HBQA 3CONA 3HKCB 4R9NA 3WIUA 4Z4EA 1RKXA 2RSLA 2JCXA 3P9YA 4NLLA 4D0RA 4OXIA 5ALUA 4M86A 4YRPA 5CCEA 1ONSA 3D02A 3PI7A 2AUMA 2GBCA 1JALA 3A4TA 4K6KA 3H9QA 2YYAA 3PC6A 2YUTA 3GK3A 2R4TA 1A7UA 5I9BA 3DULA 3VKWA 3LZ6A 5KWSA 1GAEO 3NVMB 4TWIA 3WXMA 1S8OA 3BJMA 1XHFA 3SXPA 5HF9A 5IJAA 4Y2XA 4MWCA 1QDLB 4UHCA 3WXBA 4ZOLA 1QFXA 2Z56A 3BJZA 3VPSA 4A73A 4PX9A 4EJMA 3UH0A 5G4KB 1CUVA 4Q1FA 2J0VA 4UNPA 4ZGBA 3F8WA 4OIFA 3LC0A 4CF6A 4ENVA 4DLNA 3QKUA 1Y4ZA 5BUSA 1AURA 1T1IA 2B4KA 4HQNA 3S68A 4ZYLA 4FW8A 3STYA 3PKIA 1XAJA 3L0PA 1C7QA 4HQRA 1OYWA 4AUKA 2GZRA 5LYJB 1O95A 1T26A 4BNGA 2GT1A 1KHTA 2HJRA 3OA2A 2H16A 1F17A 1M66A 2I2AA 3C6QA 4H0NA 4BRSA 2VBGA 3CO0S 3WGHA 3ISVA 1K92A 3EZGA 5HMLA 4JJ7A 1U1EA 2GILA 4BNUA 1KMQA 3H42B 3B1YA 4K9PA 4Z3OA 3DF9A 2BTOA 1T36A 5HG0A 1J0BA 3A10A 4XQCA 3R7BA 1Y6GA 1P7WA 3HHEA 2NACA 4IGFA 4CMBA 5KIAA 3ROKA 1LVHA 1LH0A 3ZWMA 5AVUA 4C07A 3AVUA 2OHVA 2AZ4A 1AU9A 1QFSA 2QM0A 4NMXB 3ETCA 4BTLA 1SHTX 2OCDA 2O9JA 2XT6A 4XRRA 5I4IA 3ZCXA 1VHQA 5JJBA 3VMFA 1SOMA 1FU8A 3TFQA 2HLHA 2JS7A 4FCWA 1KE1A 1WQ3A 1ZD1A 3HZRA 3L0YA 3ZE0B 3M1LA 1M2VA 1M2OA 2DGDA 3OLCX 4K05A 3OY2A 4PSAA 2W7TA 1FY2A 4J7XA 1XCGB 3MLEA 4UQPA 2IIBA 5HF6A 2I6GA 1K66A 4L7VA 4A2WA 4MQUA 4UBNA 2V9CA 3R4VA 5ALWA 4CNQA 4ZMSA 1C0LA 2R8PA 2C20A 4XIGS 4WACA 3DO8A 1V3QE 1NI4B 1JDZA 3RREA 3NWOA 3U4DA 1CRQA 1G5IA 3W3AH 4BE7B 1QGDA 2RHTA 3CHYA 4WXYB 2NUAB 1SCKA 1G3UA 2BDEA 3UAOA 1F5NA 4H1VA 3D59A 3FSRA 4CE6A 3BICA 2PUFA 1L8AA 3V9PA 4QDXA 3FCCA 4GT1A 4HRXA 4JCCA 3U39A 5BR8B 3LDAA 3REQA 4DJDC 3JASB 4IFEA 4Q4HA 5DNEA 1QHXA 2VT2A 3CWQA 4YV2A 3TIIA 5BNZA 4MW4A 2GLXA 1CF2O 3IAXA 4L5AA 1HG0A 3AETB 3NORA 4GBMA 4YRQA 3V1YA 2PM8A 2BZSA 3PC8C 4W9NA 2B4YA 2J4DA 4ZFNA 3NIWA 4MCHA 3AP1A 5EYPB 2G1JA 1EVIA 1TJ3A 1SBZA 1RPZA 2PFSA 2Q4RA 3Q8WA 3QUAA 2W4IA 2DB3A 2L82A 3FJ1A 1X39A 2HT6A 3B2QA 3QYJA 4UU7A 1WF6A 2LW7A 4YRZA 5JXGA 1RRFA 1Q17A 4CPDA 3I5XA 4EMTA 1N4AA 3NVAA 4EELA 2GM9A 2Z4SA 1KXZA 3BG5A 5A6SB 4H4EA 3OPYI 1DRKA 4KFSA 3WLRA 5F1YA 4FYHA 5KJ1A 5KMGB 2Q4EA 3CN7A 3MPUA 5BURA 2A3NA 2BKVA 5I9NA 3PUKA 3ZV6A 4YUYA 2CUTA 1B3RA 1YA8A 2WA2A 2M1XA 4MUMA 2IEDA 2RJOA 1P6UA 2NT3A 1ZXBA 2D5CA 1NQAO 3H2YA 4Z9YA 3V4ZA 3F4KA 4TUYA 3B7GA 3X3HA 1FP1D 1JPUA 3AW8A 1W0KA