1SK9A

Crystallographic snapshots of aspergillus fumigatus phytase revealing its enzymatic dynamics
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
435
structure length
435
Chain Sequence
CDTVDLGYQCSPATSHLWGQYSPFFSLEDELSVSSKLPKDCRITLVQVLSRHGARYPTSSKSKKYKKLVTAIQANATDFKGKFAFLKTYNYTLGADDLTPFGEQQLVNSGIKFYQRYKALARSVVPFIRASGSDRVIASGEKFIEGFQQAKLADPGATNRAAPAISVIIPESETFNNTLDHGVCTKFEASQLGDEVAANFTALFAPDIRARAEKHLPGVTLTDEDVVSLMDMCSFDTVARTSDASQLSPFCQLFTHNEWKKYNYLQSLGKYYGYGAGNPLGPAQGIGFTNELIARLTRSPVQDHTSTNSTLVSNPATFPLNATMYVDFSHDNSMVSIFFALGLYNGTEPLSRTSVESAKELDGYSASWVVPFGARAYFETMQCKSEKEPLVRALINDRVVPLHGCDVDKLGRCKLNDFVKGLSWARSGGNWGECF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystallographic Snapshots of Aspergillus fumigatus Phytase, Revealing Its Enzymatic Dynamics
pubmed doi rcsb
source organism Aspergillus fumigatus
molecule tags Hydrolase
molecule keywords 3-phytase A
total genus 153
structure length 435
sequence length 435
ec nomenclature ec 3.1.3.8: 3-phytase.
pdb deposition date 2004-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00328 His_Phos_2 Histidine phosphatase superfamily (branch 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 1sk9A01
5HR5A 2WNIA 1ND6A 2P9FA 2WU0A 3HJGA 2OWEA 4D4MA 3PGMA 5HTKA 3FDZB 3D8HA 3C7TA 3FJYA 4AROA 1XQ9A 2IKQA 1QHFA 3IT1A 2ENWA 3K4PA 4IJ6A 4HBZA 2YN2A 1DKMA 2DWOA 4GPZA 1TIPA 4D4JA 1SKAA 2HHJA 1SK9A 2A9JA 4JOCA 2P2YA 1V37A 2OWDA 4FDTA 2P77A 4ARVA 3E9CA 3IT3A 5AJZA 2H0QA 2GFIA 2P6MA 2RFLA 3D6AA 1FBTA 3E9DA 1IHPA 5CDHA 2QNIA 3IT2A 3LG2A 3LNTA 2EOAA 3O0TA 2P9ZA 1SKBA 3FDZA 2EKBA 2H4XA 3E9EA 1QFXA 2P30A 1YFKA 3IT0A 4EMBA 5CU7A 3QPVA 1E59A 4JOBA 1E58A 1DKNA 5AJXA 4ARUA 3K4QA 3OI7A 3NFYA 4PGMA 1H2EA 2HPAA 2P78A 1QWOA 5AJVB 1C81A 5AJWA 2P79A 2I1VB 3BIFA 1UJCA 3F2IA 2BIFA 1DKOA 1V7QA 2AXNA 3ZHCA 1NT4A 3D4IA 2PA0A 4IJ5A 4ODIA 1DKQA 2ENUA 3GP5A 3GW8A 4TSRA 1SK8A 3EOZA 1H2FA 2YN0A 2HIAA 4D4LA 3MXOA 2P6OA 4FDUA 5PGMA 1FZTA 1BQ3A 4ARSA 1RPAA 2EKZA 1RPTA 1DKPA 2H4ZA 3NTLA 3R7AA 2H52A 4PZAA 3EZNA 4GPIB 4MA4A 2P2ZA 1DKLA 1K6MA 3KKKA 5CX4A 1T8PA 3QPWA 4QIHA 2DWPA 4E3WA 5AK0A 3GP3A 1BQ4A 1CVIA 3DCYA 2P75A 1RIIA 4D4KA 4JODA 3MBKA 1BIFA 3DB1A 1EBBA 1UJBA 4PZ9A 2A6PA 1ND5A 3LL4A 3F3KA 2P9YA 4EO9A 2F90A 2WNHA 5AJYA 1C80A 1YJXA 1C7ZA 3QPUA
chains in the Genus database with same CATH superfamily
2PYZA 4B71A 1ECFA 3QPBA 2QM3A 2ZBUA 3ZWOA 3H1BA 4AYXA 1JHRA 1GEGA 5T57A 3VC2A 4A8JA 5J4LA 4QOHA 5CFZA 1IZYA 3FCYA 2E5LB 5E9JA 5KOHA 1V39A 3K0CC 1QR2A 1ID1A 1XXLA 2IH2A 2VJNA 1UXGA 1FX0A 1XEFA 5E1DA 3DTTA 2IEDA 4R0VA 5BN5B 5CDGA 1GZSA 3C3JA 3IKJA 4R8SA 3X2SA 1IJKA 1CY2A 1RVV1 3MTAA 3T3OA 1JFFB 1GO2A 4F1JA 5FUYA 2PUCA 2O3JA 4L2IB 5A6SB 1XTIA 1VMDA 2FR8C 3ZQKA 1J0DA 3EEYA 5IT9A 1YTUA 1JSZA 2C7RA 3E7WA 5E3IA 2WIFA 4M87A 1RJFA 2VDPB 2OB2A 4KMOA 4TLDA 4C3OB 1GXSA 4B7XA 1U8AA 1OC2A 4L0QA 2VTEA 3X2EA 3THYA 4BUZA 3K6SA 3M6FA 3TFQA 5IPFA 3IH5A 1YR7A 4MNTA 3CE6A 3HJAA 2W2OA 3OLYA 4BNTA 3HQ4O 3L7MA 3PHCA 3NHFA 3DG9A 1J8MF 4G0XA 4Z8XA 4LTNA 3KUDA 3AY0A 4Y6GB 3R0JA 4RVCA 1DTWB 1TPYA 4BQIA 1NG9A 5AVKA 4KFRA 10MHA 2CUNA 1UZNA 2NU7B 1KTVA 1M2OA 1TTQB 2JIPA 3HFGA 4XIFA 4ALNA 3OPVA 4YAFA 1GGEA 1DPGA 2X76A 2BI4A 1XQWA 2HL6A 4GKVA 1GUFA 3ROGA 4RKWA 5EP2A 1FRNA 3U3MA 5JSUA 2HC9A 2HMYB 3ZU5A 4W99A 1TU3A 2YYAA 4X71A 3IIIA 4WNAA 3P5SA 4MVJI 4JLWA 2J07A 3ZD7A 1VBMA 1NZFA 2GHTA 4MMXB 3HI6A 3HZOA 1BMDA 2GJSA 5IJ9B 3R6TA 1GQQA 3HCWA 1RM5A 1S9HA 2IY7A 4JC4A 3W1VA 2DH5A 3R5XA 1TM4E 3C15C 4ZVUA 4ZRNA 1BFDA 3BWYA 3ROQA 4BEVA 4BO1A 3HXMA 3NONA 3TSCA 1M5UA 1GIAA 4HLCA 2FRDC 3RSSA 2ADFA 1HK7A 1VSVA 1Z0AA 4HAWA 4NC9A 4TLCA 4TPKA 2XB2A 2XXJA 1G20B 1SUWA 1JR4A 2J3JA 3OD1A 2PMDA 2DHDA 4E51A 3TPZA 2UVPB 2VJBA 3IP5A 4IIYA 3Q3HA 4TWAA 1J90A 2FH5B 4IEFB 2PM8A 2FDRA 3BTVA 1GGKA 2O4CA 1VCIA 2JIMA 4EI8A 4G24A 3SFVA 3UTDA 5I9LA 4EB0A 1ADJA 1M7GA 3ZE7A 4LKOA 4A0FA 1QHSA 2J7PD 4W5QA 3VNQA 1L9XA 1I0LA 1KS9A 1USIA 1ZIPA 3CB4A 4EGJA 3ZWMA 4RMIA 5J47A 5CR9A 5A1JA 3R5HA 4WINA 1QZ3A 1RCFA 5CNIA 3ZJTA 1SEVA 4QFMA 1AX9A 3R6WA 1M2HA 4GP6A 1EQAA 3AHDA 2W8BA 4L76A 3W06A 3AVTA 3HDTA 5JFTA 4AM8A 3OCUA 4FEGA 2VYND 4DADA 1RWQA 3E22B 1G6Q1 2JI6A 2A0FA 1PJZA 3MWYW 4RHTA 5AJYA 5FBQB 3U17A 4IIBA 4A10A 5JATA 1Z5GA 3VFDA 3GLFA 4HDSB 4ME6A 4NI5A 1LCIA 1OLXB 1SCJA 3NH9A 3WE7A 4B3HA 4CIYA 4R7ZA 5COAA 4E4YA 5TMBA 3BXXA 3EC2A 3U9SA 4BCDA 2ZAIA 2OXTA 1ISPA 1R9JA 1GGFA 4J6EA 4WCFB 4XRGA 3KEOA 1IQUA 4LOKA 3C7TA 3U7QA 5B1DA 2ABWA 3AQ4A 1G7RA 2I3AA 1GPUA 2FPSA 2EATA 2DYKA 1V1MB 2ZW9A 4H3HB 5HMMA 1T5BA 1KI3A 1S7CA 2A1IA 1VP9A 2OLKA 3IUYA 3K4PA 1T4CA 1C7JA 1GTZA 1M8FA 1NV9A 2A67A 1OFUX 4MO9A 5FWXB 4XRRA 3JYPA 4INJA 2Q2VA 3O26A 1DX4A 4HADA 2ZI5A 3K73O 4U39A 2J9ZB 4ZCRA 1E6KA 1KXZA 2RHMA 3JTMA 4J07A 4BNHA 4Q1BA 2AMVA 1RWOA 2P8SA 2QENA 4QODA 2P6MA 1N0IA 1U4SA 3HR7A 1EZZA 5BWLA 4PFJA 2ONKA 3H1PA 3P9RA 4JJKA 4PGAA 2HPHA 2HA5A 3OJLA 2C4TA 5AW2A 3LXRA 4DCVA 5KC9A 4QDUA 5TB5A 2AQ8A 1XVAA 3LKDA 2R751 2FWRA 3HXPA 3LRXA 4TQUS 3TFOA 3IQGX 4FMPA 2BGUA 2NN3C 1BXRA 3I2GA 2XUFA 3O8QB 4N0PA 1QAMA 4R1MA 3AHIA 4WK4B 3U56A 1XUOA 1U1IA 3WC4A 5I9TA 4U63A 2ZRJA 1ZRMA 4KR6A 2J0QA 1VLHA 2HPAA 2P78A 3E9RA 5D7BA 1Z18A 4F2WA 5FOXA 4NJMA 4IX1A 2QX8A 1YR6A 3BGDA 2R5FA 4MWGA 1V8PA 4FGWA 5D1NA 5B53A 5F7XA 1LPNA 2IIPA 4DV2B 1XEWY 4GW3A 1NN3A 2APJA 2L2QA 1PZNA 3T7TA 3I6ZA 4QQNA 3UMMA 4N01A 4I6GA 3TMKA 3BEDA 1W5FA 3O74A 1GCGA 3N74A 4ZI2A 2DPXA 3VZRA 1PX2A 3P0JA 4HZUB 1QYDA 4J9UE 5FL7D 5BN4A 1H22A 4X92A 4RSMA 2J3LA 4PG5A 1WP9A 1XPJA 2VDKB 1RI4A 2YJ6A 1NAHA 3ZWAA 4F91B 3MTGA 3VU9A 2LXNA 3RW9A 1C4XA 4Q39A 3ZIUA 1QHHB 4EFLA 2Q2OA 4MV0A 3FW1A 4URUR 2ZJ3A 5FR1A 4YCSA 4K6KA 4OMUA 4YDSA 1H66A 2EDCA 2ZIWB 3HHPA 4M88A 3EDOA 4L5JA 4PVDA 3DQQA 3MLEA 3JQ9A 2GGSA 2AMYA 5FYDA 4HI0E 3GAMA 5CXSA 2WIDA 3PJDA 1N9GB 4KDFA 1Y89A 1U7TA 2ADOA 3MELA 1V48A 1M2GA 2C5LA 4BN0A 1HT1E 2N9UA 3RVJA 3HVUA 2X5NA 2F6RA 3KOMA 4DMLA 1KYWA 3T41A 1WMBA 3TEFA 5KTMA 1KI4A 1U65A 4B4WA 1OFIA 2Z2IA 3FF1A 2NXNA 2WZBA 5FIUA 4B6FA 1LNQA 4OG2A 1Y7IA 1W94A 2ZSHA 1W8DA 2WWFA 2X3UA 2XITA 1PQYA 1UJBA 3CMCO 3UT0A 3CGGA 4AIRA 5CDTA 1N57A 1UBNA 2EP8A 2DTXA 2XXBA 3F9IA 3G6KA 3JATA 1T9HA 1XHLA 2WUGA 2G77B 3OWHA 3QE2A 4G84A 2HGSA 1JR3D 1JAHA 3GJ5A 3H2ZA 4AJIA 3VNVA 3L8CA 4MOWA 1NF8A 1IXRC 3ITKA 3WFIA 1D1QA 1RJWA 1TEHA 2PRKA 2SNIE 4R3NA 4B6GA 5CH8A 3TTUA 4DR7B 2BC9A 2OZEA 1Z28A 1SM4A 4BMYA 2IELA 4PIVA 1RLOA 1XJWA 2REXB 1DC8A 1A2QA 1QZTA 2L18A 3H5NA 5I4BA 1O94A 3LVRE 2ZBEA 1IEWA 1WOMA 4XOIA 5JAPA 2P1ZA 3HGQA 3ICEA 1XQ9A 4EDHA 3TNYA 1GA4A 4MUAA 4P4UA 2QZ9A 4P7FA 1KI6A 3SIRA 3X1YA 3MB8A 3L6RA 4RHFA 2DQYA 3C7KA 1UK6A 3R23A 4HLDA 2RI6A 4JU9A 4E6PA 5ITWA 1BN7A 1QQBA 3WWZA 2N1BA 1W29A 1D0SA 2OILA 3BJZA 1A82A 4I50B 4ZQFA 4ZD6A 1WUTA 3HN6A 3I72A 4LHEA 4V03A 2OE2A 3HYLA 1AKWA 1TO1E 4N3CA 5IKPA 3TNDA 4I1RA 3PR2B 1NQVA 1A8PA 3ZHOA 3Q8MA 4BWFB 4YBRA 1E9DA 3MVEA 3N07A 1EX6A 3AP1A 1NBAA 4WXYB 5DBHX 5FPSA 5JC8A 2IPNA 2VF4X 2QN9A 3JQ8A 4DOMA 1U4OA 3L06A 4MPDA 3MTJA 5IAJA 1PV2A 4C2AA 4WASA 1C0KA 1NPYA 1WZIA 3HMQA 1RWKA 4HVTA 1QFYA 3A9UA 4PRYA 1D1PA 4N8EA 3PFGA 3MM4A 2WF5A 2P11A 2ZQZA 4CEIA 5LPNA 3HFSA 3KTAA 3QEOA 5JVDA 3OOJA 3FLMA 5AHXA 5E38A 2AG5A 4B2YA 2CXTA 3TAUA 2X2OA 1LBQA 4Q4LA 4UUAA 1YMQA 5LYYA 2VZ8A 3H2KA 2IU0A 3LQRA 2NUAA 3I05A 3KYBA 2BH9A 4HKTA 3SHVA 4BQFA 4BMDA 2C7PA 4X65B 5EUCA 2PWBA 4WXPA 3GBPA 4AY5A 4C7OB 1JW9B 1YGPA 3JQ8B 1PLLA 3CRQA 5U4XA 2VZ0A 2R8YA 3O83A 1SBNE 5EWMB 2I1LA 4UM8B 3FPKA 2PWPA 2HJRA 2JAXA 3IBCA 3ZVLA 1XP8A 4UQPA 5FNVA 5CG2A 1OXTA 1J07A 2V6BA 4G3XA 4CEIB 3MJDA 2YXEA 3GWZA 1Y33E 2NU9B 4I2NA 2VHYA 1WUHS 5L4LA 5L9AA 4UNRA 1CG6A 1TCBA 2R1TA 4O25A 2O8VA 4Z0HO 1D9ZA 3BF7A 1G5IA 1MAWA 1XAIA 1WBJB 1AKTA 1JEQA 3E4CA 3PEWA 2JGJA 3AFMA 3R9KA 1EM6A 3SBOA 3ZQUA 3STWA 1K7SN 4IM7A 2ZJOA 1W75A 2F00A 2WUDA 1HY3A 2MU1A 1HYGA 1E20A 1OLXA 1L8QA 2Y2UA 3NOXA 4LS3A 5BT9A 1J0XO 2Y0DA 3VX4A 2RONA 4FHZA 4H27A 4C7OA 1EZ4A 1GPJA 2ZCJA 1L6IA 3HN2A 4ZOBA 3CUWA 2ESRA 3OCYA 3RARA 3FYSA 2NVBA 5LM3A 3AI7A 2VWPA 5G4KB 5DYIA 2EVWX 4X8LA 1FDWA 2VXCA 2ZJ1A 4MUYA 5J5AA 2QLLA 3TQIA 4ZZ3A 4DDUA 4FX5A 1PUXA 2WWIA 3G8CA 2VPWA 3KL4A 4OA5A 2QTNA 2QLJA 4Y1EA 1BW9B 5HDQA 3MBKA 1OY1A 4LHYA 4A5SA 2XOEA 4LN1A 4URXR 1ID8A 5EE3A 4WOCA 3I9V6 1E7RA 1FP6A 4UBMA 1EXWA 1NHGA 4YMGA 4ARIA 4P33A 3ZY3A 1R6XA 3AR6A 3V7WA 3OLVA 2Q5OA 4HS9A 4MYHA 5GIPE 3BCRA 1Y6FA 3N75A 2LIPA 3RHZA 1E4YA 3TW8A 1FFAA 4WFKA 3TDNA 5BWOA 2IPMA 2BUCA 1BMFD 1EE1A 1IEVA 3BD7A 3MRVA 2Z2XA 2P9FA 5CTAA 4ZOLF 1Q1GA 3IIEA 4PXSA 3RG8A 4Q4JA 4K03A 5LQRA 2VHUA 3F4LA 2B5VA 3L8GA 5CXXA 2YMPA 4MV8A 1AOXA 4AX4A 1GYQA 5F21A 3DAGA 1BXRB 1XO1A 3L02A 3O8QA 1DIAA 4CVNA 1L1FA 5G0SA 3KQNA 1KFKB 1DKMA 3FNBA 3VDQA 3PITA 3LO8A 2A9VA 2O07A 4JB8A 3IL2A 4K9OA 2IXEA 1MC8A 2H1RA 2PYIA 2Q1UA 3GB9A 2CVQA 2X22A 1XFDA 4J8PA 2A1UB 4C7BA 1TAUA 3DMNA 3IJRA 2HREA 2H9AA 3B3GA 2H0RA 4PHCA 1CUZA 2IHJA 2ZXFA 2CBGA 5F33A 3CFYA 2EJVA 3TVDA 1SEPA 1CDDA 2ATIA 3QPAA 4OBBA 2HBRA 3WAJA 2MR5A 1I9GA 2J1LA 1XR3A 2ORED 5C5CA 5AT1A 3HUEA 5GGXA 5FLXA 2WQ7A 3SQXA 5JHGB 3E5MA 4DWWA 1UPCA 1Z26A 3OOEA 3ZTTA 2E2WA 2UYCA 1HRKA 1P1KA 1Y3CE 2FSVA 3ZV6A 5FUVA 4UTNA 1HNZB 1N2EA 1Z4MA 2FP4A 1BE1A 1H2AS 4HB2A 5J2UB 3E0QA 3KSRA 2MINB 4ARUA 5B3LA 3KEGA 3C6KA 4PBSA 1XJCA 1NXQA 1AH2A 4HAUA 4MLCA 3H16A 3S29A 4HNTA 2ACWA 4I99A 1Y5IA 4KR3A 3D1JA 4GO1A 2HLHA 5DO9A 3O73A 4MAAA 4QLOA 1OT3A 1ZP6A 2YRFA 1WDLA 4R6XA 1QQTA 4K3UA 1GTVA 2XYPA 5KAPA 2ZKIA 4YBZA 5FLKA 3V2IA 4U00A 5JNVA 2QN6A 3IAUA 2ENUA 4EHIA 4ENWA 1E9EA 5I47A 2BMDA 1A9OA 4GGOA 1USWA 1XZKA 1IN4A 3SR3A 1CYEA 1OTXA 1P1IA 4NXNB 4M9SA 1ZOLA 3A4NA 2Q0QA 4G9BA 2GVNA 1KDPA 4DG9A 2WD8A 1NQUA 2JASA 2ZYDA 3KPVA 3PD7A 4TKVB 3U7IA 4PZCA 4IDGA 3I0ZA 2BBWA 3WFZA 4EUNA 1IBSA 2G72A 2I3BA 1C3LA 1EA5A 2Q2QA 3MOSA 4HGPA 4ZDKA 2V58A 1ZVMA 2HF9A 2DLNA 4NFSA 3C24A 5FPQA 4I81A 2FG6C 3QITA 4J1NA 1GPLA 4R8RA 4Q7EA 1EX7A 3HB1A 1T3ZA 3DA8A 3JQDA 4H4CA 2W2XA 1IXZA 5H68A 5C8VA 3UY4A 1GTL1 3ANXA 2XADA 4D3YA 1W0JD 3DBIA 4QUDA 3ESCA 4H6XA 1L8LA 2DECA 1W47A 3I6IA 1FDRA 3VR5D 1XPRA 3L8MA 1YO6A 1ZA1A 5DCUA 1GU0A 1NUTA 1MIOB 3DT8A 3ICCA 3L6EA 4QGFA 4C4SA 4ER7A 1VRCA 2RK4A 2CUZA 2YFQA 3D8RA 3DGEC 1TT5B 1M3SA 2NV6A 2RKBA 2VAVA 3DFKA 4UD6A 3SG0A 1G8YA 2IYYA 4Q66C 4RKQA 3IP9A 1J70A 2GZSA 5DHPA 1AC5A 2HDOA 1P39A 3PDUA 3V7NA 9LDBA 1HE8B 1E2FA 1GUDA 1ZW6A 4Z2YA 2IYEA 2JC3A 1HTWA 2IDKA 4HPWA 4KYVA 2FWMX 1WU8A 1BMQA 1GDTA 5G3YA 3W9SA 5CYGA 3D4PA 1ZMXA 2Z5VA 1I5RA 2F1RA 4DL9A 3A7DA 4CIWA 3B1FA 3A58B 3ZXUB 3RS5A 4JP8A 3R9XA 2K2QB 1OKKA 4K86A 5BSVA 2FA9A 5AESA 3T5PA 1NI3A 2I62A 4BQQA 5CLQA 3IE1A 1I2CA 3CT6A 3HBAA 5C1PA 2FSGA 3V48A 4F96A 4F8EA 1X1RA 2CLIB 1V37A 1RRFA 3LH5A 3MOGA 3NR2A 4G1EB 4MW6A 5JD6A 4RFSB 1N92A 1Q0LA 5KIAA 1XOIA 3HJNA 5EKDA 2VA8A 4KLNA 4KPEC 4FMBB 4NDAA 4MW0A 2IIBA 3AV0B 2HF2A 2AN5A 2E4ZA 4BZXA 1VKOA 2QE7A 2A7XA 4A0GA 5BQXA 3BHJA 1JNYA 3IRVA 3QKTA 2WKPA 5TJ9A 3M1IA 5MF6A 4II3A 4MSUA 3IELA 1MEOA 2OV1A 2REBA 4IDBA 5FO0A 2DR2A 1FMFA 3PXCX 1C1XB 3AF6A 1TJ4A 5DEOA 2FMHA 5LQJA 4PGMA 2ZXEA 4E31A 2NOAA 2GNOA 2RAUA 4G85A 2PUTA 5KWEA 2QQ0A 4MUFA 4QBTA 4RE6A 2QL9A 3KBOA 3RBAA 3WHLA 5A4FS 4PYQA 2GASA 1XQXA 4B79A 5AW1A 1OBCA 4ZV4A 2FMUA 2IE8A 3UA3A 3L7AA 3JZDA 1NBOA 3IV6A 1KZGB 2AXNA 2AGVA 2QGZA 3QFFA 1QS0A 4UVDA 2XE8A 3NIFB 3OZCA 4PG6A 5AI0A 1DKQA 2XBMA 3ZW9A 4LCEA 4JASB 4JB0A 2A3NA 1E9SA 1F2UA 3UJBA 1HQKA 1X7ZA 1VLLA 3D0RA 3IHKA 5KNBD 2JJYA 3K32A 4YJ3A 4IICA 2LGJA 2RH9B 3RRFA 2ZPUA 3TTYA 1RLTA 1B8PA 5DGIA 1KRHA 5SYNA 1AD2A 1R0RE 3SQNA 4O8CA 2G9UA 1ZWLA 2BFDB 3EUWA 4MW9A 4CMAA 3HZZA 3ONWA 1J2JA 1UDXA 1R8SA 3ECAA 4AZVA 3ZWNA 4A26A 2KLBA 3UGJA 2OCDA 1GZ5A 1C41A 2EW8A 3TINA 1BDMA 1E2UA 1E77A 3DWEX 4IOMA 2H07A 2CL6X 5CX4A 1DO0A 4FWTA 2FW1A 3BN3A 4PLGA 4O63O 4GR4A 1E61A 1VYHA 4Q4JB 1E7MA 1Z5UA 4FLFA 1K8ZB 1ZSNA 2CLSA 4Z0NA 4DA0A 4KPGA 4AMYA 3FNEA 1OBHA 4FR2A 3SYNA 4JBNA 1NXTA 1JUDA 2IYXA 3AB7A 3EQ6A 1OLSA 4A6DA 2Q49A 4HDQB 1R6BX 4R7TA 4M76B 4AK9A 5ISMA 5AJTA 4RMGA 1QNLA 2HIMA 4Y1RB 1AU9A 1NVAA 3IDFA 5THXA 4R54A 3RBVA 2BGWA 3NI2A 4ALLA 3B1KA 3JV7A 3VR5H 1CQWA 3RWOA 4Q9JA 1Y7HA 1XZ8A 4LOIA 2NYUA 2QDKA 3DZCA 2YYZA 3MGGA 3O90A 5CG1A 4J0JA 3OIWA 3WHIA 4BQNA 1XF1A 2X1VA 1U7PA 3T7RA 3TXAA 1N2GA 3ISJA 2PT6A 3A1UA 2LKCA 3EPPA 4DM4A 4R9RA 4BKMA 1IPFA 4QDJA 1QH8B 4ZVLA 5EHZA 1XGKA 3LCVB 3DMTC 4ALMA 3L0BA 4KQ6A 4XGKA 2Q3FA 2PVPA 3DXYA 4URVR 1SCIA 2IYZA 3P0EA 1GRNA 1NVWQ 2ZVQX 1LB1B 2W6JD 1EK6A 3AU9A 3JYLA 1UJ6A 5AD1A 4CLRA 3HXQA 3U4QB 1J97A 5P21A 4FFRA 2B8EA 3DMRA 1P73A 2P77A 1KJNA 4LK3A 3AUXA 4PTYA 1PBNA 1U2PA 4J4HA 2P91A 2ZIXB 3AI2A 4U5XA 4HN9A 1QIGA 3GJXC 3HJUA 2F3SA 5LL6P 1S96A 2JHPA 3EPJA 2WIJA 3OICA 4XCXA 1UKCA 2Z4TA 1FS6A 4IHJF 5JCOC 2PLFA 3KXIA 3PXXA 2EJCA 4IWNA 3U49A 4H08A 5LQSA 2W6OA 4LYHA 3SR4A 5IKMA 3BMNB 4WKBA 4NEGA 3COWA 3FCOA 3O4JA 2ZYIA 3E3AA 2OHIA 2XI4A 3KLNA 2FR1A 4G0NA 4CDGA 5MN6A 1A1VA 2E5FA 1J0AA 2X42A 4Y3UA 1BCRA 2EJBA 2G67A 5E2BA 5EYPB 1ENZA 3HBMA 4EHKA 1G59A 2UYYA 1MT3A 2PU7A 2B1IA 1YU6A 5CA0A 4P3KA 1WKBA 3I04M 5C1IA 2HDNB 3ASUA 3EDCA 4Z1MA 4D74A 3R7DA 2ILTA 4XQGA 1NFFA 3PSHA 2C0CA 4FS8A 4QELA 4CF6A 5FKJA 2N0SA 5HTOA 3RTGA 1P62B 1QIDA 4EG3A 2PRZA 3JD0A 1SXPA 3QYFA 1NZJA 2B9EA 4MI1A 1THGA 1DCMA 4GYWA 4P4SB 2WTBA 1OVMA 3H2YA 3W77A 3T9DA 4AWAA 4BLQA 4BTVA 5A4AA 5JS7A 4YAOA 3EVEA 5TR9A 1A8IA 2EXXA 4MKIA 3ZIAA 2VSOA 1YA6A 4NZMA 1C7EA 3H9CA 3EZFA 3SYTA 3CF2A 5EYPA 2HIAA 1D0IA 2ZJZA 4KB5A 1QKIA 3TL3A 2QUKA 2WJ6A 4D79A 4QGSA 2PTGA 4CN8A 2R2GA 1RXSA 4JLMA 4PS1A 5REQB 4BUJA 1Z0JA 3EYAA 1JDPA 1ZKDA 5TS3A 5IU6A 2JFXA 1SKMA 2QG6A 1E3IA 3R7AA 4C6SA 1P7CA 3T99A 3UJ6A 4DA6A 1NLZA 2R00A 4J4BA 1P1BA 1IJEA 4YH1A 3CCBA 1DS6A 2BI8A 3KKNA 3UANA 5ALLA 1CY1A 4K6OA 2WI8A 3AINA 3GVPA 2OBLA 1Z3IX 3C74A 4KNWA 3AFOA 3H5LA 1RYNA 4RC9A 1U1EA 5HEKA 5B1SA 1JIVA 3ZYZA 4JH0A 4Z99A 2GSWA 4B5LA 2JAQA 3DOCA 3G6WA 3OZTA 4MH0R 4P7JA 5IKOA 1XA3A 4DLVA 4DYVA 3VISA 1TAGA 1JFVA 1S8FA 2B6HA 1ISIA 2COUA 2Z2YA 4AXXA 2F8SA 1SRRA 4PF1A 1T2EA 3TKAA 3KXDA 1HOTA 2D2EA 3PTLA 1ORTA 1MTZA 2EG9A 2FMTA 4QSMA 1RP7A 5AVJA 1E1RA 1LKZA 2EQ5A 3MS7A 4GZ5A 4U9HS 4CKXA 4FMCF 2W4IA 5BYJA 3TIXB 1GPWB 1IDOA 4I7EA 3TECE 4BEBA 1N3YA 4YRGA 1CQPA 3KO8A 1H8ED 2KBEA 4KX5A 2LBPA 3PYXA 3EMDA 1YZQA 5EMLA 3CNLA 2UZ1B 1E2PA 1DQSA 5AVVA 2IY8A 3KTOA 1T13A 1B0UA 4RHUA 4N8DA 2PLRA 1C7RA 2ALJA 1JAYA 5ALYA 3CF4G 4HSGA 5I8PA 2BR5A 3WWCA 3CX6A 4REOA 2DGDA 5T4EA 4M1KA 5GP1A 1J33A 1NW3A 1BFUA 1ODJA 1C8BA 3KELA 1P0FA 3WB2A 4BU0A 4IGEA 3MD0A 1VMKA 5EJFA 4XQEA 1NMQA 3F2VA 3UJ7A 1UBOS 1O94C 1T4GA 2CNLA 3NWEA 3SX0A 2VXBA 2FSHA 2FF5A 1L5KA 4M1TA 5JO0A 3NNSA 3SZ3A 1B26A 3JZIA 1UBSB 2V8OA 3WB9A 2H0QA 3L7JA 1K27A 3ZJVA 3E0XA 1L7VC 4GUAA 4XX0A 3LVBA 2J4DA 3HKBA 2AFHE 5HQJA 1SPBS 3T7AA 3WIVA 1SIWA 1EWRA 4RXTA 1UFKA 4F1KA 2A3RA 1NI4A 3F6CA 2B8TA 2HTFA 5JZSA 3K31A 1RWNA 1UWKA 1R6DA 1QP0A 4NR0A 4A8HA 4LZJA 2QRQA 4NK5A 2WTAA 2POQX 3AW9A 5JY1A 3OA2A 1BJTA 1K0UA 1RWWA 1Y6ZA 1JMVA 4G0MA 2EZTA 5J2TB 4LYFA 1M0EA 2EBFX 4QXOA 1PZFA 2GD0A 4NCAA 3IEKA 4WZ6A 3EGEA 2ARKA 1K68A 2HRRA 4KO1S 4P7KA 4OFBA 4QFDA 4CZ2A 5KHOC 4YMUA 3S7ZA 2QTBA 1X8LA 5B36A 3IPAA 4AP9A 3HO1A 4NCBA 1UADA 4EHNA 3OC6A 4JQCA 1U0SY 4KP7A 1IONA 4UHBA 3RTDA 4OV6B 4ZYWA 2NO6A 3I6YA 5GPBA 3THOA 4IDCA 1V7ZA 3IMEA 3HKBB 3THXA 2V96A 4QG7A 4K9KA 4EWLA 1IM2A 1O3YA 2Q6IA 1BEZA 3KP1A 5C8ZA 1YZGA 3KKOA 4PRZA 5KCZA 1TA0A 1CQIB 3AJ8A 3S8MA 1KYTA 2VQ3A 1LTQA 1KMQA 1YQWA 2XD9A 3HUUA 4KIWA 1OGJA 1W36D 4A8PA 1Y3HA 4GDFA 1GILA 1S4MA 2DPYA 3FCSB 5F1YA 3KLPX 1UT5A 1JYEA 3D02A 4MIEA 5LN1A 3Q8KA 1VDMA 1VRWA 3D7NA 2CNNA 1S6YA 1FE8A 1W2GA 2AJ8A 3O2QB 4RQBA 4RM2A 5LU9A 3MCWA 2EBWA 3OZDA 4RS3A 5I3CA 5J23A 3GPCA 4QBHA 4DRXA 2H0AA 2E4XA 3DV2A 3GN1A 1LC0A 4IVPA 2ATVA 2RGCA 3NU1A 4Y2RA 2BL4A 1NUHA 1T1EA 2WHRA 3BMCA 2IVFA 5HSGA 3QE4A 3HWRA 5DBGA 1L4HA 1NBME 3PR1A 3UXYA 1A98A 3VM6A 2DKFA 3U7RA 3ZCRA 3JYNA 1CZOA 2LE0A 4K6FA 1FYDA 2JIZD 2MYPA 3GPBA 2R60A 3INGA 3M6WA 1WHTB 3WKCA 4X3OA 3UK1A 1L4KA 3FPJA 3STYA 2ZPAA 1PYDA 1T0PA 1PDOA 4YRTA 2HV8A 4B81A 2DOKA 4NX2A 1J0EA 3A1TA 4JYCA 2R8EA 4HL6A 1TCVA 5MHTA 4EI2A 1ECPA 2NWQA 5JWOA 1HM5A 3QX9A 4RENA 4CKYA 3O8BA 3EBOA 1JHXA 1KERA 3CTPA 5EJAA 1CETA 4Y2QA 3STVA 4RA6B 4K9PA 2ZPTX 4PZ0A 2D5LA 4RF2A 1J1ZA 3H4IA 2OMEA 4JJ6A 2BGTA 3THRA 5BR7A 1D2MA 2BR4A 3RLFA 2HKIA 3OG9A 5DIFA 1QGED 2I78A 2F55A 3FPSA 2ZRGA 4GKAA 4BFZA 1DJPA 1R10A 4G0OA 3E9MA 5HR5A 3IUPA 4NENA 5H1YA 4A1OA 2OCXA 2VO1A 3EUAA 4F71A 3OU6A 4Z7NB 5KQRA 2FHSA 3H97A 4GMXA 3TQRA 4AG3A 2B4RO 4B3JA 3AKEA 2H1LA 3C3AA 4QOJA 1P2DA 3TGWA 3NEAA 1A2OA 2BHSA 2Z83A 3HKCA 5SYAA 2AR9A 3IJPA 1OXKB 2DQSA 3KU4A 2GVZC 5GONF 1X7DA 3WLIA 4HRVA 3MTIA 2R85A 3K70B 4OHXA 1TF7A 1FVHA 2FTKE 2POCA 1BSVA 2XCRB 1JQKA 5E4TA 1ZD5A 1MW9X 1P60A 4R9VA 3VGJA 2FPPA 1C9NA 2BBTA 2BKAA 4BVBA 1A9YA 3FUXA 5FR2A 2Y05A 1JSLA 5EZYA 5KOIA 1TI7A 421PA 5BSUA 4R8KA 4IEEA 2VIIA 4HUQA 4FI3C 5DIZA 1T6BY 1IHXA 2J45A 2ZJ2A 4XUDA 2E89A 1AXRA 4EKEA 1UC9A 1F4PA 1ZOPA 1X1AA 3ZGZA 3E15A 4J0KA 3UWPA 2ZJFA 2XQFA 4JR2A 1T1JA 4IS3A 1BS9A 2AG0A 2EGGA 3OWXA 5AOCA 1N2CB 4AKTA 3OT4A 5HMLA 1MO5A 4E7OA 2CZCA 3CWCA 1A2KC 3LFUA 1IM8A 4MEAA 2ZREA 4A92A 1WCV1 3LZDA 1XZEA 2NVOA 3W8RA 1A5AB 3ZGNA 4KACA 2UYGA 3GH3A 2BBOA 1CPYA 2CZGA 2G6BA 3BILA 5HG0A 2G5GX 3TCNA 3BPSA 5EZYB 1TE2A 4XYEA 5B7GA 4HNQA 2PUDA 1CZUA 4LDAA 3DVLA 2I1VB 4OF4A 4D6XA 1BDBA 1H23A 1I6WA 1Y4UA 3G5TA 3JWJA 3WGOA 3W6PA 1FVOA 4KBYA 1SZDA 4KQHA 4ZEXA 4RH0A 3ZHCA 4B1FA 2CVPA 2RHBA 3DTVB 5GONB 1U9IC 3R7BA 1ZGCA 3WYFA 3B60A 3PZBA 1G0NA 5CRIA 2PR2A 1XJQA 5FTKA 2V7VA 2XHEA 5HZHA 1S89A 4YASA 1ZNQO 4J6FA 3ZCPA 1J0BA 1VHQA 4FN4A 5JFOA 1JBEA 4AD8A 3LZ6A 4P53A 2G9ZA 4PHFA 4R51A 5LD2C 3OSUA 3NDRA 1KDYA 3G9QA 1PT8A 2C77A 4HRXA 1BVYF 3NORA 4M1EA 4BQOA 4CKEB 1TUEA 3CBGA 1GSIA 4OKIA 3FD8A 4KGVA 3N2KB 1K92A 3JQ7B 5FBKA 4DSAA 1NURA 4OK5A 4TXNA 4ZOLA 1V6AA 5LZ5A 3G2JA 5F7OA 1STOA 5EJ5A 1LEHA 1I3OA 4G6ZA 2ZI3A 4E0BA 3EIWA 1R4MB 4W1PA 1KU6A 3DOEA 5LKRA 3HL0A 2WM8A 3QTTA 3EVGA 4IV5A 1K8RA 1KO8A 2I55A 2VUSA 4QJIA 5GJWC 3BL5A 1QUFA 2D7DA 1YFZA 2HZBA 1JQJC 4G86A 2HWYA 1NVVR 3VR6D 2CK3A 5CVTA 3CH7A 5AM5A 4Z4FA 2NU7A 2IEZA 3Q4GA 4G5FA 2F7SA 2YS6A 4AJ4A 3M5CA 1IMJA 3NDIA 1O77A 2ZJ4A 3EODA 4JVSB 4KXFB 4CT4B 1T35A 2HHHB 2VRCA 1QE0A 2ZSIA 1IH8A 4NYMR 4BU1A 4YT4A 2CYCA 3H8JA 2YQZA 1FDVA 3V2HA 1NI5A 1WG8A 3DP7A 3WYEA 3G2QA 3OQJA 1I36A 2B21A 3L3BA 1YE8A 1L7RA 4DJ5X 4MKGA 2P7IA 3K35A 1XVVA 2YH2A 5KEIA 2R4TA 2OVBA 4JI5B 5CH5A 3PGKA 3QEKA 4CIBA 1EYZA 3RWMB 1MRNA 3ICPA 2CFCA 2PSDA 5JYCA 3GUZA 2CL5A 4YLGA 3FMGA 3A14A 2YTZA 3PT5A 1XYVA 1AQYA 3Q0TA 5GM2A 1J5PA 5AUPB 2DWOA 5FWXA 1ZBQA 4BE4A 1FLVA 1IIBA 1OJ7A 3FETA 4GVXA 4DANA 2OC9A 2Z43A 4URYR 3HV2A 2W98A 1LS1A 2AFIE 3IKVA 3EWSA 2D1QA 2XRFA 4QYXA 4RJJA 1ORWA 3WX0A 4LSZA 5H4GA 4FOPA 1GRRA 1OFGA 4IFIA 5IT0A 2Q1TA 1YK0A 1RC8A 2R4QA 1XZMA 7REQA 5AR1A 1Z8HA 1ZUHA 2UUCB 3HLKA 4OL0A 2K5UA 1JLKA 2ODQA 3N76A 5ALFA 1JEDA 2XMGA 2V7WA 4XE5A 3UK6A 2Z1NA 1M1XB 1T6ZA 3BFKA 4JC5A 2TECE 1TK9A 1B2RA 4JBXA 3IA2A 4PCAA 3TB4A 1W36C 5HJ7A 4PSVA 1VM6A 2WP8J 3LGSA 4XWAA 1OU0A 1WBBA 5AI4A 3RSGA 821PA 3N0XA 2OM6A 5KYWA 3I5XA 4MUMA 2CLDX 4BNLA 2C42A 3M1YA 3OIYA 3CZAA 3DPIA 4TLBA 4AAYA 3AC0A 5C7OO 3OT1B 4B40A 2JGEA 2B94A 4UFNA 2BIFA 2ZUBA 4TMTA 5KNDD 2VJPA 4MP8A 1LSOA 2IEIA 2B82A 3HCPA 3QVTA 4FX2A 4QJBA 4B75A 3T3IA 2BFNA 3NKFA 4MVJF 4BQEA 3I6BA 4M1YA 3P0IA 1L3CA 3O4GA 2H18A 2BTEA 5AO9A 2WTXA 1CUBA 3CH5A 4J94A 1KQGA 5T7BA 1PWZA 2XVZA 1T4CB 4BKQA 3KQMA 4DLSA 1B76A 2GPBA 1P2UA 2YMLA 4HJXA 2OPHA 3U7FB 3SSOA 3VC1A 4DSTA 2BFAA 1ZAKA 1ZCZA 2WP0A 3AEUA 3KQYA 3EULA 3L18A 5A6SA 2QL6A 1U0GA 1YKFA 3NTRA 4M37A 1WKCA 4WK2B 1NYQA 4F9FA 2YY6A 3F5MA 5CA0F 2J5XA 2H92A 4J29A 4DEYA 1CRQA 3QSGA 2WSBA 5HIMA 1T24A 4B3XA 2AWNA 3A6EA 1CJBA 3THYB 1L4EA 1O5OA 1PQPA 1HOXA 3BIWA 4UARA 3SIXA 4WI1A 5BSWA 7MDHA 2G9RA 2P9CA 5KWJA 2QUHA 2D0IA 3VYRB 1KC1A 2P5YA 2Y1KA 1UDRA 3PYMA 2OBBA 4YR7A 3EB9A 3VPBA 1G8KA 1S3SA 1NXWA 4WL0A 3QIVA 3SSMA 1NV8A 1N77A 3ZWCA 3AVOA 3HVHA 4CDNA 1BHJA 3KYDB 4TTJA 3PPWA 2HSJA 2C3MA 2Q6KA 4DR3B 3AERB 3N2ZB 2QTGA 1EGMB 2OSBA 4HAOA 1CUWA 1E3WB 4OCZA 3LWDA 3S2UA 2WAXA 1ISGA 1E0JA 4RW0A 2PY6A 4K6CA 2ZI6A 2XT9A 5BNTA 1W9MA 1OIVA 2P9TA 4H7KA 3PE4A 2B1QA 1U98A 2BLNA 3OE1A 1X7XB 2ZT7A 3U09A 3PLNA 3WO1A 1VI6A 5FT9A 1LI5A 4O3FA 2J3KA 4JOSA 4QA9A 2ZT6A 1WQ4A 4RIGA 3N7AA 4XUEA 2X58A 1ULUA 1XTQA 3E3NA 1G3MA 3FFXA 3OZXA 3NYQA 3IMKA 4N47A 4PQYA 4EX6A 1IE3A 3SP1A 4RVSA 5BSHA 1ENPA 4LMPA 221PA 5BVGB 3IAS1 3GWGA 4IUYA 3C8MA 2QD1A 3FPAA 3L8YA 3RHTA 3DDHA 4W6QA 3NGXA 2JLWA 1I3MA 1A71A 2FZGA 4MGZR 3B5IA 4ZCPA 1AA6A 4H3SA 1GZUA 1TTPB 3SF8B 3BWEA 3QI2A 3KDSE 5H7XA 3UJ8A 3WA7A 3I9JA 2Y3IA 1EESA 1FSZA 1VCMA 4DKXA 4ETMA 2NU8B 1IAQA 1S5PA 4UBOA 4KPFC 3ZBTA 1SUSA 4RUKA 4TXMA 3WADA 3UFXB 5IANA 2EV9A 2VP4A 1M2OB 4C21A 1KI1A 2QUJA 1PNOA 3OUTA 4FFPA 1RXEA 4LE0A 4XGIA 3OIFA 5B55A 1V16B 1ZEJA 2I6FA 1BG6A 1RPJA 5H5JA 4AG5A 2D2FA 2ZCUA 4CU5A 3FDJA 4L8FA 1FFEA 1O87A 3G2OA 3DXZA 4M0UA 1ZJJA 2QMUA 3EVZA 4U7PB 4WERA 4W1SA 5DGTA 1YRHA 3F2IA 1KGSA 2D3WA 5AKGA 1E92A 3OIDA 3ZW7A 1WE2A 4OQYA 1TLFA 3C4QA 4UMDA 5F3DA 1JECA 2H2DA 2XJ9A 4LJKA 2WJJA 1QH1A 1KMIY 2XB6A 1V5GA 4KE8A 4D9KA 4E88A 2IVZA 1JA1A 1FXSA 2F1HA 1H4QA 1T36B 4H7JA 3N3BC 2MTBA 1LDYA 3P9XA 3ESBA 3ZU4A 5IF9A 3O21A 3G7UA 3WTCA 2Q9BA 3GLSA 3IKMB 3OO0A 4RXMA 4ZVRA 2C00A 3FPGA 3FOAA 4Z4HA 3GLIB 1QK5A 4PAGA 4YQEA 1EJ0A 5F4ZA 4QXRA 1ZUNA 3ZW8A 1X1SA 4XDZA 3H8WA 4TSFA 1GKUB 4GE0A 4TXHA 2OP1A 2H4HA 4ND4A 1GNRA 3TTTA 4GFDA 2CYBA 5DMXA 1GNTA 3CLRC 4Z7OB 3T1VA 1IEQA 4LJ5A 5KWIA 4XWTA 1YB5A 3GNQA 1ZH2A 5D85A 3RFFA 2FEAA 1Y7TA 2D8AA 2WV7A 2ZSFA 3DAOA 1ULZA 3RF6A 4X54A 2LVBA 2ZCVA 3CVOA 1SXIA 3ASVA 2BLLA 1P4HA 3A27A 2AFHA 5SZHB 1T36A 1SXJC 3R0IA 1NP6A 2DBVO 3DUFB 4M54A 1FLNA 2ODEA 2ZIUB 3VSCA 3BJIC 5JPCA 1RXUA 1F8UA 3EBLA 3MJSA 1N6LA 1PR4A 1AUPA 4KYTA 1R64A 1MP0A 4BYGA 3Q3EA 2BFEB 2X8WA 2HA7A 2UZIR 1DCFA 4ROTA 1TZJA 3DOOA 3B1YA 1K89A 2G4LA 4K28A 3S27A 3C7CB 2H4YA 3FCAA 4HPXB 3JRXA 5ALHA 4N3BA 4KFSA 1NUUA 3PXGA 1C0LA 3EW9A 1KTIA 1E3QA 4XJSA 3WYNA 2XXAA 1ZIOA 2B1RA 2IYUA 2A0YA 3BZUA 4P31A 4FDLA 3UM9A 1A9ZA 4WY5A 2JVIA 2XOKD 5EN4A 3WAKA 4PINA 3E84A 1EBUA 4RV5A 4RZ3A 3MMXA 2QX7A 1YDHA 4LNUB 5D3ZA 5JXJA 3CNNA 5C37A 1RLMA 2QTZA 3IP7A 4C2BA 4MUEA 4C4YA 5LBTA 5HDBB 4F3KA 3L79A 5T4FA 1W30A 3P9YA 4EY6A 6GPBA 1R18A 2Z09A 1O54A 1L7AA 1QHFA 3JYHA 2UYHA 4HB0A 1ZM3A 3TX2A 1NVKA 3AL0C 1KK1A 1E3JA 1KAQA 3FJ1A 2XDAA 1E2MA 3ELUA 1NRWA 3AI3A 3U1TA 2EKLA 3O6VA 3L6CA 1UQTA 5JT1A 4R2IA 2H00A 4YREA 4X91A 4ZO8A 4DV0B 1OAKA 3GLIE 2KWIA 3A1FA 2E49A 1Q7CA 4G63A 3TO5A 3ZWWA 3ILXA 3OFSA 5GMOA 4GSYA 2EFCB 3EXEB 3O3CA 1UINA 1YBAA 1ORDA 2E1RA 2X0FA 1PUIA 1ZN7A 2GLTA 2VP9A 4YRNA 1PD0A 5JD5A 2VUUA 1D9XA 2H16A 2H1VA 1N6KA 5LZ2A 1ULAA 5IC4A 4TS1A 2H1IA 5IH7A 2AKAB 1WDKA 3RASA 5FP0A 1BFKA 1E58A 2B20A 1NVVQ 2WF9A 4JBGA 1KI9A 5JAHA 3ZN2A 5EJGA 4OJTA 1H8HA 4OOEA 4KH1A 4C0JA 5JCJA 4ZT7A 4BLTA 4V1CA 3HYTA 2NADA 3W9YA 3UMJA 1C9KA 2HRQA 3DWIA 1LA2A 2K87A 4HNGA 4PYIA 1HFJA 4ES6A 3GUUA 1L8XA 3K9WA 1NULA 3LUCA 2Y1EA 3EGCA 3M1AA 4IMIB 2W71A 3PPXA 4KMMA 4M7WA 3DCJA 1T0UA 3FOBA 3PUKA 4A9AA 1B6GA 2CDAA 3LW7A 3OU2A 1C3EA 1FFHA 4N03A 1IOZA 5IAEA 2QJWA 4MRRA 4WKCA 1ZISA 2M9MA 2Y4OA 1USUA 5F5XA 4HMQA 1GZ6A 2GBFA 2RGXA 2AZMA 3O4FA 4PQRA 3GJSA 5DRYA 2WVGA 1TMOA 5HKKA 2AOUA 3PJGA 1GTRA 1IN8A 1R37A 4RTNA 4DY6A 1PJLA 2QYOA 2JK0A 2CXQA 4LCBA 5DXJA 6AT1A 2WRZA 3CRNA 1DARA 4M89A 5AVTA 2XMSA 3TBKA 3RJZA 4O1MA 4CYMA 2XNJA 4HDNA 5TPWA 1IBKB 2ZZNA 4G41A 2O2GA 1Q77A 1E4EB 1ODCA 3IQEA 2E48A 3BL8A 4KDEA 1L5SA 3AG5A 3V97A 2JAOA 3E1KA 2GPAA 2O8DB 2O19A 4ABYA 1YIOA 1F3OA 1R5NA 3CW9A 2XF8A 3KKPA 2W6NA 2WHYA 3KCQA 4N12A 4Z6KA 1SB9A 4D46A 4QZVA 1BE0A 1ZNZA 3WGHA 4RQUA 2V7GA 3T95A 2BM9A 4EEXA 3QE9Y 1VMAA 1E9AA 3HKEB 3UATA 4Q5IA 4UNPA 1FF9A 3VJKA 5KBYA 4HH3C 5A03A 1Y8ZA 4Z53A 2WILA 3FYTA 1I4DD 1KHHA 2Y66A 2PZFA 2P0AA 5JOQA 1JHDA 1E4EA 4R2LA 1DBPA 1TQHA 1VKNA 3PUXA 3RM3A 4QSHA 2R6FA 3B7GA 3LT4A 3VO9A 4OQPA 2FR0A 1PF7E 1DQZA 4MQ6A 3PIDA 4P4TA 2FJUA 2OZPA 4YO8A 1RPNA 2OG2A 5AM4A 5EWMA 4PO1A 4PONA 1QLHA 5JH7F 4KUHA 5KS2A 2Z57A 2XQKA 5FAXA 1ZU5A 4U2BA 4EYEA 5L51A 4B9EA 2Q9CA 3GA5A 2GO7A 2G9VA 4NDNE 1EIWA 3M5DA 4HX5A 1A4RA 1Q7RA 4QUGA 2ORWA 1TUGA 1UDAA 3BK2A 4WOBA 3CINA 2QPOA 2XNHA 2R11A 2FE4A 3N58A 4YAWA 1OIXA 2W90A 4R2MA 3FCUB 1Y98A 1I0IA 1JEQB 1QTRA 5FOWA 3PEUA 3ZWBA 3A6PC 1G7SA 3H9GA 2CY0A 4IIXA 4D02A 2BMWA 2OO5A 5EKTA 3OECA 3GUHA 5J1TB 4XFDA 3CR3C 2R66A 2I3GA 1TB4A 1N2OA 4UBLA 3KB2A 5H80A 4JYAB 1KKUA 3NOQA 1FTNA 4Q7JB 3LUKA 1Y4AE 1CRLA 3MUOA 1PZMA 3D4OA 1QQAA 2ZI4A 4YB8A 2YW2A 1N1EA 1LPMA 1SR8A 1YZUA 1ZK4A 2I2WA 3GVXA 3K1JA 4Q18A 4ENUA 1O08A 3EEOA 1TT5A 1BW9A 2HLDD 2P9QA 5E1MA 3GCXA 1OFUA 4I1VA 1G3UA 2WUWE 3NJ8A 2VJMA 4JUIA 5CYPA 2P4SA 2RKWA 3TKYA 4DWVA 1SCUB 2P35A 1CRWG 2AUMA 5A9TA 1O96A 3DHWC 3U6KA 3K0EA 1AQUA 2GEDA 4Q3AA 1MPXA 2C07A 2JFPA 2P8JA 3OTIA 1P2TA 1IZ0A 5AK5A 5DNAA 1VC2A 3D6VA 5CJ2A 4E30A 2ZM5A 2FEPA 3H0CA 3TM5A 2XUOA 2W4MA 1PHRA 3FSGA 1CLUA 2GD2A 4PICA 4DBVO 3E81A 4U6QA 3FLBA 5DYGA 1N4DA 1ODSA 1T8YA 2B7LA 2OOSA 3HY4A 3QXJA 2VP6A 1R0BA 4CM3A 3OTQA 4HGNA 2LNDA 1J4AA 4LJ8A 4LXHA 2HU7A 2Q3EA 2COEA 5G40A 3TZHA 1G5HA 4DA7A 2DRIA 1VHLA 1LUAA 1WXWA 3LF2A 4YMHA 3BX1A 5EPUA 2G07A 2O0KA 2DB3A 1BQ3A 3HVKA 1QU3A 4N0MA 3KDPA 2NT3A 5ECYA 1ULBA 3CMMA 4IUDS 4RHXA 1P6QA 3BTUA 3GEDA 1NMXA 4L9AA 2XAAA 3IUNA 3QKSA 4PSKA 5JUWA 2VK2A 2ZJAA 1JJAA 3C98A 1IOWA 4KAFA 2DHRA 4X97A 5CEEA 3RAFC 1JU3A 3L4KA 3SXUB 2C54A 3F67A 3VUFA 1WU7A 2NUBA 5LD2B 3DBHB 4K9MA 4ZGGA 2JLVA 2ORIA 2VLBA 3ND9A 4YRSA 1X74A 5ALEA 3T7SA 5HKLA 3DYBA 1CVIA 3MG9A 4M1ZA 3BGIA 4Z4CA 1PR5A 2FEOA 1XTPA 2C03A 4COKA 1IBLB 3U7EB 5B3JA 4K9SA 1EDZA 3OA0A 1FIUA 3RC3A 2ILVA 4JLNA 5HCNA 2MINA 1EK2A 2JH3A 3I2FA 3HUFA 3O3MB 3NATA 1K2VN 2MJLA 3HWSA 5F9MA 1P1FA 2RCYA 4HR7A 1DX6A 3UQZA 4BZPA 2VTBA 1XRSB 2CFSA 3IESA 4DV6B 3SE0A 3QPUA 2NZXA 4N41A 1JYFA 1MUUA 4QXPA 1QS0B 2YASA 3BRWA 1YA8A 5CLGA 3RYHA 3TLGA 1CE8B 4Y1FA 2WU0A 4N82A 3ZDFA 4BNKA 3FHJA 1Y3FE 4OX9Y 4WE3A 1L7OA 3H42B 5DM4A 3KOZA 3Q7RA 1ZUWA 3E6AA 4AFNA 2PFKA 2WWHA 2X23A 2A58A 1NDUA 4GBMA 2YV4A 3QHQA 3QYJA 5FOQA 2DPHA 3K96A 4B4OA 1UKZA 4EPVA 4B3BA 1JGTA 3KJQA 4QFCA 3TLCA 1Y9JA 5BR1A 1IATA 2VDWA 2PZ8A 1WX1A 1Y9ZA 2PK3A 1Q3HA 1ZOSA 3L8FA 4IIEA 2OSVA 1W88A 5C3UA 2ACEA 3S5JA 1UPUA 4MZXA 2V5UA 5CB6A 2ZBVA 3C5VA 5H70A 1OFTA 3EVNA 3FGZA 3IT2A 3LY5A 4YJGA 5BV7A 1JQAA 1ESDA 2EKBA 2HSWA 4GLJA 3ZC3A 4E15A 1SG6A 1HL7A 2JJ2D 1APBA 1IPEA 2H54A 2QD3A 3TB6A 4NBSA 2ODNA 4LDPA 4ZVMA 1MOQA 4FCWA 3T15A 5DNWA 1DO8A 1IAVA 2Y4NA 1H5QA 4AS3A 2GXAA 5IUNC 1UIRA 1Z4NA 3N59A 4F72A 5JSZB 4KQEA 4MW4A 3L7CA 4INAA 5HIKA 1GAEO 4YRCA 4DQDA 1ZM7A 5JANA 2X7HA 1SQFA 2GD6A 4UUOA 2CD9A 1YR3A 1P3Y1 1GTMA 3W5HA 4X00A 3WLMA 1AZSC 2RHDA 5EMJA 4ZOEA 1CUAA 3KZXA 2D7CA 4WN3A 3U44A 3PGVA 3V8RA 3PQCA 2QTMA 3CUTA 1Y8QA 2FOXA 4LJLA 1QX4A 1A3CA 5AKLA 1ATIA 3BXHA 2HBZA 4KTTE 4RIIA 4AZ3B 1XX6A 2AN1A 3H5AA 1XTJA 3A2NA 3OMLA 3GRVA 4XVUA 3P1JA 1UEJA 3HH8A 1KZ1A 4KVGA 4BNNA 2XB8A 4JYMA 4MTLA 1HE4A 2YZNA 5HIIA 5HJ5A 5J4HA 4NU8X 5JI3E 1IEXA 3K94A 2QWXA 1FP1D 4X63A 3M5PA 3VO2A 4QQFA 3UAZA 3W2TA 4LMAA 2CE7A 3D6MA 3ER9A 4R9NA 4M83A 5E6UA 1UMDA 2GRUA 3R3WA 4ZQGA 3WL8A 2W2KA 1IBMB 2ZI7A 1NJ8A 5IX8A 5K05A 3FUTA 4E5PA 1NE7A 1AKYA 4F7WA 2J87A 1T5OA 1F5SA 3PBKA 1Z4QA 4Z4GA 3G17A 5EKXA 4PYMA 4Q4DA 1AK9A 5JSFA 2IOYA 2NU6A 2QB5A 4J49A 1H2WA 3A3NA 3E9NA 5KSWB 1MO2A 2WJWA 3BIXA 1BIFA 4Q82A 4BGIA 2GYVA 2QF7A 1T1RA 5GQSA 4BJ6A 4ZEVA 3C85A 3HDHA 5H82A 2X9VA 5AM1A 2W43A 3BTOA 1Y6GA 2I2BA 3A7EA 4II2A 2J0UB 2QVLA 2V65A 4D3FA 1RXIA 1ZGAA 4NIMA 1BDHA 4NMMA 5D84A 2YUTA 3EF1A 1OGIA 3P9KA 4IHQA 4JVOA 5ALGA 3RRNA 3N53A 2OECA 3QVGB 3DBRA 3DHNA 1BTOA 1H94A 1QP8A 1FL9A 4G5GA 3UVEA 3G5MA 2WKWA 3KYIB 2QL7A 4INPA 1OI7A 2YRWA 3E3OA 3L7NA 3TZKA 2ZSKA 1Z25A 1VPWA 1ZJYA 4DLYA 3RADC 3R9XB 3DF7A 4M1WA 5KX5A 3ZHBA 4Q4HB 1LBEA 1Q7TA 4E5MA 2WFAA 3EFHA 3NAZA 4Q3LA 4TT3A 2GK4A 3BMOA 1PFKA 1OZFA 3NHKA 4TZKA 4IHJA 2RDMA 3AXSA 4J0CA 3SMVA 3AVXA 2OCPA 2GCOB 1W73A 3I9OA 4P82A 2ATEA 4GXQA 2HQOA 1G8GA 2OGSA 5I5EA 5AVQA 2Q5IA 3THWA 1RRVA 4FFOA 3B5EA 4G5RA 1UOPA 3AZQA 4DSOA 1QBKC 3D3NA 2DHQA 2I7TA 4LJAA 4QTYA 3DTNA 3CKMA 5JDCA 4GS5A 2OXCA 3GLVA 4BRWA 3FA2A 3LCUA 1OKKD 2KB0A 3I9LA 4KG7A 5AMXA 1MHTA 5GOZA 1MDFA 3B9BA 1O97C 4MMZB 4O5AA 2HDWA 4AO8A 4B3IA 1IB0A 1QVAA 5HIJA 1QCCA 2BF4A 4MV3A 3RPEA 3QMPA 4Q3EA 5FUBA 2J0EA 3A3PA 1ZYUA 4I1PA 1IHOA 4DBLC 1WMSA 3AL3A 3PNQA 3DT6A 3F6SA 4Y8VA 3CM0A 1H5NA 2FDXA 2W6ZA 3ETNA 3MERA 5C34B 4ZGWA 2QAGC 1UJCA 4G1BA 4KQMA 1DXHA 2HQSA 1M1YE 2ZM6B 1DDGA 4CCYA 4EUHA 2TMYA 3M6UA 4DMUB 3OIGA 4CMBA 1XVUA 3Q41A 1HZZC 3BGOS 3HJTA 2KMLA 1BXZA 3FMPB 2H7XA 5IJ0A 5JS6A 3B6EA 2QMOA 4Y9SA 3DL4A 1T1SA 1R50A 3VV3A 1F2UB 5CFLA 1CR0A 1QDLB 2JRLA 3PQEA 4HAYA 1A4IA 3GJYA 3H6HA 2FOLA 3L1HA 4P6VF 5LP6F 1JEYA 4JI3B 2ZSEA 4BNVA 1NX6A 3U48A 4RETA 2JK1A 3DNPA 4FKMA 2ZRHA 4H7FA 4O4JB 2V97A 3ZK8A 2JHCA 3OSZA 4XSHA 4DYDA 1Q3TA 1YQUA 3B2QA 1MO4A 4JUBA 4PZUA 1J56A 2VL7A 1HT3A 3IEXA 1N8KA 4KJXA 1IY9A 1C5KA 4MQ5A 4PZAA 4WA7A 4NECA 1Z6PA 2BONA 3AR9A 3I5UA 4Q9DA 1NA5A 2EFEB 4TGLA 5DASA 5WRFA 2VRNA 4R68A 1I7LA 3A0UA 4LTDA 3ANMA 4KQWA 2R68A 2BEWB 2BP7A 1ZVQA 2BTOA 3ILYA 1RE0A 1AS3A 2HO4A 3EMVA 4JFAA 1K5HA 4PNZA 3SHFA 3UENA 3B78A 3RJMA 2I33A 5DK6A 3ZUGA 4B48A 2WZQA 2PKXA 2WSYB 1FYEA 3UC5A 2JVKA 4MVJP 2LZ0A 5LIRA 4D4HA 2WFLA 2GHQA 1KR5A 4LMRA 4J90A 1FTYA 1L4LA 1Z56C 3DEJA 3GLQA 3ORRA 3ORQA 4TMKA 4OD0A 3QU7A 4FEAA 1VBNA 1F4LA 2QQFA 2GDZA 4Q3BA 2M6KA 4L6CA 4ND2A 5F9FA 1CUYA 4AMUA 2IZZA 2Q46A 4LYYA 5COQA 4EMSA 5FI5A 3PD0A 5ECGC 3Q85A 5HVNA 4JLBA 2RBEA 2LD4A 3K1AA 1N5RA 4K9LA 3IUSA 1P8AA 1E2DA 1O0BA 2QAGA 3C5EA 1DIHA 3O93A 4AP5A 5EHIA 2YJNA 1KBQA 1LZKA 2RAPA 1V9CA 3MWJA 1RE1A 4EKDA 2QT9A 4INOA 1PL7A 2ATXA 3F49S 5CDYA 4K6MA 5EQFA 1OGYA 3C6QA 1U94A 4Y6SA 4YTEA 5GVRA 4AJ2A 3I28A 4H77A 3C6XA 5IDQA 1IBCA 1HFKA 2E82A 2DWUA 3DKKA 3HVJA 1ST2A 3GLUA 2ZS7A 3IJEB 4ZREA 4Q6WA 4ZWNA 4DREA 3VYVA 4FFSA 1ZNYA 1CHNA 1RMQA 1XCPA 2PZAA 3FUWA 1SG0A 1T4MA 2V7PA 3KPJA 3EDQA 1FDIA 5E7IA 2L42A 1QVWA 4QYIA 5JAOA 5JCOA 1V9LA 1U5BB 3LNTA 1YDWA 2OV8A 3A05A 4L4YA 4ZKEA 1FYVA 2IZ0A 5AQ1A 3BMNA 4RE5A 4IFEA 3U4GA 2KPOA 3KXLA 1W5AA 1X13A 3PQ2A 4XLTA 3GJ8A 3ZNPA 4MITA 1GTG1 3CO0S 3NHYA 4KUGA 1U7XA 1KMCA 5KO2A 1F0KA 1B15A 1N2SA 1QVZA 2NXJA 3JQPA 4LHVA 1V11B 5K0LA 3H4TA 5AW4A 3WGIA 5DP1A 1P5RA 3BEOA 5K6TA 1JFFA 5CVVA 5AVWA 2E4YA 4Y6PA 3MTBA 1O1YA 4N6GA 2ZWAA 4CBVA 1FEZA 3WKBA 3OZIA 1PCXA 3HUTA 1JHMA 4HNAA 1YC5A 4CIVA 4D5EA 5EJMA 5JMPA 4D3SA 2V0CA 2X5XA 3DCIA 4M22A 4N3AA 1WW3A 2V4UA 3GK3A 4M8IA 2ZWIA 2I7CA 2YMQA 3E70C 2X8JB 4P93A 4WN9A 1AV7A 2ZIGA 4CCAA 4EGQA 3KYJB 2B3DA 5DFAA 3HPRA 4UNNA 5YASA 3WSWA 4EDFA 1CB0A 2Q6TA 3UXHA 2H08A 2Y6VA 4ZXFA 4BJ5A 3BH7A 3I8SA 2ZWMA 3OMXA 1P2FA 5C46F 4NBLA 5KU1A 1JG4A 3L4BC 4FEEA 1P0PA 1B74A 8ABPA 5LWHA 3CLHA 3QVMA 3AUKA 4DXHA 1KIFA 2JDID 1BOFA 3F8TA 5IXSA 3SK0A 1IUPA 2VCYA 4Z1MD 4GRDA 2XRMA 3ZJ5A 1TK3A 3INNA 3OCVA 5EIBD 4QEDA 3FPFA 5D3KA 1VSTA 1REQA 5GJBA 2LPMA 5K6AC 4LXYA 3OOSA 4UQLA 2I4OA 3VSAA 4OXNA 4M1MA 5FEMA 1K6IA 5FCDA 2ECOA 1N6PA 1P8JA 5LMNB 5JLAA 2ZAGA 1DC5A 2WOJA 1C9DB 1Q0ZA 1YQEA 2DWPA 1WP4A 3JSAA 1H9CA 5I4IA 1B3BA 1AGYA 2XNDA 5TQJA 4HWGA 5TPZD 6CHYA 2O8EB 4UMEA 4FIZA 1PJRA 2VWHA 4XIIA 3U9LA 2FMIA 1QRTA 1JYSA 3KEFA 2QN2A 3BZBA 5EJEA 4BV8A 1HT0A 5HFAA 2VQEB 1FU8A 1SUDA 1FX1A 1I24A 1QE5A 3FWYA 3OE5A 2E55A 2DWCA 5FTJA 2PANA 5ALVA 4C2TA 3EXIB 3MEQA 2VHEA 1P2VA 1HV8A 1NATA 3CUEF 2IJGX 3RRYA 4PG8A 4O2BA 3T5CA 2GZHA 3H83A 3O94A 3V7FA 3O84A 4UBKA 1DP4A 4GMHA 3INRA 3P0FA 1WB9A 3DTVA 4FQ5A 5GONA 2ZRDA 1NVTA 3A6HA 2XUIA 2X2EA 3KAKA 3IPLA 3WSVA 3DBVO 5LR6A 1UEIA 3D81A 13PKA 2GN1A 4B6OA 1X9HA 3BM5A 1MGPA 2Q5QA 4GYJA 3D7RA 3TRJA 5KC8A 2HHLA 4V2UA 3A36A 4CM7A 4E2XA 2OZLA 1CJSA 2KI5A 4MQLA 1OYYA 3C3KA 3ZR4B 2VJYA 4W8HA 1XZGA 2P5UA 4I08A 4OY3A 4HYYA 3FPHA 1ODTC 1C1DA 1I01A 4GC9A 4FDTA 3NEPX 2RB4A 1SVIA 3DAYA 4OAOA 2FR8A 4HFMA 4X7RA 5FPTA 3TZ6A 5HX7A 3TGLA 5GADl 2BCEA 1L4NA 5F76A 3E7FA 4OJQA 5JY6A 1NM5C 1LVGA 2V7QD 2SBTA 1N3IA 4W7SA 2ZAMA 4F6RB 1NI4B 2RBKA 4MCHA 3H5VA 1YTLA 2FCRA 2D6FA 4AYTA 1VCNA 2QR5A 4TZ0A 1N4AA 3IDQA 2DG2A 4C05A 4G2NA 5KTTA 5IJWA 5CTJA 3NMUF 3IAM1 1II8B 2VTKA 5HE9A 3E3MA 2UKDA 3OOHA 1XMJA 2UDPA 4P0PB 4XDYA 1F38A 3EEFA 3FWHA 1XRRA 4FONA 3PKJA 1U11A 1XALA 3UV7A 3NDPA 3WXBA 3V6LA 4MQUA 3DF9A 2GOYA 3OHSX 2H85A 5I7SA 1KFEB 2Q8PA 1KQPA 2ZRKA 4LZNA 1ULSA 2PAAA 4R1TA 1H5UA 2A33A 3ZU2A 3VO8A 4AJOA 4BQSA 3DL7A 4CCSA 4D81A 1TVKB 1K97A 2D3TA 1Y80A 2H63A 2JHAA 2O7NA 2RHJA 3LRTA 4GXTA 4MS4A 5DYNA 4OQLA 4EVQA 1T5HX 1PD1A 4I9NA 4JX9A 2H2AA 3D6JA 1A95A 3ZU6A 2OXFA 1K6JA 3FWZA 4NU5A 1F12A 2R9VA 2GPYA 1NVDA 1GPYA 2O1SA 3CNBA 3QKWA 3ZCVA 2D8MA 2FUCA 4CQNA 2IX3A 1OWOA 1PRYA 2RD2A 1UJ4A 5CH3A 2I80A 1X2BA 5DLPA 3RVLA 3TR6A 3IP8A 2OTCA 4V39A 4B0OA 2JZNA 5A05A 2V7XA 4CTJA 4QNNA 4GKKB 4X8OA 1CNMA 3H8VA 1SXJB 1VL5A 4JJIA 5PGMA 3VZPA 4B35A 3N8KA 4WK6A 1EJ2A 4J91A 4DZTA 1QFJA 3PFWO 5C7YA 5DKFA 3SKVA 4YYEA 1AF7A 4MUNA 4KSBA 3AFGA 2ZIVB 5EP3A 5H3HA 2QW0X 1GKKA 1XN1A 3P45A 4W6ZA 3K20A 3L82B 3N2LA 2NZ2A 2WG2A 4EATA 1JHVA 3B2NA 3FCCA 2AT1A 3CLUC 4XQ9A 1G9SA 2RB5A 1JDBB 4FFBA 2JJMA 1CXZA 4ZI7B 4WRRA 3T7KA 4FHEA 2CCGA 1MXHA 3SMQA 5FPKA 3H1GA 3K0HA 1T4BA 4BFVA 3HSSA 3MJCA 3ML1A 2WJZB 3ADCA 4XJXA 3AMVA 4YJFA 3T1NA 1XA0A 2ZRFA 4RIFA 3TQCA 4FT2A 1UPTA 4A0RA 1QK3A 2V8BA 1PJTA 4GOOD 2PPLA 5KWVA 2Y1GA 3FNRA 2VQFB 4NOLA 4Z0PA 2QEQA 1P7PA 3PF9A 1UJ2A 2VHWA 1C30B 2ZJ0A 4A36A 3EK2A 4WTOA 5BPFA 2HWUA 3ZS8A 2AQKA 4J76A 4R84A 3G02A 3KHSA 3K5IA 3NS7A 2ONYA 5DLQC 3CSSA 3RTEA 1JLHA 1GVNB 3ENKA 3O75A 3TI9A 1I5OA 1QKKA 3W6OA 1QM5A 5EHNA 1OIWA 1D07A 2RHHA 3H13A 5EZ6B 1H3EA 4K88A 3OU7A 3MJHA 1Q1ZA 1VECA 4PZPA 3KB6A 4R9UC 4RLQA 3WB0A 1HURA 4D4JA 2X1LA 3ZH2A 2OWDA 4L5AA 2FPRA 3I58A 4R98A 5J5CA 3TPCA 3ZXXA 1M2VB 3E2PA 5CBPB 2QX6A 2I8LA 2D62A 4O02B 4P22A 1KQFA 1DG9A 3DEFA 5DF1A 3VJRA 1Q0TA 2J6HA 1C30A 1XKLA 3GCGA 4CV3A 3LKBA 3RRJA 4Z49A 2Q45A 4O2BF 1NASA 2FSFA 4E5DA 4TWRA 4MMYB 1Q6ZA 4UHKA 2C5SA 2V54A 2P30A 3IOCA 1QX3A 5AKZA 1MJHA 3QOFA 3VHQA 4D8YA 3K92A 4AMZA 3ROFA 1GG9A 4ZPJA 5BN5A 1O95A 2PFSA 2WJGA 3ACDA 2H2HA 3WYAA 4D9CA 3IALA 1UP7A 3KJXA 3FVTA 4BFCA 4HQNA 4TQGA 4O0LA 3ETLA 1ISMA 4JXKA 3FPBA 1Z5WA 4PHGA 2ATCA 3G9XA 1LDMA 2PX3A 7MHTA 1MVLA 1V43A 4HX2A 3V55A 3RFUA 4Q9AA 3ITEA 5B4TA 3UUGA 3CJRA 5CM9C 3RJ9A 5LOVF 4OAPA 5K3FA 5BMVF 2XDQB 4QVKA 2V9CA 5HPYB 5ALSA 5HM8A 3ZY5A 4C29A 3DHVA 2AC2A 5K3OA 3WLFA 1T9CA 1Z0DA 4NATA 4TWJA 3Q5EA 1DV1A 1RFGE 1CKEA 2C5BA 1DTWA 1M6WA 3KUUA 2DY1A 4P81A 4ZXPA 3ICOA 1Z5VA 1HYEA 2V4ZA 1EUCA 3F6EX 3KR2A 3NBXX 5TVKA 2O7VA 3T7DA 3TX6A 1Q0RA 2VEOA 5T8KC 4C7XA 2F3UA 3WL6A 1BKSB 3E7PA 2WAOA 3LCCA 2FYTA 1I1QB 5TEWA 3RUCA 2QRMA 4ZOLB 1XU4A 1R0YA 3P7MA 4C5AA 3NT2A 2Z8YM 3R8CA 3A4VA 4L5CA 4UKDA 1CJTC 2XVYA 2O8CA 1SD5A 1ZN2A 1GL3A 2JAHA 2G0NA 2VSFA 3CONA 4ZVSA 1SHLA 3EXFA 4PC1A 2R48A 2IYRA 3T12A 3UXMA 3AESB 5C4MA 1HLPA 3A4IA 2ZOSA 2QOEA 2WINI 4Z3KA 2VXOA 5I9SA 3DCNA 1XZFA 2DBQA 3GP3A 1LI4A 3NRCA 2X0EA 3TQTA 2GAJA 3OZVA 3D6TB 3EGXB 2YOFA 3HDJA 1GM5A 2AQHA 2E3JA 4OQQA 5IM5A 5HRUA 3W1WA 3F5QA 1Y1QA 1QORA 2W0MA 2H59A 2Q50A 2O1XA 1OXVA 1ZS9A 4OQXA 5JSHA 1DEAA 1Y3AA 4CM8B 1XELA 5KKCA 1OB2A 2Z30A 4EF6A 1KO1A 2R8RA 3GZNB 4DLXA 2PJUA 2JFVA 2VPPA 4CDMA 2I34A 5DTQA 4D9NA 5MFZA 1OYWA 1ZCBA 1NIPA 2C2GA 2GI4A 3MQ2A 3GLKA 4PC6A 1H2ZA 4R5MA 2FEWB 2QP3A 4DJEC 3EXFB 3FUUA 1V6SA 3GGPA 4D4MA 3JQ9C 3SYLA 2GBGA 5LIPA 2SHKA 4FW9A 4GLBA 3VSEA 3G0DA 5A71A 4R2JA 3W5IA 4BWYA 2BI7A 3KHUA 3G68A 2JD2A 2BTQB 3K2BA 3AIMA 4F4FA 3DZ8A 1W36B 4KPUB 1XTSA 1SJ9A 2HO5A 3VTKA 3QMVA 1X77A 1J20A 1RNLA 1FDTA 3GXBA 1NLUA 2GETA 5AIBA 4G37A 2F9MA 4GX1A 4RKEA 4M0EA 4Z8YA 1US8B 3O82A 4XD7A 3WV4A 1NF9A 1JALA 2FFRA 4ND5A 2FV8A 2AR7A 1T5DX 1FJGB 3NKVA 5EFZA 4UM7A 2FRVA 3FN4A 3EDMA 1A9TA 2QRZA 2XZTA 3PHJA 5ALMA 1KIAA 2PCLA 5HS4A 2MSNA 3COVA 3A2MA 4G8CA 2R79A 1KEZA 1DLIA 4C4RA 3ZI7A 4V0RA 3BFXA 5ARBA 3OQMA 4UBIA 1FNDA 3EHEA 1PJSA 4CNBA 1K5GA 1IOLA 3HY6A 4O2AB 3G0IA 5FTLA 1NF3A 2B35A 2XT0A 2G5PA 1R3UA 3BE5A 2IXAA 2HADA 4D97A 3NB0A 4G5XA 2C8KA 2FHPA 2CJPA 1U63A 4Y98A 1F1JA 2OLJA 2QNBA 3O7WA 4HYTA 5JCZA 1HDRA 3M6XA 4EECA 2PLAA 2UV8A 4HQFA 2WD7A 2WYIA 4KV9A 4LQCA 3OEED 4B7ZA 4EUFA 2AWOA 3EZ2A 3GEHA 3H19A 5HCIA 1DUVG 3IIMA 3VHLB 3HCNA 4M9XA 4KU4A 1K06A 4Q47A 2AXQA 4EGAA 3TRIA 2FZWA 5BRNA 1I80A 5B2FA 3PC8C 2JB9A 2IZ5A 1NVBA 1SUEA 3KQOA 4Q37A 5EKUA 3FVVA 1B42A 4JL6A 1QPZA 2YN0A 3KZNA 1S2NA 2CZQA 2JCYA 4KQIA 4GUDA 4YUWA 1EFAA 2FP4B 2RGUA 3W4IA 5J2UA 4B6PA 1BHQ1 4NJMB 3DXFA 5L95A 1U0NA 4AXBA 4U7DA 1CRPA 2J32A 5GIOE 3PA8A 2HQRA 3W8FA 5AHWA 3TZQA 3PYLA 4H4DA 3RNLA 4ACAA 4UPEA 3SZMA 3KBBA 4ZGBA 3I30X 2I4TA 2C7OA 1B7GO 1J21A 1U9CA 1Z17A 4NJEA 5TPWB 2AE2A 4ONEA 1DXYA 1K8QA 1FUIA 3ZY4A 4ARCA 3UJNA 1G8HA 5BUQA 1HDZA 4KMSA 3OCJA 2HSZA 3OX4A 3ZGVA 3STUA 1Z33A 3E5HA 2WG0A 4U2GA 5DTMA 3IOMA 3OEWA 4QPJC 2BSAA 2ZSDA 4UHCA 2AEFA 2AVDA 5EHQA 3T7IA 3WHKA 3I2YX 4BLVA 1E5TA 5B4VA 3G1WA 1KZ4A 1DBVO 1YRAA 4MW2A 1MB3A 1X2EA 3GGGA 4R01A 4CQMD 4F93B 3DUWA 5ALDA 1Q95A 1M83A 4ENRA 3YASA 1RWPA 4IDPA 4IXTA 3MSXA 3G79A 3KJNA 4BMVA 3SS7X 5F2KA 2GN4A 4M0FA 2NSHA 4D25A 2BGJA 2O2HA 2EARA 2XA9A 4HB3A 5E2IA 3KT8A 1X7XA 4B7AA 4CF5A 3Q7EA 4W5OA 3JD1A 1J00A 5KHAA 4MQFA 3KK0A 2ZROA 3M4JA 1TZKA 1QGDA 2C20A 3BBLA 3RFVA 4CPDA 4UBNA 3H11B 1HBJA 4KN6A 1IUOA 4K9RA 3AM5A 3ZE0B 5A3JA 1UDCA 2BZSA 4H17A 1DAFA 1U3GA 1XMOB 2DETA 2WU4A 3GLIA 4DCNA 4NNJA 5TARA 2VYVD 2F8TA 5KCMA 3L4SO 3JQAD 4KBGA 3VOBA 5CITA 1LBSA 2IOQA 5FHQA 2WB2A 3D5EA 2NYVA 4GYKA 5IVHA 4KZPA 1YVPA 3JD4A 4TKUA 5LZ8A 1B14A 1E1NA 1V4BA 3HV0A 4PEVA 4RMHA 4DM7A 5B7NA 2Q6OA 2X0JA 4MQBA 1VLVA 4RBNA 3STTA 3ZWDA 4A5OA 5K3EA 3SX4A 4DUPA 4LI0A 2G1JA 3G0CA 3RTCA 2QU8A 5LP6A 3IR5A 4OO3A 3D7MA 3TRDA 3MJEA 3UOGA 1UT8A 1NJFA 4C0AC 4ZKDA 1NLMA 3RK1A 2E4AA 5DB4A 1TZ2A 3L0CA 1CT9A 1NBMD 1EUCB 1YB7A 2DHCA 4E94A 3ET5A 1COWA 1O0CA 4I50A 5IM4A 3TMAA 3WGVA 1KPGA 3PD1A 1TPZA 2AJDA 2R1TB 5L3RA 1D2EA 2FE1A 3JWPA 1ITZA 4FHFA 5CX1A 1JVBA 1E79A 1I14A 2YZ2A 3QHAA 4P4NA 5B1EA 1EBFA 1V7QA 3EXHC 5KQLA 4AUNA 2YC2C 3D8TA 4DQXA 1H65A 1HSZA 1K08A 1TJ5A 3AY7A 3IGFA 3S1AB 2HSDA 3JARB 2C4UA 4KQFA 4OB6A 1HDEA 5FTNA 3ADDA 2VJCA 1R9GA 5T41A 4BV2A 4EVRA 2HGZA 1KI7A 2XNSA 1ABBA 1HI9A 4F9TA 4YWJA 1FS4A 3G2NA 3NM4A 1KE1A 2YOGA 2X1HA 5EQJB 3KTAB 4FYWA 2AMJA 3O91A 1TYAE 1UBGA 3VH1A 4E03A 3SEQA 1C4WA 5KJEA 3LUBA 1UKBA 3UMVA 4BASA 4OHVA 3EQ8A 3C4JA 3RU9A 5GM1A 1PG5A 3PWKA 4FQ8A 4ENPA 4MWBA 3GZNA 4YQYA 2JH9A 3H04A 4NZNA 1BD4A 5EWLB 3VSDA 1AGPA 4WAUA 4KI7A 1UBMS 1K8YB 1RWBA 1FXUA 1X38A 4AJLA 4DEVA 1JE1A 3ODPA 3C6BA 3L9XA 1FB5A 5G2OA 1FZQA 4HQOA 3BDVA 2DVMA 4LF4B 4V3CA 4KWEA 1BRTA 1NNLA 1T8UA 2VDRB 2HIHA 2PUJA 4LJ6A 4R1UA 2RAVA 2YCLA 3RV4A 4BNXA 4FKBA 1KEWA 4Q1DA 3FKSA 3I2IA 1GGMA 1Z5ZA 4ZI3A 3BUSA 4CKCA 3G0GA 1NY5A 1ONOA 1U8EA 1W5BA 1L5FA 2CWDA 2OT3B 3A1WA 3LD9A 4MR7B 3AUFA 1Q20A 3FB1A 4P7BA 1CIJA 4PIPA 4Q0MA 4QGAA 4UAUA 4YXWA 5BXQC 4D1YA 4KFCA 5A0TA 2JI9A 3LHSA 4TTQA 2PXXA 3DM5A 1B6TA 1EFUA 1ADFA 1V95A 4TMWA 4F4HA 2AKYA 4K9NA 3Q2OA 2XXAB 4YC7A 2IYAA 1WQ1R 2ZBPA 3VPAA 4GGMX 2WIBA 2JNWA 2B30A 4G4JA 2BRUC 3ZE6A 4CTMA 2HSGA 3FHLA 4H15A 5JH7A 2PNFA 4ALJA 3FFWA 4JC8A 2PH1A 4HRYA 1TK2A 1LVHA 4YAKA 1B8NA 4MVJH 3GPLA 3FNFA 1WLSA 2IPOA 1Y81A 4K46A 4BB6A 1SXJE 4MX8A 3ACCA 4G1FA 2Q5EA 1ZMRA 1UK8A 4J1SA 3RVQA 4A8TA 2QY6A 3WGUA 3S70A 4X93A 2VQDA 2BHRA 3LP8A 2XT6A 4LFBB 4A27A 2ZB4A 4D0LB 4IJQA 1DT3A 2G7MC 4BKUA 5AVYA 4DFDA 1NQWA 2GO1A 2NUTB 1R6TA 1RYZA 3ZCSA 1BMTA 2B5OA 2RIRA 4BLPA 4EKNB 3CRMA 4BYMA 4U2FA 2B3TA 4D44A 1N2CE 3W9UA 4FFVA 1B3RA 1MAHA 5IZCC 3LSTA 4CM6A 4AF7A 3E9DA 1INLA 1OLUB 2TMDA 1OWPA 2WMDA 3LBNA 4RSHA 3CX4A 3KKEA 3NXSA 3DEAA 3LA8A 1EU1A 4YFYA 1QH8A 2C1EA 1K3TA 4MP3A 5CT5A 2BM1A 2O5VA 3GN2A 3KEQA 5CT4A 4BO2A 5AVSA 5IDXA 3ZJUA 1Z6GA 2H5LA 1PHPA 3EXAA 4RGQA 4M46A 4W9NA 5C8YA 5C7IO 6REQB 2BFBB 5DX8A 5B57C 3HJHA 4L4XA 4JI7B 2WYWA 4NQZA 2Y9PB 3X1JA 2VAWA 4UZSA 1LLCA 1WCYA 2P62A 5G0VA 3QBEA 1NKSA 3W34A 4RCYA 1WEHA 1B73A 1R12A 4L5BA 3TLAA 4KHPB 5LB4A 3HBJA 1NMZA 1QG0A 2J09A 4Q4CA 1ZL2A 1DC4A 5C1BA 1MB2A 4UHHA 1EI9A 1I32A 5I01A 2NYRA 4HMOA 4G25A 2O5EA 1KSJA 2BGNA 5F3WB 2OCKA 4Y1GA 4LFAB 3SLRA 4E7PA 3N2YA 1VZ2A 1VCOA 2OYSA 4OGFA 1A69A 2RGGA 4RPIA 4ICIA 4ZO6A 3R74A 2REQA 2E4VA 2FMFA 4FYPA 4NPCA 4D4LA 5EFOA 2R00C 1W6RA 1KAGA 4TV8A 1M5TA 1K88A 4ZYTA 1D4AA 1SVUA 4N5DA 3EQZA 3L0YA 2YZKA 5DZSA 5FX2A 4HH4A 2QRGA 2BVNA 1W88B 4PY2A 1NJ1A 3KOUA 2QR2A 3VHXB 3JWGA 2V6IA 2AEEA 4HDNB 4J7CA 4OQMA 2RKOA 2NX2A 4PNHA 1NXSA 4K8RB 3UMBA 1E0DA 3M0EA 4BTLA 5MN5A 2VF8A 4C6RA 2Z0MA 2PKYX 1U2GA 3CHYA 1H85A 3LFHA 3V1TC 4MR8A 4B44A 1N2BA 2V6JA 3NG1A 3V1KA 1XWFA 2GEVA 4W5RA 4FZJA 3F96A 1S4QA 3OY2A 3ZXSA 1B23P 1Q15A 1USGA 1PSWA 1PV1A 2REQB 3HN7A 1FC0A 3PSAA 3UCFA 3OJXA 3KWMA 4Y9UA 3UT5B 5HK8A 2H31A 4TV8B 1WWKA 3RUDA 2YL2A 1MQ8B 1JLLA 5IARA 1R16A 4WLFA 1EEXB 1OVGA 3LIPA 5G41A 3U7JA 4L7QA 2NZVG 1UFOA 3GD5A 3LPLA 3NRBA 1E2QA 5KJ6A 4LRUA 4XUCA 4YRJA 3UK7A 2CKMA 2ZYGA 1ZXBA 2JD0A 4PHTA 4Q1CA 4RYLA 1SUAA 5ALIA 5EXPA 3AOGA 3T0GA 4R1NA 2IV3A 4EFDA 2AEMA 4KH0A 2Z4SA 3COSA 4KXYA 4PC3A 4R9SA 5K4AA 1XVLA 1RAHA 4KN9S 5LP6B 3DOIA 1ISHA 1ULTA 3GRRA 5BQFA 1RZRA 4YUAA 3A6GA 2QG4A 4G0ZA 4LZAA 1QH9A 4P83A 3HDGA 3H5OA 5KTRA 3VR4H 4KLAA 3UT5A 5EMMA 3NHMA 3BJRA 2ZB2A 1GFWA 5E95A 5DDIP 2FW7A 4F5ZA 2RGWA 1RM3A 1GRCA 2DH6A 3KYCA 3WOVA 4C08A 2V4MA 5LFAA 1JILA 3HJRA 4LF7B 4NFHA 4Y6LA 4P34A 1YZYA 4AX8A 5GINE 2VHTA 1A8SA 4A16A 2X4DA 3PV0A 3V8BA 1UR5A 3UEOA 4MHOA 1R88A 1AO0A 8ATCA 1BS2A 1PYOA 4X7BA 2HJ9A 3IB3A 4C0XA 3MYYA 4K26A 4GVLA 2WF7A 3ZXIA 1HNXB 1N2IA 2XQGA 4G0PA 3SJBA 3LL7A 5GZ3A