1SK8A

Crystallographic snapshots of aspergillus fumigatus phytase revealing its enzymatic dynamics
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
435
structure length
435
Chain Sequence
CDTVDLGYQCSPATSHLWGQYSPFFSLEDELSVSSKLPKDCRITLVQVLSRHGARYPTSSKSKKYKKLVTAIQANATDFKGKFAFLKTYNYTLGADDLTPFGEQQLVNSGIKFYQRYKALARSVVPFIRASGSDRVIASGEKFIEGFQQAKLADPGATNRAAPAISVIIPESETFNNTLDHGVCTKFEASQLGDEVAANFTALFAPDIRARAEKHLPGVTLTDEDVVSLMDMCSFDTVARTSDASQLSPFCQLFTHNEWKKYNYLQSLGKYYGYGAGNPLGPAQGIGFTNELIARLTRSPVQDHTSTNSTLVSNPATFPLNATMYVDFSHDNSMVSIFFALGLYNGTEPLSRTSVESAKELDGYSASWVVPFGARAYFETMQCKSEKEPLVRALINDRVVPLHGCDVDKLGRCKLNDFVKGLSWARSGGNWGECF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 3-phytase A
publication title Crystallographic Snapshots of Aspergillus fumigatus Phytase, Revealing Its Enzymatic Dynamics
pubmed doi rcsb
source organism Aspergillus fumigatus
molecule tags Hydrolase
total genus 154
structure length 435
sequence length 435
ec nomenclature ec 3.1.3.8: 3-phytase.
pdb deposition date 2004-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00328 His_Phos_2 Histidine phosphatase superfamily (branch 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 1sk8A01
4D4JA 1YFKA 1SK8A 1SKBA 1IHPA 2ENWA 2EOAA 3DCYA 2ENUA 1DKLA 3QPUA 3O0TA 1SK9A 3MXOA 3GP5A 5AJZA 4ARSA 2H0QA 3E9EA 2AXNA 2A9JA 3QPWA 2OWDA 3IT2A 2P6OA 3E9CA 5HTKA 1H2EA 1ND6A 1EBBA 3C7TA 4IJ6A 4PZ9A 3PGMA 4FDUA 3LL4A 4D4KA 1DKPA 1SKAA 1RPAA 2EKBA 3E9DA 5AK0A 1DKQA 1BQ3A 4JODA 1T8PA 2P78A 1RIIA 3D8HA 3LNTA 1C81A 1DKOA 4GPIB 4ARUA 2DWPA 3QPVA 3EOZA 2I1VB 2YN2A 1XQ9A 2QNIA 2WNHA 1FBTA 1E58A 1QHFA 1DKMA 1BIFA 1RPTA 3GP3A 5AJYA 1TIPA 5HR5A 4EO9A 5PGMA 1UJCA 3F3KA 3IT1A 4PGMA 2P6MA 1V7QA 4ARVA 4AROA 5CDHA 3ZHCA 3K4QA 1QWOA 2IKQA 5AJXA 2P2ZA 2F90A 4JOCA 3MBKA 3KKKA 2HIAA 1QFXA 2P9ZA 2OWEA 4MA4A 1C7ZA 2P30A 4TSRA 2P77A 5AJVB 3LG2A 1CVIA 3FDZA 4FDTA 4GPZA 2WU0A 4E3WA 2RFLA 2GFIA 2PA0A 5AJWA 4D4MA 2HHJA 2P9FA 3D6AA 2H4ZA 5CU7A 1K6MA 1BQ4A 3GW8A 3EZNA 4PZAA 4IJ5A 5CX4A 2P2YA 3FDZB 1C80A 2YN0A 4JOBA 3HJGA 2P9YA 3K4PA 2BIFA 3OI7A 4D4LA 2WNIA 3D4IA 2HPAA 1V37A 1FZTA 1DKNA 3NTLA 1UJBA 3NFYA 1ND5A 2P79A 3F2IA 2H52A 1YJXA 2P75A 1E59A 2H4XA 1H2FA 3FJYA 3BIFA 4QIHA 4HBZA 3IT0A 2EKZA 1NT4A 4ODIA 2A6PA 4EMBA 3R7AA 3DB1A 2DWOA 3IT3A
chains in the Genus database with same CATH superfamily
1GRCA 1CB7A 3D31A 1C9EA 5HBRA 2M1XA 2QYHA 3OT1B 3PNYA 4L4RA 4CM8A 2IIVA 4PPFA 1HDXA 1MAVA 1ZL0A 3MYYA 4QUIA 5HRAA 2QAGA 2JRLA 3A6FA 4E2WA 3EEBA 1E9BA 1B23P 1DJMA 3KDSE 4O08A 1WHTA 2ZTLA 3O0DA 3MC1A 5EE9A 2OZKA 5TR9A 3F47A 4JQOA 3MJRA 1DQYA 5FOTA 1OJLA 4NAVA 4MQEA 1FLNA 2OORA 2YYAA 4Z7NB 1GTJ1 2BFDA 2XNDA 2YOGA 4IXDA 3RR2A 4ACAA 1XQ1A 2IX3A 1S2OA 1ORTA 2WINI 4DT1A 2HO4A 2QORA 2XMCA 3QWFA 4D41A 2UYOA 1F8UA 1KDZA 5EFOA 3DBRB 1LPOA 2XCRB 2EF1A 2J4DA 1TKBA 3DTVB 3VKWA 2ZM6B 2VDUE 2IZZA 3FVWA 4J29A 1GL3A 1Y6RA 4D3SA 4ILKA 1VJ1A 3EZ9A 3QVUA 4A0QA 3QP9A 1CUHA 5K8JB 2WBLC 2CKMA 1U80A 1RJ9B 3K4HA 1NE2A 3NV7A 4I8XA 2QT0A 2QG4A 3W6ZA 3WRXC 2BEJA 4E6EA 3H5VA 4PLYA 4QXMA 1REQA 2GF2A 4UXIA 4KIFA 4JYPA 4KQ2A 1U2RA 2XZPA 2P6MA 4LY9A 5ADVA 1E96A 2V3VA 2WWHA 5EE1A 5ETJA 3QLTA 2NYAA 4HLUC 8ADHA 1VIDA 3L4KA 3QV1A 3EG5A 4EYKA 1Q11A 3UPDA 3K8YA 3H7IA 4F86A 3HA7A 1BE1A 2VS1A 5DHSA 2HLDA 5FADA 4UZEA 4XZ3A 3QA9A 1A9SA 1IB0A 4W7IA 4XWYA 4Y1EA 3RSQA 4QPPA 1DELA 1WCYA 1K27A 2VZLA 3TZEA 2CXPA 1O87A 3O4IA 2LPMA 4M1YA 1V3UA 1FL9A 4OU4A 4YCCA 4P6VF 4ZK2A 4XWAA 3WDMA 4RJKA 4EITA 1SAYA 5EIHA 4CN9A 5I5EA 2JLRA 3KWFA 4E33A 4K0RA 4PC7A 5LP1A 5KO2A 1AOXA 4CR7A 4EVQA 2AK3A 4UVHA 5JAUA 3RIHA 3VNQA 4PRKA 9LDBA 2ZBDA 4LMPA 4M38A 3KR9A 4HGRA 3IVMA 2QQFA 3PIRA 3L6RA 4H3SA 5C8YB 1USUA 1FK8A 4M9RA 1XDWA 3FYUA 2PZFA 4B45A 1G64A 1J90A 1E6WA 1U2GC 4FCTA 5CYFA 3R8XA 3H4TA 1V95A 2QYTA 5CIYA 1L6RA 2B82A 4TMVA 5FBHA 4MGHA 3MTBA 5EIOA 1AH2A 5FA5A 1XN1A 3R74A 2A0KA 2PMBA 1G3QA 5EMNA 2WMOB 2HHCA 3WLQA 2Q6VA 3ND5A 3GWGA 4I14A 1ZPDA 4MW2A 4DLAA 4E31A 1U5AA 3PSAA 2XNHA 4QE3A 4HAXA 4RTNA 5JH7B 1QP4A 1DU4A 1NF3A 5KTKA 3UT6A 2FMTA 1MNAA 3TDKA 2IDZA 4IGEA 4HK4A 1P2DA 1JDSA 3SFTA 5HIAA 3EUFA 2FKNA 4OH1A 5CTAA 1RXUA 1GKUB 5AW5A 5IULC 1QHHB 3TXXA 4YV1A 2WT9A 3ZCUA 2MTBA 1HSOA 2E6KA 4MW7A 2HRBA 1WW2A 4JBIA 2B3TA 1RABA 2GRAA 3L07A 4HRXA 3NI2A 5DBHX 5BQ5A 3RWBA 4L8YA 4D8UA 2W6IA 1UAGA 1S01A 1U0HC 3WP0A 2QQ0A 1ORHA 4GIBA 2HIMA 3OQJA 1F7VA 5CAEB 1BFKA 3BWEA 1Z08A 1F6BA 1O6FA 5ENDA 5THQA 4EL0A 2R4QA 5EIWA 2QY6A 1UZUA 3T7CA 4FP9A 3C8MA 4AULA 4I6GA 1TC1A 2CV2A 2Z1MA 2WHEA 2H7CA 3OE1A 5AVTA 1NFRA 4JVNA 5G4KB 4HH3C 2EZ4A 2FEAA 2Q27A 4EHJA 3WIUA 1XK6A 1GCIA 3OAAD 1DMRA 1LY1A 4GDFA 4Y2TA 2P27A 4M86A 4EUSA 1OH5A 2IIBA 4TRJA 4C05A 3T7IA 1Y9DA 3U4MA 1N57A 1M6VB 2AEEA 3FSRA 3NKFA 5IT5A 1IB6A 5BYAA 2QD4A 4YECA 4HH1A 3WIBA 3ZEAA 5GP1A 1E7MA 1XZEA 3UK1A 5IUKC 4BRUA 3EC2A 1S4MA 3KR2A 4D9CA 5L8VA 1CZNA 3G0GA 4C5CA 2GN8A 4MLCA 4TKUA 2IZ7A 3HVUA 3N7TA 1ZCZA 3VHLB 5DGHA 1DKMA 1G7TA 2AMJA 3FBWA 3UZUA 3VKGA 5HEKA 4YMIA 4LJAA 2X0RA 1A8QA 3PQ6A 4YV0A 4PGMA 2YIDA 5K03A 3E05A 3FYCA 4XFDA 5J4VA 1BVHA 2V96A 1ELOA 1CUIA 3NHYA 1QO9A 3IHLA 1X1TA 1CCWA 3WB0A 1HNZB 2JKVA 3M8KA 4Q3AA 4AY5A 3M82A 4TTRA 2OLKA 5F7JA 4OF4A 4QELA 3X1JA 3TR6A 2QXUA 1RYMA 3KPVA 1ODIA 2DHEA 2DHDA 3A4MA 5I8ZA 5BRJA 1GPWB 1HE8B 2BGLA 2PR2A 2V4UA 5GTDA 4KBFA 4AAYA 4CQJA 4K0KB 4DEXA 4RPCA 1LC3A 4K5QA 2FE4A 5DGTA 1P80A 3EIHA 4J1NA 3TPFA 4CM7A 5ELMA 5CFMA 4XEUA 2P3SA 1KAQA 1KZ9A 4Q1BA 1IG0A 3TL2A 1R0KA 3PVCA 1Z88A 4PPNA 5K0ZA 4J7AA 1AGPA 1P60A 3H18A 3EZLA 4DSTA 3UUFA 4DJTA 5AKZA 3SVTA 3SU8A 3N0WA 3CF6R 2PANA 2CLIB 7YASA 3E84A 2NUTA 3MN1A 4BMZA 3VO9A 1P5ZB 4YJ2B 3L7YA 2PGDA 3H11B 4A8JC 5EWLB 1W5TA 3K6SB 2WK1A 4INPA 1SULA 1X8KA 1I8TA 4D96A 1US8A 2GA8A 5LQUA 1OIWA 5C5IA 1VCMA 4RKRA 1ZD1A 2VJDA 4RXUA 2OXFA 1DBVO 4H3VA 2OXRA 4IWYA 3PEWA 1ZKDA 3IAUA 5FPQA 1SCJA 2ZYIA 3JQRA 5FFFA 4F71A 1EP2B 4PNZA 1BU5A 4US0R 1CWUA 1XRPA 4NU6A 1E2NA 2FRXA 2PZLA 4PGHA 5EYPA 3UO8B 3U60B 2IPLA 2FQ1A 4NU8X 4ZTUB 1TEVA 2FR8C 1C7FA 4MYSA 5GGYA 2AR0A 1SCKA 2XSZA 3TRFA 3KC2A 3W8DA 2WNSA 1F9AA 2ZAMA 2KBEA 3KYBA 3T3PB 1S9HA 1TGVA 3DZBA 1HY3A 4UDOA 4X1KA 2LCQA 4QOGA 4HYYA 3H9GA 3NCTA 5LP6F 4RHFA 4KVAA 2CMGA 2NTNA 4RHYA 3QKWA 2C2OA 3GLHA 1D9XA 4PC3A 4NC9A 3O4HA 4I55F 1G0OA 4B4WA 4EZBA 1KZHA 2P0YA 2VJQA 1FXWF 1ZMOA 2W6JA 2ZBGA 4FYPA 1MOQA 3G5TA 4RS4A 3FPFA 1IQPA 2PLNA 3FOBA 3JQ8A 4K9OA 4O1HA 2YJ3A 3BHJA 2RJNA 4WE3A 4ZT5A 1QRRA 2QL9A 4OX9Y 3EIQA 5FPTA 5LZ7A 1W19A 1JILA 2NXEA 2D3WA 2XKBA 4NJEB 3DHEA 4GZ5A 1IWPB 3G1UA 1LUAA 3P4XA 1T8PA 3MXTA 4XX0A 2IUUA 2CCKA 1G63A 2EG5A 1T8SA 2FH5B 2WDPA 4JIMA 4NBKA 1UKBA 3SEAA 4D9KA 3UMYA 5LA6A 4QLOA 1K89A 2A88A 2AZXA 3CZPA 4NK5A 1NU8A 1FU4A 4Q34A 1OI7A 1R8JA 4C3OB 3O84A 1H2ZA 5L9AA 1SUBA 4D26A 4JB0A 1C30B 2ZRAA 3AF3A 3SF8B 1T2FA 2CYCA 1YZQA 1HF3A 2FCAA 4NICA 2XXJA 2VBIA 5KYVA 2Q99A 3O1HB 3OX3A 4DCCA 1YDMA 1H85A 5HS6A 2PNFA 5KVQA 1IJBA 1NN5A 3PDWA 3MD0A 5FWXA 1ZJYA 1BWPA 3BXHA 1NMZA 2FZVA 4H7EA 3CNOA 5AKEA 1LS1A 3ONDA 4YP9A 3ZV3A 5K0JA 4GZ6A 4I5FA 3P2YA 2REXB 3NT2A 1XRMA 2J41A 1L5FA 2O0LA 3CCFA 3L43A 3QXGA 4GLOA 4KMMA 4WJKB 4W5NA 4Y7CA 1XO1A 1EQUA 3V2UA 2D74A 4FX5A 4GOKA 1YMQA 5A4FS 1EK0A 1HE1C 1ZAKA 1CQIB 3DPUA 3NHAA 2VNKA 3K5IA 3OKCA 4WZBB 3PLAE 3JWGA 2FK7A 3QVOA 5A1JA 4ZALA 5IEBA 3UMMA 2Y3IA 3RIXA 3FZGA 1DAPA 2Q4DA 1GQQA 4WXMA 1ZI9A 4LQDA 3OOSA 2ZJ7A 3PR1A 4KQMA 1N32B 2Z6VA 4JSRA 1FP2A 2H4JA 1TYAE 2NO0A 4GR4A 4EFKA 1E9SA 1WPQA 3RTCA 2PK3A 1J9EA 1ZUNB 1X7ZA 5E38A 3GLHE 3R5SA 1T3HA 4KQFA 4ZQFA 1CUVA 2I9PA 4J2OA 4L5CA 1U7ZA 3I3OA 5CM9C 3C3MA 1EA7A 4RJLA 2QJFA 2R7NA 2XODA 3IMKA 1CJUC 4XB2A 1F0PA 4YO7A 4FT2A 2J9FA 1A1VA 4TROA 1B3BA 1E0AA 2W6QA 1NBOA 2HL6A 3FLAA 1A88A 3GFOA 2EW8A 4RABA 5IASA 1NXSA 2X0NA 3ZY4A 5THKA 2B35A 2OAQ1 3P9QA 1VJRA 3QPAA 4IZHA 3DPIA 4GLJA 4MW5A 1RYBA 3GVIA 4PLZA 5DJ5A 4QXRA 3FKQA 2H65A 4DDUA 2GHIA 1AGYA 1OTYA 3DFKA 4G8BA 2ZQ5A 2Y6VA 4AN0A 2G36A 5K8LA 3UANA 4DMKA 2Z09A 4OKNA 1TM7E 4A8HA 3H9CA 2ISSD 1DFHA 1KMCA 3JASA 5IF9A 4WVLA 3OZSA 4OV6B 1YI1A 5EFZA 2Z5FA 3A27A 2VSQA 3W2IA 1JFLA 3FOAA 1GARA 4J0CA 3CLSC 2BHTA 2P41A 4UREA 1NN1A 4WDQA 3L46A 5HIMA 5JMWA 4R6WA 4IOKA 4RYLA 1IBMB 1EJ0A 4YYEA 3CEMA 3DMTC 3SSOA 2JJQA 4ESHA 5IZCC 1RAGA 2IX9A 1OZFA 3ZWWA 1F2TA 2A9KA 3OECA 2GZHA 3G2JA 1JQKA 2JZNA 2M9MA 1UAYA 4I5EA 3V7YA 5CYPA 4U2CA 1JYFA 2FWBA 1KU0A 2BGUA 1F0YA 4LRWA 1V43A 4LYGA 4RU1A 4Y2GA 3RGGA 2HADA 4QDZA 4A16A 4EEXA 4PN3A 1JEYA 2P8SA 2XXAA 1S8OA 3UWMA 1BCRB 2WSIA 3WGHA 1Z2NX 1MVLA 3TZKA 3HA2A 4MW4A 3A3OA 1TF5A 2BFEB 2Q4RA 3EOBI 5BN5B 4EUKA 3JAMA 2O5RA 2HWXA 2QZPA 3JALA 4IDNA 3RNLA 3V4PB 4EG5A 2EGGA 4BQIA 4ES6A 4RK5A 4LGVA 1RIIA 5EESA 1MXFA 3PEVA 4QOEA 1XNJA 3LNTA 4J2HA 4JX9A 2WKWA 4Q4LA 4X3PA 1GDHA 1YBMA 3T9AA 4PZ0A 1SXPA 2WOJA 5TQ0A 1QZUA 4EP1A 3OCJA 1FVFA 2ZATA 5JXGA 1G59A 2FRDC 1QIJA 3I37X 3SIRA 1X87A 2AOXA 2WAAA 3WRYC 3E9ZA 4BNKA 4WINA 3PQDA 3KCQA 1RLJA 1E32A 2QIOA 3O90A 4KUEA 2VBGA 3DBHB 3CUTA 5ILGA 3TIXB 1NVDA 1QHYA 1QTNA 3F5MA 3LQRA 2B4AA 2QV7A 4LXUA 1NQTA 3CJQA 4CDRA 4LISA 5JALA 3GLIB 3UHAA 3V4RA 2VUUA 4FDAA 4N3GA 3OQPA 1PNTA 5A9SA 2FMFA 1Y1QA 1O0BA 2VKQA 4NMHA 4IDCA 2ORED 3LGXA 4KRXA 4CF6A 2ACKA 2BH2A 3NYRA 1ACJA 1AGNA 2QPAA 3GNQA 3C6YA 4UBKA 2G76A 3PCTA 1FQWA 1GUDA 4ML3A 2VHYA 3V1YA 3BFJA 1GCUA 2KSQA 2W4QA 3LHSA 1ENYA 2QJRA 1MCZA 4P22A 3L6BA 5AJVB 5K8TA 3WGVA 1JG2A 3F73A 2VNHA 3M4YA 3SZLA 4L2IB 3OPYB 2J0EA 3IDAA 1AGRA 1FDVA 3WGGA 4OHFA 3DE1X 1TTHA 4RVNA 3RDPA 3GLGA 4BP1A 3Q87B 4E30A 1JVNA 2RGGA 2B20A 3TD9A 4I9NA 1LLFA 3BBLA 3N70A 3RK4A 4GOOD 1SC3A 3A05A 5E6RB 3J81A 3VOSA 5THXA 1KP9A 2O3UA 1UDXA 3PL1A 4LQCA 3RSFA 3SD7A 1SPBS 2LIPA 4FUQA 3ICVA 4IMJB 1YOVA 3O6VA 1X19A 3DOIA 3C3PA 3FE2A 3S2FA 2PX4A 4NU5A 4YC7A 5GINE 1N3YA 3P32A 5GY7A 1P17A 4HPWA 1YQEA 4IUBS 1FVOA 1DC8A 4B3GA 4UHJA 1DX4A 4HDSB 1ZRHA 2IXDA 3HN6A 1SPXA 4IVQA 1GYQA 1ULHA 3W5BA 3NEPX 2HB6A 5CD9A 2CD9A 1TJ3A 4K28A 3N53A 2JLBA 1E3DA 5DSXA 2FZKA 1CZHA 1T4CA 1R4MB 2CGEA 3VC1A 5TGDA 2CFTA 3OLYA 4OJQA 1M1NA 2QD1A 5KKAA 3O3MB 2R8OA 5BYJA 1NUSA 2CHVA 2DTEA 2WFAA 3ASUA 1TA0A 3AU9A 3MJEA 4JVOA 1AX9A 2QV0A 2NU6A 2Z8YA 4PFKA 1BMTA 2ZB2A 3CB2A 4R8VA 1QK4A 5CLLA 4HVCA 1YUMA 2KE5A 3EPRA 4WCFA 2RD2A 1EFPA 2CXXA 2I3DA 3L8GA 4RH3A 1OQAA 4LI0A 4BP8A 1RC8A 5CVUA 4CE6A 1P6QA 2NVOA 3CYFA 3UT5A 1W87A 4C6TB 1T15A 1WXXA 1E6CA 4MWCA 4ARCA 1Z75A 3R2JA 3ZOZA 3GUZA 2OV8A 3ZW9A 5BN3A 4R2LA 3A58B 4Y2QA 5DLEA 5FO0A 5A05A 5KNCD 3HJBA 1EDEA 3IMCA 3PPYA 2LW7A 1EZ4A 1GQFA 1JA0A 2EJCA 2WJZB 4J1SA 3KQKA 2L17A 5I47A 1XDUA 4L4YA 3RC2A 2J4FA 4EELA 1I4TD 2VHWA 4RPHA 4XDYA 2GHTA 5F2EA 2AG0A 2JZCA 2FW7A 3H1PA 4MCIA 4YIHA 2JCYA 2CE7A 2JVKA 2R8EA 3IIKA 4HTFB 2ODEA 3JS5A 4BZWA 5ERXA 3TE7A 1WZEA 2FFBA 3G13A 4GSYA 3HNOA 3GLGE 1BW9A 3HM2A 1E3LA 4I4TA 1L5ZA 4C07A 2WUDA 3X1DA 2FG6C 2PX6A 5HNKA 2XKKA 2O2SA 5AUNB 1QU2A 4C7OB 5TX7A 1ETHA 4TXHA 5K3BA 2AC2A 2AE1A 2AG5A 3KVNA 1N2IA 3GUVA 3RS0A 4R3NA 2YN2A 4EA6A 1T43A 4E13A 1U3FA 1IC6A 1YRYE 3R3VA 5DOZA 3RQSA 2R1TA 4QGAA 1OW3B 3AY7A 5CFOA 2WIDA 3F4LA 3M89A 3L0PA 9LDTA 2LXNA 1QZ3A 4JLPA 4RIIA 4DLYA 3OCVA 1VMKA 5JAHA 4RD4A 3PNVA 2A30A 3HLTA 4KQHA 3JQGB 1VSVA 3KZXA 5COQA 4MRNA 5BQOA 3AM1A 1T2DA 4FOOA 4YQEA 3HFSA 1JHVA 2C31A 2R84A 2RK4A 3KQPA 4TMZA 3SCZA 4JVSB 4J9UE 1S8NA 1TLTA 3SXUA 3T7TA 2RK6A 2F90A 1T0IA 2ZR7A 2X19A 1BEUB 5A02A 2EQAA 3FR7A 3K73O 1C3LA 3H75A 4H7DA 2HA4A 3ILYA 1YCDA 5FAXA 2EP5A 2X0FA 4YAFA 1GG8A 2HXSA 2HRDA 1RRKA 2LKCA 4DTCA 4ZO8A 1XBTA 2Z9BA 4MYDA 6ABPA 2FN7A 3EZGA 3LC2O 4RTPA 4AUKA 2E89A 4M54A 4EQ6B 5EAIA 3AEQA 4IMPA 3CU5A 3I6QA 4FKBA 4DY4A 2AZ4A 1OBFO 3LP6A 2RHMA 3P9SA 1G8JA 1U5BA 3IELA 3ZDQA 2IU3A 3MMPA 3CT4A 4GHWA 4WKNA 2X41A 4A9AA 4EL5A 1PNQA 3GJZA 2BM9A 3ZUPA 3ZIAA 1DINA 2EJUA 3VR3D 3C5CA 2P2NA 3HN7A 4LY6A 1NL3A 2EP8A 2QN8A 1SVUA 5HF8A 2WJ6A 1QTIA 2AI3A 3C6ZA 3C8UA 2QRJA 3F6YA 3NHMA 3DF9A 4X7BA 5F77A 1WZ2A 1MAWA 3HMQA 3KJGA 3TUIC 2OESA 5ARDA 1JLMA 3CZMA 4RK1A 1YUBA 4PINA 2FPXA 4P3YA 3T3MB 3H5LA 1WZIA 5IT4A 1I1HA 1YZKA 3PVSA 3I12A 4TWAA 3SSMA 4YP0A 5LDHA 1I7SB 3TPCA 1CQJA 4YIKA 1E0SA 1RWPA 1QLHA 2WTXA 1R10A 1XALA 3UEOA 4UARA 3KL2A 5I51A 1USVA 1XC7A 1Z5OA 1HE2A 5F98A 221PA 1T1SA 3UGQA 2W6CX 4DG9A 4EHNA 2QXYA 4MQ6A 1V9SA 3STXA 4J90A 5KMGB 5DBGA 1IE3A 1GA4A 1LA2A 2IPAB 1E62A 4WFQA 1V9CA 2E82A 2ZUDA 4R7GA 4EKGA 4HMQA 4JLBA 3AL3A 3EXG1 4RL4A 5JWOA 3AUUA 2ZUCA 4I3GA 5F3DA 1L4YA 1S1MA 2BR5A 2F4NA 5ESRA 2VATA 4H7FA 4M9ZA 5JZOA 4PFJA 4O4LF 2MINB 3PGMA 3AFOA 5TRTA 4D8YA 4NNJA 2QR5A 1GUZA 1NYRA 3BX1A 1YQDA 1MW9X 2WJIA 2FPRA 5JYCA 1IVNA 2QY9A 3RQIA 3OPQA 3E1KA 2FEMA 1UMCA 4R1PA 1SQ6A 1NVAA 3G23A 3DZCA 1T9AA 2HHLA 1CP3A 2ZVPX 3EVZA 3GT7A 4RADA 1GGVA 1F4LA 3AF0A 5DGDA 4WLUA 2JIOA 4EK9A 2O1SA 1V7ZA 1TPYA 4YT8A 2F1RA 4IF6A 2CZCA 2J6HA 1TUGA 2O48X 1HLFA 2B6HA 3B85A 3SHFA 4AN4A 1SWWA 3FJOA 4ADSG 3PDUA 4IUYA 1RWQA 1V48A 2PWAA 1G5FA 3L0ZA 1VKZA 3SS7X 4DR2B 2A5LA 5IANA 2PX5A 3PLRA 5T6BA 1V39A 3MJCA 4LOAA 1MAUA 4UCQA 3RH0A 5FLKA 4V0OA 1S2GA 3OQIB 4TS4A 2Q7OE 3JD2A 3K0CC 3WK5A 1FDSA 1MVOA 5DYGA 4YMSA 3PV0A 4B3DA 2PBRA 4FQ8A 2IYXA 2C4WA 2ZI5A 1S96A 1I5RA 3E7WA 1K5PA 3ED1A 1E9VA 3LY9A 4JEHA 3EDYA 3I23A 4WK2B 1MIHA 1NNI1 1PE0A 2N3ZA 3GAZA 2VTDA 3JVEA 1NG9A 4WA8A 2OC9A 2HK7A 3EVAA 1NC1A 3O7WA 3TBHA 3TRIA 1E7WA 2O3JA 4GU5A 2AC4A 4HGQA 4ZI5A 2TMKA 3AESB 5BV0A 4Z4EA 2D0DA 2RAFA 3FCSB 2ZETA 3FPGA 4QA9A 4FHEA 3HZHA 3KB2A 4F8YA 3I1FA 2C0PA 1BXKA 4YRCA 1RQXA 5G4LA 1D0SA 5A4AA 1B8VA 1A4XA 3BWXA 2XUGA 3LPCA 2RKOA 5AW3A 2PX3A 5ICMA 3R3JA 4KC0A 3W8RA 1Z4PX 1Q6ZA 4MR9A 1K8QA 1Z6TA 3R4CA 3BCUA 4BNFA 3EGEA 2I7XA 4G2NA 1P9WA 1YJCA 1V41E 3IMFA 2H52A 4X6YA 5EKTA 1NX6A 2QYOA 3KT0A 2XZTA 4NCAA 4P4SB 1OHHA 1Y1SA 3DT9A 1DIRA 4N8DA 1VLLA 3ICQB 3IVGA 2I6UA 3VU9A 3SPXA 4FZ3A 4XD7D 1U7DA 4IUCS 3ZHUA 4PG5A 1TPZA 4OI1A 4G97A 3IX7A 3IODA 3X44A 2EKZA 3U7GA 4EMBA 2QL5A 4U7WA 4S1OA 3V1LA 4H31A 4MZDA 3X1XA 5KPJA 4G0OA 4V0QA 1QG6A 1U0NA 3S28A 3JD1A 5BMVA 2ZIXA 4W1SA 2XDQB 3Q7SA 1VE5A 4EGFA 4UU7A 4LTDA 2JHAA 1OLUB 2WLTA 2QI9C 1U8ZA 4XVRA 4JEUA 3P9CA 4O2BB 1FS5A 2MJLA 1NVVQ 1E1KA 3KVOA 4BUCA 5IT0A 2O7VA 1HG0A 2C7OA 3TD2A 3TNJA 3QVMA 4N48A 3K9QO 5HK8A 2P0EA 3HJRA 2VYQA 3HB4X 1F3OA 1JGTA 5AO9A 5E6SA 3R5FA 1T4GA 1L7XA 3GY0A 1TAHA 1GRRA 4HQOA 4M1QA 5EE5B 1OAOA 1SB8A 2I2AA 2VZ0A 1J0BA 3HYNA 2NM0A 4GRDA 3SKXA 3ZZNA 2VZEA 4KODA 4MRMA 4RIFA 2ZYWX 4DS3A 5A62A 4Y6RA 4JUDX 4ID3A 4KB5A 4B43A 4EFLA 2JK0A 3NIGB 4EZEA 2EX0A 4GGPA 1R6AA 2Q1XA 2BFMA 3I6YA 3PNQA 4LTMA 4DQLA 4RH0A 3QF4A 3AHFA 1ECFA 2HBYA 2YVLA 4RFSB 3KHTA 2L2QA 4X94A 5K45A 2UUPA 4IZ6A 2VVTA 3DE6X 3MS7A 1NWCA 1V6SA 1U0SY 1RXSA 4MUHA 4GG1A 4AJ1A 1RP1A 3O83A 2VJLA 2ZCJA 5ALZA 1XDGA 4KGXA 1TLLA 3NHJA 4ZYLA 2QZZA 3C6MA 3FHOA 1UWKA 1OX6A 2J3LA 4ZPXA 3WGNA 3QLUA 1ULSA 3FWHA 3ZBPA 3PGA1 4O0MA 3I5AA 1W0KD 3CX8A 4LJ9A 5F52A 3THSA 1E2DA 1VCOA 4QXOA 5CYGA 3VTFA 1LI5A 2I7VA 3D3EA 4WFIA 5TPZD 2C9YA 3FCYA 2VBCA 2P30A 4YV7A 2O20A 5A6VA 5AW2A 3L5KA 1X7WA 2QMHA 3AW9A 3QUSA 1QYDA 1L5VA 2ONCA 3KRTA 3C6KA 5C5CA 4JU9A 4YRPA 3B36A 2BUBA 2ZJAA 3OCUA 3MT9A 1CJBA 1UF9A 3L06A 3UJ7A 1T5DX 3OBIA 4ZGGA 4YCSA 2PGXA 2AUTA 4LQLA 1PSWA 4L8GA 4G5XA 1N6PA 4RZIA 2VDRB 1UBSB 2W2TA 5ESDA 2V74B 3O03A 4D0NA 1MO6A 5IM4A 1MC4A 1YMUA 4C22A 2OHOA 3AEZA 3QLVC 3KBOA 3IKLA 4J4HA 3WYAA 3D2BA 3WGUA 5B6IA 4FYKA 5COAA 3U7EB 4MZXA 3RRZA 3QSGA 1ESDA 3R3WA 4LBVA 3SI7A 4CMAA 4L4SA 5LKAA 3FPKA 3NFYA 4V3BA 3URKA 4D43A 2Y67A 3R3HA 1VSQA 2IYQA 2Y76A 1WKCA 3FCCA 3GQBA 3K53A 3LC0A 2J7PD 3QNUA 4LBZA 4H1VA 4TYPA 5EG5A 1B2LA 2BL4A 1Y33E 1ZC4A 2GESA 3ITKA 3PUZA 4YK7A 3M4NA 2LZ0A 4DHWA 5TT1A 2H08A 2ZXFA 1WSDA 2VP5A 4HAOA 2GNPA 4BWYA 2J6CA 4M0LA 2FQYA 2RCYA 4RK6A 1GLGA 2AN5A 1W4AA 3ANLA 2H2GA 1KBZA 4JGIA 4XJSA 5AHKA 4ZEOA 3RIGA 1MV8A 1O5IA 2IGTA 3LQQA 4FYMA 2WOOA 3LE8A 5KBYA 5DNCA 3FGNA 3LBAA 4YJ3B 1XDSA 4Q0MA 2DY1A 3G79A 4K9NA 1R37A 1L2TA 4C4OA 4YDQA 2XUPA 3FLEA 3MOGA 1KR5A 4JN6B 1AQ6A 2Q5QA 1GR0A 3PXCX 2EOAA 1N5OX 2A7QA 1GZ4A 1VI2A 5IJWA 4KLCA 4JXZA 2YCBA 3N0VA 3DGEC 4DRZA 2QVGA 3NPAA 3P9XA 1RYEA 2QN1A 1EAMA 1XG5A 1L7PA 4UTOA 2W48A 5JBIA 3UW3A 1EBBA 1Q15A 5C7OO 3MWDA 3QKRB 2HJVA 3LH5A 3P2OA 5FUQA 5MN4A 2H1LA 5CDGA 5ALPA 2QLLA 5AVOA 1CUXA 1X94A 4K05A 4KO1S 2F3PA 1X1EA 4DLTA 1P5JA 1TTPB 4AJHA 5ESXA 3AI3A 3G5LA 1BJRE 3PPXA 3R3UA 4IHJF 5EKDA 4AMBA 5CB4F 5ED0A 5TJHA 5KEIA 1E1YA 5G3YA 5AVSA 2PUWA 5LDDC 1K63A 2WNHA 1KSGA 1Z5WA 3W05A 5MGBA 5KOYA 1GNQA 5AJYA 1L4MA 2Q0QA 5HQ3B 1CY7A 2CDCA 3BSYA 1Y3CE 4YAUA 5AVZA 2ZBUA 1TZ2A 1MC5A 1YS7A 2GEKA 2QS9A 2Z95A 4C1BA 4G89A 2E21A 3V6MA 1NIJA 1KMIY 1A8IA 1H3EA 1UAAA 3RAFC 4C87A 4H77A 1D2EA 1X80B 3WL6A 5LXTA 3QX3A 2TMYA 3NDRA 2PJDA 3EGVA 3O4RA 3ULKA 4XWGA 5AJUA 2ZR8A 1FS6A 4FMDF 1DB3A 5JFTA 4HWGA 2X4DA 1P6XA 3KYDB 4D74A 3KKKA 2H5IA 5JZBA 3CZRA 3UKDA 4BEWA 1GPDG 3AM4A 3WNDA 1FC0A 3PHGA 1YVPA 4QWWA 1BEZA 5KQLA 4MPTA 2H0RA 3DMFA 3LTEA 16PKA 4AQYB 1AA9A 2N9UA 2VT2A 4MLPA 1RXIA 2IYNA 2XA2A 1N6KA 2HMYB 1O9BA 1MB2A 3PC2A 2AC7A 2PSHA 2GPBA 3BTUA 1QLWA 4JYAB 6AT1A 4AZSA 1T36A 2QPLA 2R62A 4BE7B 1TRKA 1CFZA 5BT9A 4IRUB 5F2NA 1XEAA 3CSDA 4QICA 2X22A 4JR2A 2V7GA 5CNMA 1B7GO 1LSJA 3CRZA 4ZKEA 1AKWA 4WASA 1W49A 3G0HA 3EY4A 3KQHA 1NQOA 3CR3C 2XMBA 3C5EA 4OGFA 2GHRA 1WY7A 4NMXB 5ICSA 1Q1GA 1ZOIA 5BW8A 1E18A 1HOTA 1WUJS 3P0JA 1PJTA 3IP3A 4PC6A 3VPBA 3K31A 1W34A 2ZI4A 1EGAA 1PDOA 1X38A 2B8EA 2JAQA 3Q3CA 1WSWA 3SQOA 4OQQA 2PSFA 4BZZA 4DSAA 2XZLA 4BQOA 2GO1A 4BCDA 3B3GA 4ER0A 3H5RA 4O4JB 2IRWA 5FCDA 4UD6A 2Q41A 1GPBA 3QZUA 3T0FA 1XEXB 4QQKA 1MRNA 3U3ZA 4QG3A 2AEFA 1S7GA 3ABSB 4RIEA 3W0LB 1OB2A 3PGXA 3P2JA 2W4MA 1N92A 3OJXA 4BDTA 4CVNA 4LXYA 5KOJA 2FW1A 3ZDFA 1G8YA 3B2QA 1XD2A 4J3JA 4FYIA 4D82A 3DXYA 3L4EA 4EGSA 5JVDA 5KNDD 3N07A 1VTKA 4Q1FA 1DDOA 4FE4A 1XP8A 1W52X 2IF2A 1XFDA 4ZD6A 3HKDB 1E3WB 3W3AA 2QLTA 3KVVA 2HY7A 2R86A 4IKEA 3LGAA 4LZOA 2VQEB 1ORRA 2PKRA 4CMBA 3F67A 1EAYA 2RHRA 3CONA 4HLNA 4D02A 5C5EA 3MGKA 1CY4A 421PA 3EEIA 4X20B 3MNFA 3LVQE 4M9UA 1W46A 1AZTA 1F51E 1P0FA 2J1LA 1TJYA 1Z4LA 1Z83A 2O54A 1K9SA 3A3NA 1GRNA 3D7LA 3MVEA 3CGWA 4GT1A 1GKIA 4F6LA 4HMOA 1U98A 1H2EA 2MHCA 3BE6A 3JYLA 3K94A 2O2HA 1J33A 1I10A 4KKVA 2WSSD 4BCCA 3L4BA 3I4LA 1XZAA 4IO0A 4OHKA 2QGNA 5DHFA 5F76A 2G04A 2HMVA 3S81A 3CH5A 2YKGA 1VPLA 2PGAA 4E7PA 3RC8A 3KTOA 1EHCA 1FDUA 3CR7A 5FI3A 5KQMA 1MB9A 2O8CB 3O75A 1ZR2A 5BOVA 4AJKA 4TLCA 3PJFA 3UYKA 3EAGA 3PICA 3RIMA 4GS5A 4QBFA 2UYHA 4GOXA 1TQ4A 2OM6A 2ZRDA 5J5CA 3LW7A 3UWSA 4ZMSA 3GJYA 1AQJA 3TN7A 4BVBA 1KPHA 4NEQA 2COKA 2QTLA 1V5GA 4KBYA 4R1UA 1T4BA 2AZTA 5JDIC 3DEYX 5DBOA 4E22A 5AUPB 5CVTA 2HA2A 3X2EA 4TV8F 5M5BA 3RUEA 5EKSA 4B85A 1P2FA 3BJRA 4HGOA 4C4TA 5JSZA 2GBIA 3G9ZA 5IDYA 3U9LA 3W2EA 3PNOA 2QMZA 1XZPA 2UZAA 5F33A 4ALKA 1ZK3A 2VHQA 1GQYA 5GWXA 3RASA 4C9BA 5HRUA 3SQXA 1P7WA 1W5FA 1GNLA 2WWTA 3K0BA 1J7JA 1A9ZA 1P91A 3QJYA 4MA5A 3KKPA 1I3CA 1GZHB 1L7RA 4E1BA 3FCOA 4YVFA 3PWZA 2OHXA 3S7ZA 2WA2A 2TS1A 3CVOA 1Q83A 1JH8A 4YN3A 4YT4A 2RFLA 3RUFA 3U9SA 3E1GA 5LVAA 1A2OA 3UK7A 1G7CA 2OVBA 3IYLW 3OTHA 4WBNA 1W2WB 3I3SR 2GUWA 3U3JA 3HRKA 2VF8A 3LUJA 1PL6A 1E8DA 2GAFA 4A1OA 4EJFA 3MW8A 4ZHQB 5J3JA 5IWAB 4FJ2A 2VNAA 4NXMB 2IS2A 3IR6A 4WRRA 4U4AA 1JMYA 1QGUB 4YUYA 3LM8A 1P4HA 4JSYA 1CUZA 2I4MA 4KR0A 1M33A 1ULZA 5J63A 2BKLA 2B25A 4X97A 1YRAA 2GASA 1LS6A 1N2OA 2PVPA 3PDHA 2Z9CA 1R5JA 1PFGA 2H54A 3WJAA 3NJ8A 3NAMA 3UQZA 5B55A 3OOYA 5U9CA 1H2BA 3SYLA 4Z49A 2WHPA 4P0QB 2NU8A 4X1IB 2YY5A 1FX1A 5BW5A 1CS0A 1R0ZA 4TL9A 1YJAA 2CNDA 4EG1A 5DRTA 4UUPA 1JDNA 4FWIB 1OH6A 2XMZA 1NW4A 4LCJA 4D9NA 4X63A 1XR3A 3I73A 2ZSUA 2C4KA 4FYVA 4OQPA 4W8GA 5CVCA 3V00A 2CDRA 4REQB 3KETA 2W8ZA 1U90A 4WKBA 2QN7A 2B1QA 2CK3A 1OZAA 2ILVA 3MERA 4YJKA 1D6JA 2PQ2A 2CVQA 1H8ED 4XTRA 4G3XA 3AVPA 1JX6A 2GZDA 1F3LA 3M3PA 4HVAA 3QMWA 2E1RA 1TQ2A 3ZHOA 2GJSA 5CGZA 1HI9A 3ZNOA 4E5DA 5HW0A 2OOSA 3FPLA 2F43B 2HJ9A 1Y3BE 4CIXA 1MXHA 2ADFA 1W581 4PRYA 3WYEA 4DMCA 4KIWA 2P62A 4OKSA 2XX3A 4PR0A 1U99A 4GUDA 1HEYA 4BEBA 2NV2B 5HUQA 3QPWA 4HZUB 4XWTA 1WXHA 3ZI7A 3WNZA 5JAIA 2E4XA 3E3MA 4BQQA 5JQGF 1GILA 1TYEB 1UKYA 4TTJA 1QVWA 3BCRA 4NPHA 4ZGWA 1J1UA 3PWTA 4TS3A 3SM9A 2X13A 4JODA 3UV7A 1C3EA 3LXMA 2J9RA 4KLZA 2WVJA 2HC9A 2RGCA 4FCVA 1IN6A 3GBVA 4FFWA 3J7AC 1O4VA 3LC7O 4Q1AA 4Z51A 5BO5A 4DBLC 5C3MA 5HZMA 4DJ5X 4QHSA 3Q3JB 4BXOB 1BE8A 1J49A 4CV2A 2UKDA 1ONSA 3D7NA 1SQ0A 2CLHB 2Q0HA 4KITB 3DLAA 5CXSA 1AA6A 2XYQA 5LQNA 3BMNA 3LAWA 3L2OB 1T5HX 1QQ7A 2DG2A 1ZGZA 4HTAA 4XR9A 2YUIA 2FLVA 3USCS 4R5HA 4TWZA 1L8OA 3KVRA 3PQ7A 4TN5A 1DP4A 1ODJA 2FWAA 4LNUA 5LBIA 3VOTA 3UBMA 3C3DA 5KTOA 2WFZA 4KMSA 1VPTA 4E3ZA 1U7WA 4JYCA 1UC9A 5BNIA 1B41A 4OBBA 4N65A 4D9BA 4TV9B 2OB2A 2TSYB 4DOMA 1NVKA 2V1XA 1GQOA 3Q15C 4JXKA 4B1FA 1YFLA 3DE7X 3U13A 4V0LA 1I7QB 2FW8A 2ZIGA 3EDRA 2GZMA 1NTRA 1C4WA 2R79A 1EM8B 4NH0A 3U48A 3WLOA 2CEKA 4HAYA 3V9PA 1OD6A 1SRQA 2B99A 3U7IA 1SCUB 4G1UC 4IIEA 3RBZA 1GTVA 2OY0A 4A26A 2D2IA 3IUBA 5C35A 3BORA 1RAEA 2ZE5A 4NQRA 4OHXA 4ZVVA 2C5LA 2EYQA 3HABA 4DM7A 1I2CA 1CEXA 2BM8A 4HUTA 4RZUA 4LYJA 2J3MA 5G0VA 4GQAA 5DM4A 3OP1A 4CEHA 2DBYA 3IBTA 3ZDDA 4J0QA 5IAEA 4B75A 2ZYHA 1BGXT 5KKNB 2YVAA 3B7PA 5FA8A 1T1JA 1I3NA 2DQSA 4U9HS 3QE4A 3WIDA 4CKCA 2JGNA 2ZRCA 3OLCX 3QVSA 2FP3A 4CIBA 3RT7A 1KZGB 4AKGA 4MUMA 4IDDA 1CZRA 2A9PA 2R44A 3ELDA 4XVQA 1RR6A 3AONB 1XU4A 2YJ4A 3OU2A 3LQKA 5IT9A 2GCGA 5EIXA 1QIMA 1CF4A 4DZTA 1EVZA 3C3YA 2NVBA 4D3FA 3DZKA 1C7RA 3BXPA 1POXA 3C3EA 3UWKA 3KZCA 5DN6A 5JZVA 2PVCA 1IOLA 2HRZA 3L7OA 4RLQA 5EPOA 4RETA 3SZMA 1A2BA 1MORA 4BNIA 3DAPA 3NORA 2VSNA 1VSTA 3K0EA 3NKLA 3PXAA 2O5CA 1AS0A 2GKOA 1JR2A 1ZX1A 5JY1A 4DLZA 1NFFA 3PQ3A 3DLIA 4GOLD 1DWOA 1KZ4A 5AI6A 1TF2A 4N41A 2FXVA 2AV6A 4KAJA 1XVIA 3E4CA 4RK0A 4XM0A 3CNBA 4DSOA 4BTEA 5A4KA 3JWJA 2ZIWB 2IYEA 1G98A 2LKDA 4D0RA 3PT5A 2LDBA 3EC7A 3NDIA 3RTBA 5B1SA 5LQJA 4AURA 4P31A 1AKTA 3LBFA 3AF6A 4L4ZA 4X00A 5BSKA 2O8FA 3AETB 1Z62A 3PFIA 2QMYA 3LKBA 3HHPA 3WRXA 4AMUA 2PGOA 3WQQA 4JT4A 3U5TA 3K0FA 4R2HA 3AP1A 1CPYA 3ZGZA 4DMFA 5A9TA 2JIZA 4L95C 1TKAA 2P3LA 4JJ8A 1AHNA 4UEOA 3OLQA 4J9VA 3N58A 4W1PA 5E1MA 4XIGS 3UOGA 1DKQA 3CA8A 4HLUA 4F9FA 1VCHA 3AI2A 2JAOA 1GA1A 2HA5A 2CHEA 1DJOA 4ITUA 2ZAIA 3FWKA 4PCUA 4YPFA 5F21A 5H5JA 3IO5A 4WGGA 5B57C 1A9XB 1TA9A 1DUIA 1CLUA 1E1QA 1FQJA 1DFIA 2Q6TA 2QUAA 2AN4A 3KQWA 2R7AA 2GJKA 3NT4A 5DCWA 3STWA 2P6RA 2WD9A 2J6BA 3JWEA 3KQLA 3E9NA 4GXQA 4B9AA 3WB2A 2ABWA 1XELA 2D8MA 1A5AB 3VZPA 4X6XA 4DWOA 2NOAA 1I9CA 1R2QA 2RHJA 3PTAA 2WHQA 3KZ1E 4FEEA 4QKQA 4R41A 1J8MF 5DLYA 1N5IA 2M98A 2IT1A 3P1JA 1A72A 1VLHA 2DLDA 2ZKIA 2CBGA 1CUDA 1ESNA 3QXHA 1KK2A 4XA8A 3TR0A 3UWOA 3ZHBA 5IEJA 2QVBA 2VHVA 1Z7BA 4B48A 4MS4B 3ELUA 2QUBA 3NB0A 3QHQA 5J2UB 4FJ1A 2ZRBA 4X62B 1Z6YA 2FMHA 1BEEA 2HIAA 1SCQA 4JYZA 5ALXA 1ZJJA 2JASA 1OWOA 2R2GA 2TECE 2YFHA 2YWRA 2CB0A 3KWJA 4OQXA 4KRFA 4L5JA 4HYEA 4X64B 5AWFC 1JXMA 2NXJA 5AXCA 1UJNA 1PGJA 3VZRA 4X65B 3W5SA 1A7KA 4HI0E 5GJCA 4YYZA 2C1ZA 1QCCA 3O38A 2BKUA 1GPLA 1Q7RA 2O23A 2Z5LA 3PYMA 1RWWA 4RELA 3REOA 1W75A 2PX2A 3CCBA 4NH4A 4NCNA 1ZD9A 4UU1A 4DILA 4R0NA 1S2DA 4RK7A 4MR8A 4C20A 1P3JA 1P75A 1VDMA 1ML3A 1XOIA 4J0FA 5GOZA 3NX4A 4IR7A 5JSQA 3H3XA 2JKYA 3I4FA 1M34A 1YC2A 3MB8A 4KL8S 4L9WA 4J0KA 4X45A 5EIBD 4DA6A 3T5AA 1HR0B 1A8SA 5J4YA 1K98A 4H35A 1O97D 2G28A 4HPXB 2G5CA 2ID7A 3UK0A 4EFNA 4AKIA 3DZJA 5DSZA 1GRVA 2K5UA 5BSEA 1IQ0A 4ZAXA 1UC8A 4RKEA 4RF4A 3NKVA 3WLSA 4M9XA 3RROA 4B33A 1KQ3A 1YHYA 3G2MA 3GCGA 4XQCA 1YJXA 5HCUA 4CT0A 4FMBB 3PPWA 3K8QA 1RPNA 4FOPA 2W43A 1WTCA 3FYSA 4QFMA 2WABA 5IJZA 3RS2A 1H1DA 2JL1A 4YPVA 3COPA 1Y7IA 2ZTSA 3EQ7A 1NGSA 2BD0A 2ODPA 4TMTA 1XLTA 3EEOA 1C8KA 1J07A 4PC1A 3JYPA 3P2MA 4I1VA 1JHYA 4AWAA 3PXBA 3LUHA 4PXSA 2P6UA 2SBTA 2CXNA 3CWCA 5JATA 4AP5A 1PW7A 5HJ2A 1EFTA 2QVYX 1QUEA 3U1BA 3B70A 1GSAA 4R83A 3OOEA 4OUKX 1XCJA 2DUMA 2BEUB 1LLDA 4DCPA 1RWKA 2QX7A 2ENWA 2XA9A 1UMKA 5IK2A 3PZBA 4HNQA 4X1YA 1JFRA 3HNPA 4EPVA 4Y67A 1XL0A 5B37A 1BKYA 4B47A 4BJ6A 3Q8XB 5EEHA 3KFVA 4PO9A 1YI0A 3FYHA 4C2BA 3FPSA 4HN4B 3BSFA 3PU6A 1FMCA 2QE7A 3G0BA 3HMKA 3IILA 4OYRA 5HTKA 4YUWA 4JP5A 4YCLA 1JFFA 1ZN9A 3DVQX 3GA0A 5P21A 3H8JA 1EBFA 4HLDA 3FFWA 3Q7IA 1WKBA 1WVIA 2ZS9A 4UD2A 4X5OA 1EG2A 4BNHA 1WCIA 5CA1F 3AI1A 4OLJA 4JWTA 3NYWA 4ZCQA 4DR6B 5IFLA 2PFSA 3H2JA 4D44A 1WL8A 2A5FA 3AJ8A 2JH9A 2E0IA 5K99A 2C5HA 1N3LA 4U0JA 1CG6A 3KBBA 3HC7A 1M34E 3BA1A 4KAXA 5LIRA 3ID6C 1JDZA 2XEXA 1OI4A 3ILXA 3OTWA 1V35A 1YB5A 4MNTA 4RULA 4IDQA 4JLDA 4EJ2A 5I7FA 3ZE7A 4IMIB 2ZJZA 2ZIZA 4U6NA 1Z45A 2ECFA 4C5AA 4JITA 1BDJA 4H7JA 3WNVA 1IAQA 4GBMA 1QQTA 2ZQYA 1U8YA 2HTFA 1KDRA 3FD8A 2GEJA 3G7UA 2R87A 4MVJM 5DXJA 1F1BA 2QDKA 1QC5A 3NWJA 4J0DA 5LOVB 2JFGA 5FBVB 1JA1A 4W5QA 3JYNA 4PICA 4MVWA 4ZIRB 1W25A 1U1IA 3WO0A 3QGMA 1WABA 3V7FA 5G02A 3TW8A 4R8LA 5EHZA 1EE9A 2RHWA 4EY5A 2VLIA 5F1OA 5ITVA 2BMWA 2Q46A 3K30A 4KPFC 1YULA 2AFHB 2K6GA 4W4TA 4TSFA 3IPXA 3JQQA 4M1TA 2HCJB 4DDTA 5JV5A 3SN6A 2F1JA 3MUNA 4NY1A 1LTKA 4F4CA 3EXHB 1MF7A 4Z9YA 3G82C 1JZQA 2VP0A 1J20A 2HMSA 3A6KA 3DKPA 3RVOA 2FR8A 4FOTA 5KAMA 5C7LO 1RYHA 1T24A 3BRCA 5AKYA 5L4NA 3AU8A 3ABIA 4G65A 1O96A 3M9LA 3RU3A 4AQDA 1L1QA 4CUJA 3U6BA 3BE4A 4QUBA 2GPAA 1T9HA 1LWOA 2GAJA 3C3BA 3DHNA 3AUKA 3QKIA 2OPHA 5CEEA 1JSRA 3A6HA 4LHXA 3VTZA 4DV0B 1JHMA 1Z63A 1S3SA 1G6OA 3HUTA 5A6SB 2BTEA 3AP3A 3PQFA 2BY4A 5DT9A 2QBYB 3IIMA 4OQEA 4EYGA 5FPPA 2E37A 4Q4AA 1O8BA 4MAMA 4D8VA 3I9V6 2CB9A 2CLOB 2ZZKA 3PNLA 3DFIA 4NDNE 2PCLA 1ES9A 4YXFA 3A6DA 2QP9X 3QIAA 4XLTA 5EZ6B 1SURA 5IN4A 4YJ2F 3EG9B 3CLKA 4QPZA 2A6PA 2QLBA 4NJMB 5DHQA 3AERA 4D2IA 4PLVA 4FT4A 1NLUA 1OH7A 4NYMR 4KPUA 2B9VA 1TZJA 2X14A 5J23A 2Y1EA 1FFYA 3LDGA 2XNKA 4OHVA 4MGEA 1P72A 4N0DA 3I1YA 4PZUA 4UKDA 3K1JA 1FOEB 4S04A 4EHFA 5HGXA 3HKEB 3RHSA 3UATA 3VKFA 4DARA 3FNIA 4OB6A 1L5NA 1EUCB 1NW9B 5SY9A 2D7CA 1KJNA 4BPRA 4HXYA 3CSSA 4RVUA 2AOTB 2FFAA 3CZ5A 3Q7PA 1RLIA 5L45A 2DCUA 2WUGA 3GI1A 2HEGA 1VG9B 3MMNA 2D62A 2W8BB 3DAHA 4B3TB 2J07A 1ZGGA 3TCXB 4JI6B 2CHQA 2YJTD 3LSTA 4NECA 4C0KA 3U81A 2HN9A 1QS0A 1P1IA 2QG6A 1G6Q1 2VK1A 5H3HA 4IW3B 3QV2A 3N74A 1LC0A 1AGXA 3KJHA 1JSXA 3P9ZA 3MUFA 4G5HA 5CBPA 1KEKA 5DEIA 4B46A 1ZVMA 3K6RA 3FNRA 1CQZA 2YOHA 3QWAA 4JQYA 4YCNA 1SVLA 4G24A 3DLBA 1X2EA 3IQIX 1FBTA 2Y0BA 4WBNB 1X42A 2XT6A 4L0CA 1M72A 1Y5RA 4DNPA 1T25A 4R1NA 2NO9A 4XPZA 1UFRA 4KK3A 4KZPA 3DDCA 1VPVA 2PWZA 4TLMB 4XR4A 2AMYA 4JYMA 1XMVA 3SC2A 4Q9DA 3NUQA 1K6XA 4UCFA 4Y1GA 5E4TA 5C80A 3OWXA 3QEBZ 5BVGB 3M3HA 3E1SA 1GIAA 4UM7A 2XWPA 1R6BX 3TDNA 3MPUA 5AIBA 4Y6PA 3MCAA 4Q48A 3ROQA 3LK7A 3IEXA 2PH3A 2W6MA 4OCZA 5AI9A 2ZTUA 1Z9BA 4M3NA 4LA4A 3ON5A 4IVRA 1KJJA 1JQEA 1A4UA 3HUEA 3M0EA 3P2EA 4FSDA 4U9UA 1XGKA 5DN9A 4D7AA 1ISRA 5F3RA 4PONA 1KQFA 1GNTA 1L3BA 1AT1A 3EHEA 4IEFB 2VJMB 2PT6A 4AUNA 3I8XA 4W5WA 1O77A 4JNCA 2CCGA 1Z3IX 3NAGA 2O50A 4R9UC 3FDIA 1KR2A 4XX1A 1CT9A 1JBKA 2QSUA 1KO7A 3BWVA 1XHFA 4A6EA 3S99A 1USIA 3K35A 4NATA 4M21A 3SDSA 3AILA 1F48A 1L9KA 3KE8A 3N86A 3AF1A 4DDMA 3HTXA 4F1JA 3F0TA 1M76A 1TZMA 3K4PA 1YC5A 2HK8A 2RHLA 5C1OA 4P38A 2IYOA 5IH7A 2ZYUX 2AIRA 5EQTA 4ZVRA 3VOBA 2EXXA 3DMTA 1JEQB 2BFBA 3V48A 1N5MA 2I33A 3ETGA 5SICE 5AVYA 1ST2A 3AJEA 4E51A 1Z06A 1G8AA 2H9AA 4WOKA 1YBAA 1YZTA 5LMUB 1RQGA 3DBLA 1V11A 4ITRC 5JARA 5JC8A 4XUDA 1MJGM 1YWGO 3TPZA 2OXTA 1DNPA 2A5YB 3L84A 3MCWA 1HGXA 2PEZA 4FDMA 1YQTA 3ROTA 3BN3A 4DMRA 5CA1B 1BN6A 2X8AA 3EMVA 4S1TA 5DDIP 4HNAA 2YHIA 4MUGA 3AFGA 3A1UA 3RSLA 3FF4A 5FP0A 3G9QA 2JPDA 3OCXA 3QEJA 1RHQA 4MQMA 4F38A 2ANBA 1IK6A 2VUTA 2B4TO 3ZDBA 3IERA 3IAS6 5DSTA 4CIDA 5JHHB 5I7UA 2D13A 2J5KA 1RXCA 3FUUA 3GJRA 1AMOA 1C8VB 3LX6A 2OO5C 4U3JA 3U3KA 1WEKA 2O2EA 4US1R 5F9HA 1W1IA 2F9LA 1FRVA 1SKBA 3BIWA 5GQSA 1QX4A 1B26A 1D6SA 4O4HB 1QRUA 3O93A 2LIVA 4KQEA 1T5TA 3WY9A 3CVWA 1EFLA 4L02A 5KDLA 2FRDA 2HA7A 1VZ3A 2REBA 5JCJD 1Q1AA 4QXQA 4ZYVA 4ZOEA 1M2HA 2FPMA 2VWPA 4LRTB 1U7UA 3E9CA 4N40A 2B92A 2CDBA 1ZHHA 3ZJYA 5I9LA 3IV7A 1VRCA 3EDQA 3NGXA 3RVPA 4F2PA 4JV5B 5L95A 1JFVA 2B5VA 2XQGA 4PLGA 4R4JA 1UJ6A 4MW0A 3PUIA 4OAPA 4ZAFA 4YRKA 1PAUA 4W5HA 5C8DA 3RC7A 1P1HA 4N7MA 3PJEA 2C8KA 1NY6A 2A9VA 4GNRA 2JI7A 4I50B 2V8OA 5KOIA 2G83A 1ICIA 1NRIA 4TTIA 2DJIA 2OBFA 3WNQA 2WAMA 2I91A 4JENA 4KQXA 3L9XA 1CEQA 1PWHA 4FW8A 4OO3A 3U56A 3ZC3A 2IYPA 4BNTA 1OT5A 1WUYA 1N2XA 1Z4MA 4WBXC 4LHVA 5KQRA 3RAGA 4EATA 4FSXA 4RA6A 3WK8A 5AK5A 5DYNA 4OXIA 4KAFA 2AD5A 3F8SA 2R5WA 4RVFA 4RSHA 3V8MA 3O8LA 4FFVA 1WSBA 2GK4A 4ZZ2A 2P8JA 2Z1DA 3L1KA 3HB0A 5MN5A 3ITDA 1AKRA 3D43A 5IJ9B 3FFTA 3WQRA 4J94A 1JR3A 1O95D 3A11A 4HQKA 1C50A 2XWQA 3P0EA 1X70A 3OH8A 4O0LA 1SQSA 4YXWA 3RFCA 2E4UA 4P98A 5DI3A 1O3YA 1WHSB 3AT1A 4HFMA 4XWKA 3TZHA 4LECA 2VPQA 4ID9A 1OH8A 4FYXA 5IP5A 1GU0A 1W0JA 5F4BA 4EVIA 2W2VA 3WTCA 3EXIA 1P0QA 2HF7A 3Q7EA 4EUFA 1ENZA 4K9QA 4B7XA 1LRLA 3JXEA 4Z1MA 4B2IA 3EISA 3N7UA 3E27A 2XZDA 2ON6A 2JANA 2DBZA 3HPRA 3TECE 5GONB 4IZIA 3ZE8A 2FPPB 2WNIA 2VJYA 3I01M 4M8KA 1U4OA 1SU8A 1Y8QB 3GPCA 1IIBA 4H15A 4QTZA 4XLLA 2WAOA 5EHQA 4L73A 1HORA 3ICEA 3T5MA 4WX2B 4TWRA 2PUAA 2IUSA 4QWMA 4V0RA 5AVQA 1U65A 3HG7A 1ZJ4A 3QX9A 1NASA 1TM2A 5EE0A 3GAFA 4TXJA 3QY9A 3E22A 3N2KA 2PR7A 1D1SA 2Q45A 4YJGB 3DE3X 2Q9UA 2OM2A 4TRNA 2CZQA 1QKKA 1TCCA 2Q4OA 1EFKA 3DMRA 4MRPA 4W1QA 2XVMA 3SX2A 2I4TA 1FNCA 5LBUA 4B7CA 5ADUS 4LF8B 4IO1A 2CFOA 3N3AC 4ZGBA 5CITA 1JHOA 1Z0AA 2AN9A 5DYTA 3N0RA 4A36A 5H02A 1TZKA 3HSSA 4UFOA 2OBLA 4WW0A 5IKXA 4GH5A 3IL2A 2I3BA 1NSYA 2P1RA 2A86A 4EY3A 4M22A 4EHHA 4ZJPA 4K9LA 1DT3A 5ULLA 2YHSA 4RL6A 2BDTA 1JR3E 2QU7A 2OMEA 4GMXA 3R7WA 2ZBEA 4L6CA 2JFHA 2RAPA 2PO7A 3TQFA 1VLJA 4DJJA 1QVZA 2GLTA 1MNQA 5SYAA 1G55A 2GBLC 1U11A 1VGQA 4NVRA 5FTMA 4PYLA 5FJIA 5IVPA 5J47A 1KKLA 1ZGBA 1ZM2A 5JLAA 4HUQB 2VP6A 2D0IA 3B6JA 4P4TA 1NG1A 1OFUX 1G1MA 1M7BA 1IM5A 2XLCA 3QKUA 4EZIA 2ZRGA 1Z13A 1P62B 2WJPA 3O8BA 4PZCA 1OR8A 3I83A 5IC6A 1FCJA 1QX3A 1AZWA 3OZVA 1YACA 5BSGA 4ND1A 3SQDA 3GCXA 3DLHA 3FGPA 2RBKA 3H13A 3EK2A 2IPMA 4KG7A 1M6YA 1FP1D 2FSGA 2VK8A 1BDHA 3RK0A 1MMFB 3D6VA 1P4AA 3QVTA 2DSTA 3DOFA 3VNAA 3ZHQA 3WK7A 2KYRA 4IH4A 3VGJA 2IV2X 4IQ4A 2NUPB 2G17A 3KFXA 3CRVA 3OO0A 2JDID 5D5PA 3RAPR 1Z4JA 3WSTA 2HRRA 4ZI7B 4R6XA 2UZIR 1NDQA 3IFSA 4U2BA 1E79D 3E7PA 1LSUA 1ZK2A 2E4ZA 2GOYA 4KYTA 2V9ZA 4NHOA 2YIVX 1G9TA 3RB8A 3F71A 3CJTA 4IXWA 4E03A 2Q4TA 3ANTA 3V32A 3NNSA 4BGVA 4OU5A 3DVAB 4Z0PA 3VPSA 2JFOA 2P6PA 2P9QA 1PUJA 1XD9A 3IAM6 2XCIA 4AJIA 4S1WA 4QGHA 2IITA 1FFEA 1JLSA 1RWOA 3D4BA 2Q3FA 3DNFA 4I4IA 4JBWA 1YXMA 2J3EA 4MP6A 3LQ2A 5B36A 4L76A 1MABB 1V9LA 1WY5A 4UBNA 3TIVA 3BMOB 1QCZA 2C4TA 3O8CA 4U7DA 3DVRX 2QJOA 3UN1A 4F60A 1IXYA 1QQBA 1MO2A 3R1IA 3QOWA 2QB5A 4UUMA 2V6JA 3F6SA 1U2EA 2R6GA 1AUPA 3FOFC 4ZZ0A 4KE7A 4JC5A 2X6TA 4Z0TA 2GWRA 3AR6A 3EZ2A 4GMHA 3RKRA 2GAIA 2FTKE 1R64A 2NVUA 1SCNE 4CEJB 2JHCA 3CLRD 3OTOB 2WDZA 3EC1A 4L51A 4OHBA 5A7GA 7MDHA 2C61A 4AU1A 4TL6A 1EJBA 4GLLA 1DJQA 3L8MA 4N8EA 1BYUA 3ZY2A 3EXEA 4YALA 2AMLA 1FFXB 2FPOA 1AKYA 2GTIA 5DRYA 3UAYA 3UWPA 1DL5A 1B8OA 3N8KA 4QDUA 4Y2UA 4Z4GA 5DXFA 3SJCA 1XNQB 3OPXA 3KKMA 3PD7A 3TQTA 2P75A 5C34B 4D0LB 3ZXSA 1JS1X 4Y2VA 3PDIA 3IJ5A 1TDJA 3K1YA 3L4SO 3QU4A 1TUBB 2OTCA 4FQ7A 2X3YA 3VPAA 4M6WB 4UNPA 3OIFA 2PWBA 3I04M 4IIJB 2AE2A 4PYOA 4D46A 1JDJA 2D2FA 4QJBA 2FZ5A 3QOFA 3RYHA 1F5NA 3QMPA 4EF5A 1F8GA 1KRWA 1WU7A 1JG6A 3COVA 1KFJB 4H6PA 4CHGA 5CURA 4FW9A 3MM4A 3JAKB 3QENA 1D2HA 1SIOA 2WVHA 5TMEA 3SEQA 1EUDA 4AFNA 3ZLUA 1AU9A 1CF2O 1RIFA 3MJSA 1N2SA 2E18A 4AMGA 4E88A 4DJDC 3A9UA 3SIPA 3ZDAA 3ZWCA 2MYUA 4G6ZA 5EJIA 2ES4A 2KHZA 2FP4B 3KNZA 4ARSA 1Z2AA 1KPIA 5A7HA 4ZAGA 6YASA 3ODPA 3IOEA 5HFNA 5F5NA 4M89A 1Y37A 5AR1A 1VLMA 3OT1A 1UPFA 2CCJA 4BX3A 3A9CA 3FOZA 4R9RA 2JG3A 3GMTA 4P2BA 3ZTYA 3NZEA 4JGBA 2YJNA 3EH1A 1DFGA 1P0CA 1T3SA 1LBQA 1V3VA 3NBZC 4QFCA 1N4AA 3VR5A 2XF2A 5A1TA 1ONNA 1SQFA 1YKSA 2ZWIA 3JPWA 3NRCA 4G86A 1YZFA 4ISCA 1FPQA 3K0CA 1Y4AE 2O2IA 1LQTA 4B5LA 1RHKA 1HUQA 3AVVA 4ER3A 4GL2A 1UPBA 1YQGA 2ZTMA 1BIFA 1CV2A 3LUPA 4ZYWA 5B30A 4RY2A 1HT1E 2EZTA 2PKCA 1DUVG 2ZTVA 4RNCA 4LDAA 4URZR 3A4IA 2BP7B 4IHAA 5KTPA 1KAGA 2O19A 4OFBA 3MJVA 3ONWA 2OFOA 2HSGA 3G2KA 3IQHX 3PHBE 3DV0B 1U2PA 1QNLA 4M60A 2NO6A 5EN4A 1WB4A 3HBNA 1KKMA 4QTTB 2HW8A 5ECYA 4EM6A 1ECLA 1PEAA 2PKQP 3KL4A 3CWZA 3KSBC 1D8TA 2A7XA 1A97A 1BD3A 3RJMA 4OB8A 1PJQA 4J0EA 1RRVA 3AF4A 3GJXC 2CWDA 3K9NA 1IZ9A 3C1TA 1N7JA 3VH3A 4BJ1A 5A3JA 2XRMA 1GWNA 2BGIA 2P9ZA 3DBVO 3K1AB 3PYXA 4XQGA 3S8YA 2WM2A 4YQFA 3FPCA 3AKCA 4AJ9A 1SZJG 2XRYA 1LTHR 2VTBB 4G0VA 2XGJA 1MUUA 3B82A 5JNVA 4UAVA 2BEVB 2FK8A 2OD7A 1B6RA 4Y1RA 1B43A 1PT8A 4R7TA 1SD5A 2BYTA 1Z8DA 1JB9A 2PXXA 3QXXA 3FHJA 4G5QA 3TB4A 1XTJA 2YMQA 3WKBA 2OV2A 4ZJUA 1ID8A 5EUBA 1KQGA 521PA 3ZU4A 2VQFB 2IWHA 3ZKWB 3DM5A 1J06A 2BAGA 4X61A 2JK1A 4ANFA 621PA 2H2FA 2MWMA 4H7HA 1G8PA 4EB8A 4XOUA 5EVJA 2A4KA 4TLEA 1HDRA 4BRWA 3DL0A 2XTNA 2XVZA 1F6DA 2G5GX 3AEKA 3GZNA 1I0ZA 3AY0A 5ERGB 4KUGA 1TAUA 1FY2A 2KMLA 5EP1A 1DQRA 1DG9A 4FLFA 1U6KA 4KQ1A 4UNQA 1LKZA 5TQJA 1UC5B 1VDZA 4BE4A 4Q9LA 1MB4A 4DREA 5CJJA 1ZVJA 1GZ6A 1RKXA 2M6SA 2W7TA 3AM5A 4JOSA 2BPOA 3V5NA 1RYDA 3VVBA 2HR1A 1FU7A 4EJSC 1WF3A 3AR9A 1VA5A 3IALA 2FPKA 3PXXA 2VT3A 1R0XA 5EERA 4D97A 4DLBA 4EGCB 4B4UA 1N5KA 5AK6A 3TTUA 2AVDA 1RZ3A 5EXXA 3DUFA 4ZV7A 3W9SA 3BOSA 4CDMA 3BMXA 2EKQA 2AZMA 4DG5A 1EK1A 1X7XB 3HSYA 4XUEA 1UXIA 4CMIA 3II6X 3RTEA 1JAYA 4G9GA 4DJFC 7ADHA 4J91A 1R18A 2O8DB 1K8RA 1P7ZA 4B31A 2ZR0A 1YFKA 5AW6A 2EIXA 4A92A 4CMEC 4CLDA 4H0FA 3D5QA 2RGXA 2AT1A 2NXNA 2OBXA 3PNMA 1NE7A 2UVQA 3O0TA 4BQRA 4BNWA 3URMA 4IYJA 2H0QA 2ZR9A 2ZJ2A 3PC4A 4PRLA 4Q3EA 1UIRA 3H17A 2O5EA 2GETA 1L8LA 1PT5A 5K51A 4RZXA 2AKEA 2B2NA 1QSGA 2FMXA 121PA 1GAQA 1VL5A 1Y6FA 3HXPA 2ZE8A 4OQ4A 1FUIA 2PS9A 5T57A 3ENNA 1SVIA 1U7XA 4IS3A 3I8SA 4MJ7A 3OMWA 4N8SA 3D3WA 3TQHA 5EJ7A 2P2CA 3EQZA 1OC2A 2XNDD 3DMNA 3R76A 4BNYA 3H0EA 3AVXA 4MVJP 3OEED 4NNOA 2QD3A 3WBFA 4ATNA 4WL0A 2AOUA 2QRPA 2C9ZA 3BBPA 3G17A 5BP7A 2W93A 3H1EA 1FYEA 5EJ6A 3ZUGA 1AXEA 4O2BF 4MI1A 4QFDA 4ZO4A 2RARA 3FOWA 3GELA 4PV7A 3NOQA 3I2HA 5JFOA 3WL7A 4TTQA 4XCQA 4B6JA 4DN6A 1T10A 3WQSB 2O8BB 3GCDA 3LKDA 3ADKA 4H18A 1EUQA 1FYFA 1FEZA 1C9MA 2IEAA 4IX1A 5HX7A 5CM8B 3U44A 4HATA 3SHQA 2FPWA 2B94A 3C3XA 1VYTA 3UMSA 5ADHA 2BE9A 1JLLA 1OX4B 3NANA 1JIKA 3D2CA 4Q15A 3TQIA 3I2IA 4MDHA 1SXJC 4ZT2A 1CX9B 3LT2A 1HZZC 3LS2A 1R4NB 4BGDA 4BBAA 2L42A 1R0CA 1PSZA 1U3GA 2P7IA 3C3JA 3QLVA 5F73A 4BZXA 4F45A 4X8OA 1VG1A 3UOWA 3LKZA 5A0VA 3BWBA 3E0XA 2JATA 2QTFA 2HLDD 3T12A 4DIEA 1BFDA 3BB1A 1QJCA 1EGHA 2FE1A 4OI2A 1Z8NA 3LYHA 3RC1A 1JNXX 2YJGA 5FWYB 1KEEA 4OYYA 2I1QA 1POWA 3OQ6A 2HDNB 4U0KA 4G8DA 1E6LA 4R84A 4EUNA 3S6JA 3TIGA 2OFXA 1LV7A 3IR5A 2Y1CA 5EJMA 3GEHA 3B52X 2DZDA 4ESVA 1M8GA 1I5EA 1UL1X 3G1WA 1EVKA 3IQGX 2PCJA 5DE3A 1XZDA 4XSGA 2KWIA 3TR5A 5JUWA 4QTYA 2ZI9A 4D4LA 3OZ7A 1SUWA 2XQFA 2W71A 2W70A 4QDKA 2R48A 1KTIA 4QHYA 4CI0B 1U94A 3Q40A 5ALHA 3PJDA 5FT9A 4QOIA 3JQFC 2PV7A 1SU6A 4XSVA 5DX1A 1EGMB 3DDWA 4EY8A 3R75A 3DTTA 2AQ8A 4WGFA 3RHZA 2ECQA 1Z17A 3KSMA 4DE5A 5L3QA 4HDKB 5KIAA 2P7HA 4QM6A 2QUHA 1IM8A 1OVGA 2FF7A 2J45A 4HNRA 2ZT6A 3LMKA 1SBNE 1NF2A 2DPHA 3BEOA 3H3JA 3TNDA 4ARAA 1LQ2A 3DM9B 2YXLA 4Y30A 2OAP1 3OJ0A 5GOTA 1N6NA 1JP7A 4F97A 2NV6A 1MD9A 4MKGA 4C3ZA 5ECDA 3BDIA 4F5EA 1VJ0A 3HI4A 1ECJA 2IXTA 4BFLA 4JL5A 1HC7A 4TTVA 4DCUA 3VFDA 4M55A 3H2BA 3RS4A 4INAA 3IE1A 3RLIA 2EZ8A 3QPBA 5I3CA 1ZLXA 4HADA 2W6ID 1EFAA 4IL5A 2Z6QA 2QAGC 3AJ9A 2JLVA 3HB1A 3U7FB 3IR7A 9MHTA 3DDZX 2OFFA 2Y99A 3G7SA 4MKRA 1DDGA 3H2ZA 3MTAA 5H16A 1WO8A 4MKHA 1H0RA 4RMNA 1R8YA 1L8AA 1EFCA 2OORC 3T1OA 5A4JA 3BS4A 3SLGA 1UADA 2AFIA 2ZKLA 3RVJA 5LB4A 4AICA 1QYXA 3HXQA 2IHKA 5F2OA 1TIBA 5AK0A 3ZJTA 4BVAA 4YJ3F 3VR6D 3NP7A 4V2UA 3KLPX 2VDNB 3JRWA 2EAUA 3ZZUA 4TLBA 2R1ZA 2WF7A 1DI0A 1V4NA 5EZYB 4FYJA 3LCRA 2IW3A 4J76A 1F0KA 2DLNA 2YWXA 5CGQB 3REGA 1AUOA 3WMEA 3ZJ5A 1YZGA 3VUFA 2XIJA 3BXEA 2VHTA 3L7KA 3LUGA 4D4GA 1GCOA 1DGQA 3Q5GA 3F9IA 5KNCH 4C0BA 5DXAA 1N6IA 2GFQA 1Q7GA 1E5TA 3FVVA 3GQVA 4HLCA 4BKPA 1RPTA 4E11A 1CRWG 3I1IA 1XTZA 3I28A 4DZRA 3NASA 4XIYA 1N0HA 4LEIA 1XU7A 2PQ6A 1Z22A 4PEVA 4EAAA 2G67A 4FNAA 5KSWB 3P9YA 2HPVA 3B20A 1EA5A 1K1EA 1E69A 3FRJA 2X4GA 5GJWC 4ZVUA 3LHDA 1R74A 2ZRMA 1CYEA 5I9SA 2KB0A 3CLUC 3HO8A 1SR8A 4HGNA 5G1OA 4ISBA 3HHEA 1HE3A 3I34X 2FLKA 3PNPA 3HB7A 4NR0A 5F2KA 2JLXA 4LG1A 1BXGB 4LZPA 1XMXA 2OENG 1KQPA 2E87A 4P8RA 2VEOA 2FN3A 2JC3A 3KQUA 1ZM9A 2WIAA 4LMAA 5K3SA 1KI3A 2ZYVX 2ZJBA 4IHKA 3T7AA 3DXZA 1XTKA 2P9FA 2XUFA 2A94A 2Z08A 3KE9A 2G0NA 5D5HA 2YFQA 2FNAA 1ISSA 2Q5LA 1HQKA 3B3AA 2TRSB 3D5EA 2QTCA 5K3FB 2GM4A 2C78A 2Z3WA 3KJFA 3CH4B 2QDXA 2JEZA 1I5OA 1I4EB 1GPNA 3JYOA 1RYYA 1Y3AA 2F3QA 4JEMA 1ADYA 1T2VA 1BD4A 3B6MA 1ZM7A 3D2AA 3RU2A 1AKVA 1QGED 3QITA 4IKPA 5FULA 2BSQA 2ICAA 3EUEA 2AFIE 3E9MA 5H70A 2GEUA 5AUQA 1ZUNA 2EBUA 1U3DA 3EEFA 4IIYA 4DABA 2QRUA 3E3NA 3GDGA 1UJMA 3H7AA 1XJ0A 3NCHA 4HDRB 4UM9D 2ORIA 3V8QA 3TLXA 2ZYGA 2B61A 4Z4QA 1JZTA 4FHGA 5BORA 4FEAA 4BFCA 4CIWA 3DONA 4FI3C 4GI1A 2ACVA 5F23A 1M2OA 2OHJA 3DAFA 4DZZA 1B8UA 1WZNA 2BGJA 3AKZA 1ZNXA 5LYJF 2AF3C 2FW6A 1ZWLA 3HLKA 1O5OA 3P4UA 1G21B 4NOKA 3FSEA 2IC5A 2PT7A 2R7KA 4U6SA 3D7KA 2XSZD 4QQ8A 4U5QA 3H2KA 2DQKA 5IF3A 5LMNB 3IT3A 3I1JA 1A77A 1BE6A 2ID4A 4OMFG 1H0HA 4J07A 2ZBVA 3L04A 3VRHA 1YBVA 1U3CA 2QD2A 3KAQA 4HF7A 4URXR 2V3CC 1MQ9A 1Y4DE 2GK6A 3EZ7A 1C1HA 5CTJA 5FOWA 4O4JF 5FR2A 2RGUA 3W1WA 3H65A 1A1SA 4CCSA 5KSZA 3U49A 4UQOA 1U1EA 3N2EA 5FQOA 2GYWA 4LYYA 3R9IA 3UFXA 4NBRA 2EJTA 3EQ6A 5AI4A 1TI7A 2W6JD 3MJDA 4XYMA 1A95A 5L40A 5KS2A 2VJCA 4FZRA 4R9NA 2IOFK 3L7DA 3Q9LA 1EZZA 3OHMA 3C3AA 3KP1A 2CL0X 2JFQA 3HCOA 5JS8A 2Z6AA 5JDIA 3AXTA 3F96A 4ZC8A 4MRRA 4OQNA 3KPWA 3ROKA 4N03A 2D5IA 1CNMA 2E5WA 4S24A 4D5EA 4N0QA 3DZHA 5D1HA 1DAOA 2JHPA 1R3UA 2RKWA 2HF2A 2XMQA 2FZEA 1JSLA 3T4UA 1PZHA 3QJ5A 4QXAA 4EIWA 3VA7A 3C98A 1T5BA 2IZ0A 2VNJA 3LZ6A 3ASYA 2BFEA 4RYDA 4DYHA 1CDZA 2G4VA 3JQPA 2Q1TA 3FBGA 4NNPA 5TPWA 1MPXA 2WJAA 5ITSA 1C9KA 3CUUA 2HK6A 2C5BA 2NZUG 4HS9A 4XPIB 1XN4A 4TSKA 4PYKA 2H00A 4LGCA 4XCVA 3IQDB 1QXSA 3DYIA 2AJBA 1H42A 2ZT7A 3CIOA 2P1ZA 4MMZB 3G5UA 3R7SA 5HUHA 3U7HB 4GMDA 3GFFA 1FXUA 1RD4A 4RSRA 2BEWA 5LL6P 4L75A 4GRIA 2PUGA 3ZIDA 3CPJB 2OXEA 1O0CA 1JJAA 2N42A 2Y0EA 3MTEA 3MWEA 2FN9A 2VYNA 4JJ7A 4NARA 4QO7A 5ARCA 3WLJA 3EPKA 2AFVA 3ZDYB 2AHOA 3JR7A 4DADA 2A2ZA 3Q41A 3R3YA 4TYWA 1Y4UA 3AV3A 2I7DA 4OQDA 1JXQA 2B69A 2RH4A 3EXAA 1XVAA 3FKSA 3IOYA 2ZU6A 3F1LA 3DJYA 2QWXA 4FHDA 4HB3A 1DOAA 3PQ5A 2OHGA 5CNIA 2JRCA 1K3TA 1TT5A 4K6OA 4CM5A 3I76A 4WUVA 2I6XA 1BMDA 4YP6A 1XF1A 2JJ1A 5DNDA 3PFBA 4PGFA 3HY3A 5H82A 2BONA 2MYNA 3AGPA 4V0MA 1KI9A 2NZJA 1AB6A 3EAFA 3TMAA 5I7SA 4QLAA 3LWNA 4ZAWA 5LJIA 5IC4A 5DX0A 3NUZA 1IMJA 4ZOLA 1FIUA 4LXHA 4ERXA 1L0BA 1SOUA 2ETXA 3D6JA 4LCBA 4DAOA 2INGX 4CLRA 4OMDA 2G9NA 4N0EA 1JQ5A 3D54D 4JLUA 2G08A 2FSVC 2XV1A 3HI6A 1NZFA 2IXFA 4MGZR 4I6JA 5DTQA 3VYVA 3DMDA 1Q0SA 3IAM1 4WNAA 5ALSA 1MEEA 5FNVA 1QDUA 5LLSA 4EY4A 5EHNA 1P81A 2I6QA 3UG6A 3ANNA 5I45A 4DA4A 3OO1A 2EARA 4D9MA 1GPAA 3BJMA 4L8WB 3STVA 5KZMB 1E8NA 4D9EA 1KK3A 4L6AA 2XPCA 3D5TA 1BA3A 2V1UA 4JR1A 3PUKA 3ENWA 3QG5A 1TEHA 2RGBA 3ZY6A 3P71T 4ZHQF 5M04A 4JUIA 3WMRA 3QW2A 2BW0A 3UJ8A 2R6HA 3KEGA 3MA0A 1EG7A 1D07A 2EX1A 2OP0A 1ZD2P 4HDSA 2BOVA 2Y68A 1PHPA 3NBYC 3AFHA 3FNGA 4WLEA 3F9CA 2HREA 5ALNA 1DCMA 1J56A 2SICE 1EX7A 4DDKA 1KGDA 3U61B 4YWJA 3OX1A 1R4MA 3A6GA 3O2SB 1ZM4A 3ZDEA 4CM4B 2WJGA 4MJXA 4PG4A 5FTJA 3KLNA 2PIAA 4MR7B 4R68A 3N8HA 1G8KA 2PMCA 5DM70 4PO8A 1RZRD 3KKQA 3MXOA 4LF4B 3H2IA 4LDQA 3W6UA 4BNVA 4EB3A 3SZRA 5K09A 2Q3HA 3UC9A 5EA2A 3NIDB 4GUAA 2HQBA 4HZGA 4G1BA 4IIVA 4M87A 4W9RA 4EYQA 4NONA 4HYTA 1KC3A 1NHGA 3OZAA 3EPHA 1M83A 2VTEA 1RPAA 1T6BY 4QBGB 3WV4A 4BU1A 4DC0A 2P78A 3HDVA 1KVQA 1D0IA 1JWLA 3PUHA 4EAQA 1PQ4A 2HWYA 3ELBA 4V0ME 2COUA 3Q3GE 3EY9A 4F1KA 1OKKD 2C4UA 1F14A 4MA0A 4NEGA 4CTOA 4ZYXA 3ME5A 3TZQA 2PMDA 1N78A 2XVAA 3ZKAA 1IZ0A 1F12A 5TEWA 1TMOA 4XJXA 4CUKA 2VHJA 1M6WA 3STTA 2WKQA 3PKIA 1E6UA 1DADA 1OLXA 3L1JA 4O8ZA 4AKEA 3UBTA 1MT3A 3VHXA 2J0QA 5TT0A 2IU0A 2H4FA 1KQOA 4EUHA 4LXIA 1VGVA 1BVRA 1Q1EA 3EDOA 4CL8A 2F64A 3IKVA 3EEQA 4U9IS 5AT1A 3WLKX 4CR6A 1DOZA 1EFUA 5HFJA 2BC9A 1P9OA 2JKZA 2OBMA 4NZPA 4U2FA 1Q7BA 2HBRA 3DTNA 3HYSA 4I81A 4AWBA 1LX6A 2Z1NA 4OKIA 5IDXA 4AO7A 3DP7A 1OWNA 2B2XA 3HS3A 5AVVA 2YH2A 1ECPA 5JCPA 3CLTD 4JC4A 1OZGA 2G9RA 1ZMTA 3OZCA 1J21A 1OFGA 4O2LA 4GX1A 3WSVA 4CKWB 1PWYE 3PS9A 1CULC 1S3FA 5AK3A 3NC0C 5SY4A 3IP1A 1T8YA 4BBJA 2ZP1A 5CT9A 4B87A 1RRFA 1BXRB 2B36A 4DBLE 1YZVA 1BS2A 4KYUA 4BMNA 3INYA 4HN9A 5JNRA 3HP7A 3TQOA 2OMKA 3FDZB 2PZEA 4TV9F 2IP1A 2BMAA 4MVJE 5LZ5A 4C3VA 2VO1A 5TS2A 1STOA 2Q9AA 3D4PA 3QWHA 1DWQA 4PWYA 3CZAA 4LXGA 5B58C 4BCBA 3OIWA 4EQ6A 1QGZA 1ZGJA 2WYIA 3O94A 4U5XA 5NULA 4DG8A 3U5ZB 3GLFB 1BS9A 1P4SA 3MTJA 1ZH6A 5T64A 2B4RO 1JDVA 3G5AA 1NI3A 2A1UA 2FPGB 3K2EA 5KYUB 4UXHA 4PVDA 1K0UA 1M74A 2FG5A 3NV9A 4BUZA 4ZI2A 3HBJA 1GUYA 4G0PA 4B6GA 1IOVA 2SKCA 1CY0A 4RZSA 2BFFA 1XXLA 1FSPA 5D5QA 4YJHB 3PWKA 3IB6A 2GLXA 3JV7A 5JQWA 2QPTA 2IYYA 2J5BA 4F12A 5JE8A 13PKA 1RNLA 1UM8A 2FLWA 2V5AA 3KO8A 4UPVA 4ALLA 2ZU0C 4D6PA 3PHIA 3TOZA 3KUUA 3FNBA 2AH5A 4LPSA 2AXPA 3QXSA 4UJ5A 3KOYA 4AO8A 5BQXA 2C97A 3B78A 5JEEA 3KIPA 4KEAA 4IJQA 4IV5A 4I8DA 2QP3A 2VAWA 5KYXB 2JJ2D 2WVAA 1FDRA 4XVHA 4RH1A 5CX1B 2C92A 3UG7A 4ABYA 4U2DA 1RMTA 3WMFA 2B4YA 2X3UA 2RB5A 1IWBB 4GECA 4IY1A 3K2QA 3TM4A 3KQNA 2AW5A 3K92A 3UB2A 2UUOA 3FMPB 1MJNA 1MX9A 1TF7A 1R5BA 2HWKA 1G18A 3AIOA 5AK4A 5HCIA 3THXA 5E1OA 1L5HA 4AYXA 5FFMA 5IHXA 3W2HA 3H1AA 2RI1A 4D6XA 4UNRA 2H1SA 3HKCB 2RI0A 4M0FA 5B53A 3AINA 1E5LA 4A6XA 4E15A 1W36D 4GYYA 5IVHA 4B6EA 1CUBA 1L7OA 6REQB 4KR3A 1O9HA 1FP6A 4PO1A 3C87A 1Q1NA 4OREX 4Y2RA 3GN1A 2Z58A 2ZBPA 1AZLA 1KI2A 1X39A 5F7ZA 4BX8A 3CXUA 4UUOA 2R6DA 1NBAA 3UMBA 3W8FA 1AKQA 2JIPA 2MINA 1G5RA 1GLVA 1BHO1 1FDTA 1D2RA