1SK9A

Crystallographic snapshots of aspergillus fumigatus phytase revealing its enzymatic dynamics
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
435
structure length
435
Chain Sequence
CDTVDLGYQCSPATSHLWGQYSPFFSLEDELSVSSKLPKDCRITLVQVLSRHGARYPTSSKSKKYKKLVTAIQANATDFKGKFAFLKTYNYTLGADDLTPFGEQQLVNSGIKFYQRYKALARSVVPFIRASGSDRVIASGEKFIEGFQQAKLADPGATNRAAPAISVIIPESETFNNTLDHGVCTKFEASQLGDEVAANFTALFAPDIRARAEKHLPGVTLTDEDVVSLMDMCSFDTVARTSDASQLSPFCQLFTHNEWKKYNYLQSLGKYYGYGAGNPLGPAQGIGFTNELIARLTRSPVQDHTSTNSTLVSNPATFPLNATMYVDFSHDNSMVSIFFALGLYNGTEPLSRTSVESAKELDGYSASWVVPFGARAYFETMQCKSEKEPLVRALINDRVVPLHGCDVDKLGRCKLNDFVKGLSWARSGGNWGECF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystallographic Snapshots of Aspergillus fumigatus Phytase, Revealing Its Enzymatic Dynamics
pubmed doi rcsb
source organism Aspergillus fumigatus
molecule tags Hydrolase
molecule keywords 3-phytase A
total genus 153
structure length 435
sequence length 435
ec nomenclature ec 3.1.3.8: 3-phytase.
pdb deposition date 2004-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00328 His_Phos_2 Histidine phosphatase superfamily (branch 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 1sk9A01
1SK8A 1UJBA 2HPAA 1T8PA 4QIHA 3QPWA 2RFLA 3MXOA 1FBTA 2YN2A 3FJYA 5HR5A 2HIAA 1IHPA 1V7QA 1RPTA 2H4ZA 3KKKA 3MBKA 4E3WA 4ARUA 4ARSA 2ENWA 2P77A 3IT3A 1BIFA 1RIIA 3GP5A 2EKBA 1UJCA 1YJXA 1FZTA 1C81A 1E58A 1ND5A 1RPAA 2QNIA 4FDUA 1QWOA 3R7AA 1EBBA 1CVIA 4JODA 3ZHCA 1DKNA 3K4PA 3BIFA 3LNTA 3LL4A 2P79A 3DCYA 2EOAA 2DWOA 2A9JA 3E9CA 3D6AA 2PA0A 2YN0A 4IJ5A 2P75A 2P78A 1H2EA 3EOZA 4FDTA 1SK9A 2EKZA 2BIFA 1BQ3A 3E9EA 3IT2A 1SKBA 3GP3A 3QPUA 3D4IA 4GPIB 4TSRA 2P30A 1E59A 5CDHA 3C7TA 1XQ9A 2H52A 4HBZA 4IJ6A 2HHJA 2ENUA 1C7ZA 3FDZA 2P6MA 1C80A 4GPZA 2OWEA 4D4LA 3IT0A 1DKQA 3DB1A 5AJYA 3HJGA 1DKPA 3NFYA 4ARVA 1YFKA 3E9DA 2P2ZA 2A6PA 3F3KA 4D4KA 4MA4A 3FDZB 4JOCA 2H4XA 1ND6A 2P9YA 5CU7A 3OI7A 4AROA 4PGMA 1SKAA 1TIPA 3NTLA 4EO9A 2WNIA 4D4MA 1H2FA 2WNHA 2WU0A 1V37A 3PGMA 3LG2A 1DKOA 1K6MA 3D8HA 5HTKA 4EMBA 2F90A 2P9FA 4PZ9A 1DKMA 5AK0A 3QPVA 1DKLA 2IKQA 2AXNA 2P2YA 2P6OA 5AJWA 2GFIA 3K4QA 5AJXA 2OWDA 3IT1A 2P9ZA 3EZNA 1QFXA 2H0QA 4ODIA 2I1VB 3O0TA 4D4JA 1NT4A 3GW8A 3F2IA 4PZAA 1QHFA 5AJVB 2DWPA 5AJZA 1BQ4A 5PGMA 5CX4A 4JOBA
chains in the Genus database with same CATH superfamily
1BVRA 2B83A 2GA9A 3KFXA 3O74A 1ZD5A 2HIHA 4V03A 2C3PA 2B5VA 3OOHA 4BQQA 4CKBA 4U6QA 4RH0A 3E53A 4EUSA 5A62A 1Z4QA 2VDUE 3U4QA 3HJFA 4QXQA 3Q72A 3QEKA 2NPOA 3SSOA 1UC9A 2F2TA 3K8QA 4BVEA 4V24A 3QOWA 3VPHA 4FGUA 5BQ3A 1H3FA 1VHLA 1P7YA 4G5YA 3T3PB 1A77A 1YT5A 10MHA 1XZQA 1JPUA 2I80A 3EEIA 3LT1A 1VG0B 5I6DA 2XWPA 1PU2A 1UBGA 2VNJA 4RE6A 5IVIA 3IEXA 4JENA 2AOVA 4UNIA 4YBRA 1EP1B 3U48A 1BIFA 4AM8A 4JBGA 4K88A 1SXIA 4ZI7F 5I4BA 5DBFA 1P2GA 3H8WA 2M1ZA 5ICFA 2V74B 5BW8A 2B78A 1QYCA 3HP1A 1U0TA 5JCZA 1Y9JA 1QAOA 4GQAA 1YACA 4BUZA 2Y68A 5IBCA 1IBLB 3LX8A 4MS3A 3D4BA 3FOFC 2XXBA 3QNUA 2FMUA 3AQIA 1MB2A 1ES9A 1T2EA 2BR4A 1EFVB 3IRVA 3VMFA 1MU0A 1RMQA 4QOJA 1ZHHA 1E6EA 3RASA 4S24A 4AZ3A 4GM1A 1ZESA 4IQ4A 4WERA 2ZRIA 1WMEA 4UUOA 2BTOA 3B9RA 2O06A 3DTVD 3COJA 2GSWA 2Y76A 5CGZA 4F91B 3EXFB 2GBPA 3HJAA 3O94A 3FNHA 3TN7A 4YPVA 3RSSA 1X6VA 1GQYA 1CDOA 4WUTA 5M34A 1KP9A 1M7BA 3OWHA 3A70A 1RE0A 2PWBA 3PFFA 1NN3A 1YDHA 2AH5A 1MW9X 1R88A 2GETA 4RM2A 1OLOA 4R5MA 2IVFA 1BOFA 2VK1A 1G60A 2ON6A 1RJ9A 2HHJA 3BORA 1UPXA 2I3ZA 3T94A 2ODBA 1XT6A 1J8QA 1C29B 3VSDA 1RAGA 4MARA 1OPXA 1ETHA 1GNVA 3JW8A 1PTJA 3MWJA 4IH9A 4Q6WA 4QT0A 4GT1A 3UKOA 1XNHA 3N70A 3VVLA 3HO6A 1MO3A 1CR6A 1USKA 3ZWNA 3FDZB 4IDDA 3NGLA 4PYIA 2J7PD 1I94B 4WZBE 4ECEA 5IEBA 1R2QA 2P9YA 3VYTB 4J6EA 1CJUC 1E9DA 5AW1A 4OI2A 1P6UA 2ASEA 3MB5A 4LRQA 4OUKX 5KYUA 5IJ9B 3ONVA 1JKIA 3ENVA 3CUVA 2H3EA 2D0OB 2WFMA 4E5UA 2ZBQA 3KEFA 1WSBA 3IVAA 1M8FA 2FUKA 5C7IO 5D84A 2OHFA 3FNIA 2GRJA 3JXEA 4XKJA 1VP3A 4OLJA 3DO5A 3RUFA 2W8ZA 1CJMA 3IPXA 1X77A 2CXTA 4LNUA 621PA 3EK2A 2Q1TA 3I4FA 5IF9A 2POCA 3MOSA 1OX6A 2WWYA 3COVA 4ITUA 2FN4A 1SU7A 4AAYA 3ESRA 1L7MA 1QH8B 2II6A 1EFCA 2NZ8A 1NN1A 1U8EA 3C85A 4IDOA 1MO6A 5CD1A 4B4DA 3V2IA 4XWYA 3NJ8A 2PSFA 2Q3DA 3NWEA 1COWA 3N0VA 1A9XA 1FZQA 3KQLA 4BRZA 5BWOA 5IWCA 2LP4Y 3G7NA 3S2YA 4KPUA 2WD7A 1Y1LA 3QE3A 3ZR4B 2OBXA 4D8UA 1YS4A 2YN4A 4NAHA 3DB2A 1CULC 3DOUA 4ETMA 1BXKA 3O3CA 1ZUHA 2XMDA 1QK4A 2W8BA 2YCLA 4GOXA 4FJ2A 3M6VA 3C97A 4YFYA 5SYNA 3W2FA 5MF6A 4G0XA 4OGKA 3UW1A 4RZ2A 1QTQA 1II9A 1PLKA 1WXHA 3TLGB 4C0XA 3DEAA 4WNYA 2X58A 2VHTA 4K86A 1NUTA 4V0QA 1NQWA 1PT8A 3LQ1A 3ONNA 4I55B 4BP8A 1UFKA 3DMFA 1T5IA 2ECOA 4F5EA 5CCBA 4XE5A 2X3UA 4RANA 3J80A 3THSA 4RFSB 1ZM9A 4XGRA 1HDZA 3EF1A 2I8CA 2VHWA 3OMWA 3R9IA 1ESDA 3IQWA 1RU3A 2QN1A 1L3BA 5HJ7A 3I28A 1JPVA 1ULAA 3P2OA 1I7QB 1GRVA 2GK3A 4OOFA 5TVKA 2HMSA 4JBXA 1T6NA 2ZJ5A 4YCCA 1M34B 1CS0A 4MH0R 1CQWA 1Z3CA 3HU1A 3G17A 4FFOA 4B74A 4BHTA 3H7IA 4L8VA 5HG0A 1O0BA 1YI8A 1YXMA 5FR1A 2PU7A 2R8OA 3L0DA 4R1OA 2LD4A 1G5IA 1DC8A 4X1KB 2H1VA 1G4UR 4BO1A 3IVXA 2P5SA 5CT9A 1PGNA 4OYLA 5DBGA 5A1JA 1WBBA 3BL6A 3OEHA 2WUFA 2IIBA 5CFOA 3H5LA 1F7VA 4I4NA 1CR2A 2VBIA 3DCNA 1IBRA 1QFYA 3GRCA 4KQFA 3ENNA 1H23A 1XZFA 3GLIB 2KJQA 2W4IA 4CU5A 1KS9A 1SBHA 3OKAA 4LV8B 1NV9A 4LA4A 2CMHA 3G8AA 2W43A 3F8TA 1A27A 1D5CA 2R6AA 1GSIA 2IBMA 1U0RA 1CY1A 1DWPA 3DAOA 4BNNA 1H3EA 3VR6H 3ZQ4A 3ZV3A 3S1LA 3MQFA 1ZQ9A 4A1FA 4BVBA 3PNKA 1I5EA 3OFVA 4LI0A 4HL6A 1FP4B 3AEQA 1ACMA 3H99A 5E6UA 3SPXA 3FPGA 4KRXA 1JDPA 4OBEA 4OFZA 4I50A 2XXJA 1W85B 1LLCA 2B98A 2Q4RA 2YWEA 2BPOA 1RQRA 2ZYHA 3EUWA 1Z2NX 3HACA 3P71T 4Y1GA 3ROKA 1R9MA 3KELA 3O2QB 3RSHA 4DIUA 2VHYA 1YHNA 3H87A 4IICA 5LFAA 1E5VA 3FOEC 4D4MA 1IIBA 1I51A 5AVOA 3HTXA 4HP8A 2J0EA 1A9XB 1V37A 3E7WA 2BHLA 2FSFA 3V3KA 1GNLA 2EARA 4OKSA 2E5WA 2VNKA 1SVSA 3GJYA 4MW7A 4YRMA 4N0MA 3ZD8A 3WDKA 3SY8A 1C3OA 2HLDA 4X71A 4G5GA 2ATEA 2ZBUA 1B42A 5A9SB 2QD5A 3H5AA 1NZDA 5EP3A 1P8AA 4KXUA 1ZMTA 1T0UA 3MC1A 5IJAA 4YRRA 1ZIPA 2VJQA 4HH1A 3DUFA 4AULA 4AL4A 5B3LA 4GKKB 4PZPA 3BEOA 3N5KA 1ISSA 3C8HA 2I1WA 5K8IA 3ZCSA 2JGLA 2YQ4A 1JYEA 1NQOA 3DBVO 3E22A 4IYJA 4MVWA 3RM3A 2WPDD 3I5MA 3N05A 2AJ8A 2OXIA 2Q6VA 1KETA 4J2HA 1OFVA 2VF4X 1BO6A 4QO8A 3PC6A 5KTOA 2GVNA 2QR3A 1PJSA 3B8HA 1A5ZA 2F1IA 3QXSA 1BEEA 5ALKA 3BGDA 1B4DA 1U28C 2L42A 4HOYA 3WY9A 1GTRA 1PI3A 4MHTA 2EP8A 3I3OA 5DN9A 1L4BA 3IKLA 3FSGA 4P38A 4RSHA 4D9CA 1UK7A 1VKRA 2EC5A 2PKWA 4OATA 1V7ZA 4LJ8A 1HNWB 1I9GA 2O3SA 1KI8A 3W2IA 1MABB 1HFJA 4A92A 4MDYA 5G3ZA 1IBSA 2B0CA 2VP0A 1JHOA 4EW1A 4A8PA 5BT9A 1C30A 3CRZA 4RPHA 5JS8A 3HSKA 2HHAA 4RVGA 2H9AA 4AT1A 5CFNA 3MSXA 3GG9A 4HGQA 4CM9D 3Q41A 4I4TF 4R1QA 2M6LA 2QDKA 4RVSA 3W5DA 2BFFA 1H5UA 2V7QA 3PL5A 4BZQA 5EG5A 1V1MA 2C7VA 4BCCA 2IXEA 3Q9NA 3GH1A 1XF9A 2ILVA 3R9XB 4GS5A 3SZ3A 5HF9A 1EXNA 2XXAB 1HTBA 4QOSA 3NBKA 2O2JA 3MRXA 5IUNC 5CB4A 2OBNA 2BAGA 2HJSA 3Q8LA 5GJWC 4MO9A 1E9VA 3NWBA 3M1AA 4IF6A 2HEGA 3E8XA 2XKAA 5BR8B 5AR1A 5FOWA 5K01A 3OKFA 3GX1A 1KRWA 3HV0A 2W2NA 2X8WA 3ISJA 2ETXA 4DSAA 4FJ0A 2O8CB 2PKXA 2GWHA 3B3FA 4MLDA 4TRNA 4BMPB 2EJBA 3N76A 3QKUA 4NVRA 2PZJA 5LL6P 2Z8YA 3FWKA 4YO8A 1XMPA 3LBAA 1X7YA 1JHDA 4OJKA 4IIJA 2CDRA 5JCXA 3A3NA 4WLOA 2B8NA 1W46A 1UAYA 1XC7A 4BLUA 5F1YA 3WLRA 5ISMA 1R0ZA 3K1AA 1X15A 1C7ZA 1L7OA 4D25A 1PSWA 4S1TA 4E5VA 4EKDA 4KFCA 2G70A 2YBEA 4MA5A 4IEIA 5K05A 1XCOA 4MLZA 1MVLA 3F6SA 1EFVA 2YZMA 2B4TO 3MYYA 4QQFA 3MWKA 3NMUF 5TDHA 3LXXA 1A5SB 4TRJA 4WCFA 3EPKA 3PXEA 2VAWA 4INOA 4FDMA 2F1OA 1FMFA 2ALJA 2P2ZA 1PSDA 1QQBA 1FNMA 1TK2A 2QTRA 2QMEA 1N1GA 4EFMA 3WHLA 4JLOA 3UQZA 2H4XA 5CXSA 3C14C 1QRUA 4P3NA 1VRWA 1DELA 5DKFA 3SICE 3UFXA 4CQMA 1GQOA 4DQXA 1KWKA 2V0GA 1RM0A 3GAZA 2Z0MA 3DFKA 1LDEA 2H5LA 4FEAA 1L4EA 4YXWD 3RRYA 1B1CA 1UPCA 2B1IA 5EXXA 1ORIA 3IQFA 5TGDA 4DUGA 2ZE6A 3RC8A 1CRLA 4B43A 2IS2A 1PT7A 1LSOA 3C5EA 3AOGA 3G9TA 1GZDA 3BCSA 3GRKA 4G26A 3CX4A 4LHVA 5T4BA 5J63A 5D3MA 3RVMA 3UJBA 4QLBA 4E1BA 2C84A 3ZE2B 1X74A 1YZHA 1QF9A 1CLUA 1NUQA 2H51A 4OH7A 5BRJA 1SC4A 4LTNA 1DIOB 1LTQA 3TEFA 4F4FA 1LF0A 4IUBS 3CSSA 1GSHA 2EL7A 1BMFA 2BJHA 1NATA 2HDOA 1WG8A 1MH1A 2ZIXB 1ISPA 4EJ2A 1QZXA 1PJBA 2OHOA 3PRHA 4RJ2A 2OCLA 4HMOA 4WBSA 1DQPA 3QY0A 1F4LA 4L3VA 4LI3X 4P5PA 1GGVA 1UK9A 1Y0BA 3AF6A 2Y0EA 5LDHA 1XVVA 4DDMA 2C07A 2J9FA 4V2IA 3DZHA 3H4TA 4Y6GB 3WIVA 4C4AA 3UUFA 4PO9A 4IJUA 3TAUA 4A6DA 5IABA 4OKIA 3UYLA 5FRDA 3UUWA 3P0RA 4GR5A 3GI1A 3E81A 1TQ2A 4ESHA 3VNUA 1Z12A 1DRWA 4LJLA 3ZNOA 3NTUA 4RGYA 3RJ9A 1DLJA 3QXGA 5K3AA 5KYYB 2PAAA 3ENZA 2OL4A 2Q2NA 2WKSA 1I6MA 2J5XA 1HG1A 5JYCA 1POXA 1EWKA 2MINB 3CW8X 2M32A 3H19A 3LQ2A 3NHLA 3NTOA 4J29A 4M2LA 4PLZA 3TM5A 3WE7A 4NYJR 4TS1A 2RH8A 3IL2A 4R0NA 1VPWA 16PKA 5DTMA 1YZNA 2ZB8A 3F7OA 2B1RA 2EGHA 3HB9A 4PHTA 3FBWA 1T3TA 2C5LA 3MG9A 2CL7X 3D6MA 1C9EA 4IUYA 3TR5A 1OYOA 4DV4B 4M36A 2I3GA 3NOXA 2FWBA 2GEFA 2QQFA 1OUMA 3QBEA 4OA8A 1G66A 5E9AA 2OAGA 3RWOA 4BNGA 1U3DA 1EUYA 4EPYA 1RRFA 1FA9A 3GYBA 2AC2A 3LHDA 2PZMA 2PA0A 5EKDA 2QKYA 4TZTA 2R8XA 2ZUFA 1N78A 1EIWA 3HYCA 1XCLA 5KOIA 1NU8A 4DR6B 1SK9A 1NL3A 4H60A 2FPMA 2FW9A 1UEXC 3AUUA 1W73A 2FUNB 4KQ6A 2VP6A 3LE8A 4RACA 1MEEA 2Y92A 3SFTA 3TLGA 4UBJA 5GZ6A 3W6ZA 2AIRA 2ZBFA 4B47A 5KNLA 4F8JA 1LK0A 5EY5B 4QNNA 1A2BA 1MV8A 1PV4A 4AZ0B 1RT9A 3KU4A 3LQYA 5DK6A 3VOTA 5DN6D 3WJAA 2VJPA 1FMJA 3DMTA 1MNAA 3SLGA 1IUOA 1R0CA 5B1HA 1E3EA 2FXVA 4MCIA 3OCYA 3VZDA 2Y9MB 1MORA 4MRRA 1VE1A 3L8MA 3OECA 1JAIA 1I7DA 1RI3A 3VPAA 2ZRJA 3AM5A 4YJFB 3HP7A 4C89A 1V3TA 1DDOA 2BMEA 3T06B 3DCIA 3DT6A 3R3VA 3PXCX 2O4UX 2XNCA 1AO0A 4B3TB 3ODPA 1FRFS 4NECA 5A05A 3RWBA 4NZYA 5K0TA 3GD5A 4PLFA 4R1TA 1N9ZA 1RPNA 2FWRA 3EA0A 3FR8A 4G67A 1EFLA 4W6QA 4ZI5A 4CTJA 5A4FS 5BUCA 1AQ6A 1JEQB 3MM4A 4NKRA 4QBHA 3ZUPA 4F3NA 2EKQA 4O0MA 4U4AA 2HLPA 4KZPA 2X8JB 1A7UA 2WJVA 3C3PA 3LTEA 4BLWA 4FS3A 1X7GA 4RCVA 4YWHA 3RYIA 4MVJM 4TSFD 3FW1A 4Q3EA 2AUTA 5CM9C 4ZVLA 7REQA 1RQXA 2R2GA 2ECPA 2IXDA 3BAFA 4P2GA 3JZFA 2VJMA 4R1NA 1Z08A 3LY8A 1NLFA 1Q1BA 3O38A 4C05A 4QHTA 2VDQB 4DR2B 1KAQA 4IOLA 3A4IA 2ZI9A 3U3JA 5IC6A 1HT3A 3QVXA 4LDNA 1CQPA 4ML3A 4MVXA 3V80A 5G4KB 3CIFA 3IIMA 1CUJA 2DUWA 3PA6A 4GH5A 1I0IA 3CVWA 2VNHA 2WU8A 3RSZA 1KOFA 3AHGA 1C14A 3ENKA 5C8YA 4WL0A 3M3HA 3ZD7A 4ZANA 4DOMA 2OXEA 2J4CA 2FPLA 3E4DA 3GOHA 3IUPA 1X8LA 4H0CA 4MYRA 5DHAA 3K9BA 3OBIA 4JI7B 5AM4A 1V3QE 3T1NA 4OLBA 1B8NA 1FBTA 1Z8NA 1NUSA 1QCDA 2VLBA 2F6RA 3LRXA 1JFSA 1VLMA 3H11B 3URKA 4XUDA 3RVRA 1DWOA 5F2KA 1O2DA 1OMOA 2YFQA 4XI9A 3GEDA 4DZZA 4WXYB 2MR6A 2YXLA 1E3WB 2FR0A 2AD1A 4C0JA 3FMOB 1OFIA 3R5XA 5TS3A 3T52A 2EWVA 1E9EA 3ZUGA 2I3BA 3I0NA 4GBMA 4TQGA 4I55F 5H9VA 1ZSYA 5JAQA 1DAKA 4NOJA 5FLYA 3IERA 4HDSB 5KC8A 1IZ9A 4UBIA 1GSOA 4J76A 2G71A 2V55B 5AM3A 1L7PA 3ANLA 1Y8CA 5HM6A 1DSSG 2VOEA 4I2NA 4CF7A 3LAWA 3C6QA 5K7SA 4HHEA 4D02A 5TIIA 4MW0A 2AG6A 4MWBA 1MXFA 2L17A 1DQSA 4C6HA 4HK4A 4XDHA 1EFRD 3OWOA 2B92A 3NH6A 1THGA 3FAZA 1YCFA 3ER9A 1YZUA 2Z57A 1ZH2A 3TD2A 4DJTA 3MUNA 4D98A 2REQA 3BXZA 1LNZA 5KNDA 1YA6A 2VAMA 3UT5A 3T5PA 1VI6A 2A59A 1VFPA 2WTBA 3AEUA 4YMSA 2C20A 2Q62A 3ZVRA 1Y7PA 2PBRA 4I1YA 1XZHA 4WLUA 1CNEA 3ZWBA 1E7YA 3OJEA 4CN9A 3OFSA 1US8A 4RMJA 3ZHQA 1N2BA 5IHXA 3JQ6A 1M6NA 2C03A 3A3YA 3L0BA 3MGGA 1BROA 4TVOA 4Z9XA 3TSZA 4CMIA 4DABA 1C1DB 1R5BA 4GVXA 4RY0A 3FUVA 5C52B 5FBLB 4M0DA 3MF4A 3QKRA 3OUZA 1PL7A 1IXSB 2ZIZA 4AK9A 4DV2B 2WJIA 4P7FA 2JEYA 1AA6A 4L72A 4NXMB 4P2BA 1UBHS 3RTBA 4EHLA 1SBCA 1YZLA 4UFOA 2H1OA 3MTIA 4CEHA 3RQIA 4ESOA 4UHEA 4FWTA 2DM6A 3MJTA 2YZNA 1QIDA 1HURA 3R4CA 2I2AA 2VR1A 3JRXA 1JRLA 1QV9A 3GUVA 3ZZ0A 1WCIB 2OV6A 1SZPA 1F0PA 2E6KA 3UYKA 1QO7A 2IZ0A 5LMZA 2P9BA 2GCNA 3F4KA 2R2AA 3FTDA 4Q3AA 4Z9YA 3ESBA 2IITA 1U3VA 1A4IA 5EKSA 1ORVA 3UMVA 4BFYA 2KS6A 1SEVA 1RWBA 3EGXA 1HUQA 2L18A 3HWWA 3MCTA 3QIVA 4P35A 3MTBA 5KAMA 2PJRA 4LWOA 1YSCA 4K6OA 4N39A 5JG7A 4A0HA 1E6MA 1EUDB 3ZQJA 2Q5JA 4DJJA 1U1CA 2ID8A 3FMVA 3MIIA 1QPZA 2PUGA 3SI7A 4C3VA 4TL9A 4AJ2A 3B7WA 2X6RA 1LBTA 3A7DA 2EP5A 3OPYB 3VNRA 1Y80A 5HUJA 5JQGB 3R6LA 2IUYA 4M38A 4C6TB 2F1JA 4FDVA 3HC7A 5TMBA 3DAHA 4ZVTA 1AC5A 3A6ZA 3LIIA 1Z62A 5HUQA 3EDQA 1V8ZA 2A1TR 4Q7KA 1P81A 1G3RA 3CR3C 2LCQA 4EYQA 4DLUA 5DPMA 4ZXFA 1ISGA 4MI1A 4H7DA 4BQNA 2QN8A 1GKIA 1NE2A 1W52X 1F8FA 2JGMA 3OLWA 5JWHA 4JSYA 1ADBA 3ORYA 4MS1A 4Q3BA 1KBZA 1RXWA 4ZN6A 4BEJA 2I9PA 2WIFA 3OU2A 4GG1A 3WAJA 2XCSB 2WYVA 3BJEA 4J6FA 1V95A 3A36A 5F1KA 4AYTA 1E1DA 5CFZA 2WJ3A 4K1XA 4A0SA 4WESA 3C87A 4GOOD 5DNDA 4DUPA 1XTBA 1ZSNA 1OROA 3VH4A 3L4BC 1FCJA 2FQXA 3WJ2A 1TPYA 3H2JA 4KQCA 2OMEA 3WRXA 5JLAA 5JSKA 1GGJA 3CLUD 2Y0PA 3SQDA 3OJOA 2ZAYA 3ORRA 2CWDA 2JJ2A 5G1PA 4NIMA 3DNFA 4ARZA 3KV3O 1L5SA 2GX6A 2YWXA 3QWHA 1OAKA 4DBLE 4EMUA 4CM8B 1ZZEA 2BH2A 3WGJA 1VP9A 4JC0A 3HKBB 1SC1A 4GZLA 4XXHA 4Y18A 4ZEXA 2PGDA 2PBZA 3KQWA 4LGYA 3WP1B 3WOVA 3GEHA 3K5IA 5GMOA 3D2BA 3G2QA 4LXUA 4ETIA 2H1IA 1RYNA 1GL3A 1Y3DE 4OGFA 5EZ5A 4BO9A 1Q7BA 1MG5A 1L7AA 2FFRA 1IVYA 1IYZA 1H0HA 4WE3A 1K7EB 4NCJA 3UG7A 3WIOA 1JSLA 3GLGA 2XKJE 2EFEB 4XEHA 2P4QA 2W7TA 3TNLA 1KEUA 4LXQA 1E61A 2FJUA 1KZ6A 3FPEA 3GBSA 4JXJA 4JI5B 4WADA 1ODFA 1YASA 2VDRB 3V4PB 3H9QA 2DLDA 2QX9A 2XNSA 4D9IA 4ZQCB 1OLUA 1TZ2A 4BUCA 1NMYA 3HY4A 3LA6A 1G64A 4M1TA 4JJ7A 4QYIB 1UAAA 1FDIA 1P62B 2P0YA 3OEEA 4ES6A 2CWWA 3ORFA 1EDBA 1NVVR 3TVDA 2YRFA 2GPTA 3K2QA 2GB4A 1KEWA 1MB9A 1P0CA 1YRQA 1KDYA 4RGVA 1AKUA 3E2MA 3SIWA 4BV9A 2EU8A 1BXZA 3DDNA 4N18A 1T4CB 2HSGA 3CPSA 5FO0A 1HL7A 4QGGA 5AD1A 1CJTC 1ZI8A 2AQHA 1N1DA 4XCQA 4CI9A 1TEZA 1DCMA 1HMPA 3A4NA 4G5OA 3MRSA 3K7EA 3L82B 3E7FA 4MGIR 4TTJA 3I2IA 4PICA 2FSGA 4D5EA 2N42A 4CTKA 1Q14A 3AO0B 3JRWA 4OIFA 3TLBA 4DIBA 2FDCA 3C3XA 3ZWWA 2CXRA 5KBYA 1OXUA 2NYUA 2X41A 5HJ5A 4E22A 1RDFA 4YN3A 2I7DA 4DGQA 4QARA 4ALIA 4L0MA 4OU5A 2ZIEA 2PUCA 3ECAA 3IEPA 4US0R 5EHGA 1BC5A 3VX4A 1MC5A 2HGZA 1Y1PA 4QYSA 5E1OA 3REFA 1T5OA 1SCBA 5JYBA 4G65A 1ADFA 1KKMA 4OKNA 1IZ7A 5C46F 4FT4A 5LP6A 3O21A 1JG6A 1E3QA 1QVVA 4FZ3A 1MAUA 1WU8A 4M8NE 2WBLC 1SUSA 1ULBA 2ZB3A 4HNSA 2RGBA 5ALJA 2VPPA 4GUAA 3ZU4A 1X7ZB 1A9ZA 3DDWA 1SRQA 2FEKA 3D6VA 2ZJOA 3ABRB 2Y2VA 3LX5A 1JIJA 2ZKLA 1BN6A 3R77A 4FCWA 4KMSA 4YPFA 5JT1A 2BVNA 2AOUB 1NZFA 3DW1X 3HJTA 2PNJA 4NS1A 3WK7A 1C8KA 1IDOA 4DMLA 4D92A 2ZIAA 4YRIA 5B2EA 5C37A 4M0FA 3X2SA 3C5WP 3WDSA 3B1VA 3FX2A 3TPCA 4F5YA 4C0AC 3IBTA 1YKSA 9MHTA 1VHQA 3A9CA 1LNSA 3ACDA 3KKKA 1P75A 1FP6A 4XASA 3RBAA 4BB6A 1Q19A 4ENPA 5DXFA 3CSDA 1GPKA 1QYDA 2CLLB 3PC8A 5JDCA 2HV9A 4PSVA 3DDSA 2AN9A 3W5VA 2E9SA 3QKSB 3UTCA 1EX9A 2YW9A 3L8ZA 5FUBA 1L5HA 4ZK2A 4MHOA 4GE3A 1YE5A 1SCUB 1URPA 1NQUA 3PGVA 2VWQA 1P5RA 3IKMB 3P97A 2YFYA 4JWKA 3KJXA 4UNQA 4N0DA 2G9NA 4L57A 1CF4A 1IK4A 5CT4A 1VHDA 3A1TA 4Z4HA 1J23A 1NY5A 1PL6A 2JS7A 2W98A 1TADA 5BWMA 3W5SA 5KQMA 1X1BA 4YT5A 5F77A 3RAPR 2ZIFA 4KE9A 1E1QD 1Y37A 1CE8B 2R5NA 1VIAA 2YASA 5TQVA 1N0WA 3VTAA 4P33A 3CR8A 1PR9A 2EOAA 4CF4A 5FTNA 1Z2AA 2BRUC 5IMBA 5J2TB 3JD4A 4UVEA 3VYUB 1E96A 3EGCA 4EF6A 2IOFK 3FCYA 2EVWX 4QJIA 4QEZA 4YQZA 1MP0A 5FORA 1KPGA 4YAGA 1RMYA 2R3SA 4NBNA 3TTVA 4CZ2A 1F8GA 2ZR8A 3HP4A 4PSDA 1G5HA 4CTMA 1TC1A 2DJIA 1XRPA 3HY6A 4RJTA 5LU8A 4RK5A 3HZHA 1KKUA 4TYWA 1UODA 3HDJA 3IUNA 3VDXA 1J0DA 5AM2A 1GXSA 3L2OB 4X84A 2DLCX 2IS6A 1SOVA 3QVLA 5DNAA 3VJLA 4H0FA 3CNBA 4R41A 1PZXA 3RT7A 1KI3A 1ISRA 1N6NA 3H97A 4MULA 2FSVC 3AFGA 1RHRA 4CKWB 4OL0A 1IAQA 2RGRA 1SVOA 4YAKA 3HXKA 2WYHA 5F7ZA 2OZLB 1OFGA 5ECGC 1W36C 1GUFA 1YQUA 3HJGA 4BYMA 2WQ6A 4BE4A 5B64A 3AL0C 3IMGA 2DVMA 3TDMA 1JHYA 4QJ3A 2FUG6 1YS7A 3IOEA 2YZ7A 3AMVA 4FFWA 1WXXA 3AY0A 4QOHA 1A1VA 3INGA 3FPKA 4ITRC 3H1GA 4RY8A 2QR2A 4FOTA 2CXQA 5IT5A 4K7JA 1H22A 3NETA 4LOKA 2FFAA 5AP9A 3SYKA 2NMVA 4KBYA 5B37A 1RBZA 3D5TA 1SVNA 1QC5B 1M3SA 3O3NB 1K0UA 4NDZA 4TXMA 2P1ZA 4JAVC 5J9FA 2JHAA 3PJGA 3QVUA 1UXKA 1FX1A 3ABZA 3H2IA 2VP2A 4KE6A 5FKJA 4F2PA 4B82A 2IA5A 3ZZTA 3G2IA 1EIZA 2JVKA 2JBWA 1FLDA 3H5OA 1TE2A 2O3QA 2TMYA 3EXG1 2BF7A 2MYUA 4DBZA 5A5DA 4DR7B 2VFAA 3L8CA 1R8SA 2G9QA 4V38A 5FL3A 3L0CA 4HFMA 1I3MA 5EXEA 3RIGA 3HB5X 3LUPA 3ICPA 4UASA 4EAAA 1WM1A 5AJZA 5L8VA 4O8ZA 3S99A 4GOJA 1QWSA 3MMXA 1R6AA 4URVR 1BGXT 2FRVA 2H9YA 2QX7A 4M3NA 4A2PA 1NX9A 2PQ6A 1RPJA 3QF7A 4R1MA 3ER8A 2QY6A 2FOXA 3D54D 3PQ2A 1UPUA 2C2OA 2JLBA 3C6XA 2JAQA 4Q1EA 4LYHA 3BKWA 3T9CA 1P39A 4P36A 3DHNA 1P2VA 4RADA 3W8EA 5KKAA 1WY5A 1E0SA 5LSAA 2ZB2A 4Y2HA 3ZV7A 5KYYA 1E3LA 2PJDA 1T9KA 2XKKA 3JR7A 2BEWA 5ARBA 5EC8A 5LIPA 4XSHA 2P3OA 1QIHA 3OPYI 1NASA 3BE6A 3WBFA 2VZ0A 4ZQEA 2GJ8A 2A9VA 4DF3A 1I0LA 1KI7A 4ND4A 7ADHA 1C3EA 1ZVQA 1YBVA 5FBHA 4AIRA 3GJ4A 2J67A 1JX6A 1A7JA 5CYFA 1JWAB 4YIKA 3U1VA 4O4IF 4C87A 1NVEA 4EJMA 2Z9BA 3AC0A 3VV3A 2Q7OE 2HRDA 5D8DA 1WB5A 2O3TA 3UMJA 1DAOA 4YB8A 5BN5B 1J70A 3L0IB 4EHDA 2DEUA 2E4XA 5FOTA 3LKDA 2GBLA 5BSWA 3N7TA 4IJ5A 3DMRA 1SUPA 1THZA 1KWGA 3RIHA 5AW9A 3GNLA 3REQA 3C3JA 4JBLA 1DO0A 4MA0A 1F5SA 2JIZD 3FJOA 3EISA 2FQQA 3L4JA 1Y7LA 4GLJA 1Q7TA 1NMXA 1YJ8A 2Z83A 2ZPTX 2ZSAA 3A6JA 1RC0A 3E9RA 3OE7A 4IS2A 3IA2A 4QUBA 1S4QA 4B0OA 4Q4AA 2R44A 3G02A 1PIWA 2O2XA 2VDOB 5DT9A 3UPDA 1MA3A 2FLKA 1Z34A 2C9YA 3DYIA 1VSVA 2PEZA 1FUUA 1QGZA 1V9CA 2JLSA 3KAKA 4P0TA 4WXEA 4PZDA 5B4VA 5I9LA 3EC7A 1ECLA 5I9NA 1ZGAA 4MR9A 1O5IA 3K92A 4H3VA 1PJTA 4Q9NA 1VIDA 3CVOA 4J07A 3VPBA 3GGPA 1FF9A 3R24A 3OTHA 5G02A 1K3TA 2QL7A 2HFJA 3NRBA 4JB8A 5B6IA 3WGHA 4MQMA 1W0KD 1D6SA 1QB7A 2HF7A 3ETNA 4K9QA 3WZMA 3ZK9A 1NW4A 3FVQA 3NV9A 3H6HA 1L4HA 4TXNA 4ALMA 2W6ID 3VUEA 2ARKA 1G21A 3BFXA 2YXDA 2UZ1B 4MQ6A 1YKFA 1E77A 4JL5A 5KYGA 2OBFA 4RQBA 4HAVA 2ZRQA 1VLHA 5G3YA 4MINA 4GAEA 1RQGA 4KI7A 5K4HA 2ZI6A 2DFLA 3M9LA 4P32A 5LB4A 2J3HA 3ILYA 1SUCA 3IIKA 1USWA 4EPRA 5JNWA 4MQEA 1F7UA 2CD7A 2HXGA 2QTBA 1WZEA 2EW8A 4LECA 1DU4A 4YMUA 4OHMA 1GUBA 3S8EA 2NN3C 3J7AC 2P68A 1ZUWA 2ZTHA 4KYUA 4BQSA 2DTXA 3OLVA 1G6OA 2RONA 2VEDA 5DO9A 2Q5FA 5I7EA 1U1GA 2FR8A 3ZWDA 3MJRA 5IULC 1EAMA 4CM7A 4KJXA 2NSYA 3UH0A 1XE3A 1PT5A 4I0WB 4RS4A 3RVLA 2E1RA 5FQOA 3ZI4A 2XYRA 4NAVA 1OREA 2DETA 1NBMD 2ABWA 4MJLA 2HDWA 3DFUA 4UBNA 5HE9A 3SQOA 2UUPA 5H80A 5KTRA 2OZPA 2EYUA 3E58A 2NXJA 5KWSA 4TPKA 5GONB 4IX1A 1HNNA 2QI9F 3ZZNA 1YF3A 2AA3A 4KQ2A 3IE2A 1YHYA 4N8EA 2YOHA 1SUEA 1BCRB 5FULA 1HE4A 1J2JA 1L7DA 4NBKA 4EW3A 3OJFA 5AXCA 5BQPA 3TDNA 9GPBA 1DEAA 2Q2QA 1UZLA 3Q11A 4XARA 1B1AA 1HFKA 1L9KA 1U0JA 2C88A 5D2CA 5EWMA 1M5TA 3RYCB 3FWZA 1RJWA 1DJNA 2VF8A 4LHXA 3ONWA 3BH7A 2GEDA 2M9MA 4PPFA 3CBGA 5CDSA 2XAAA 2FN8A 2IVZA 4PAGA 4OMFG 4G0ZA 4JQYA 1B0AA 5EKTA 5LBUA 1CWUA 1QKJA 4M37A 5EGSA 3RJTA 2J5KA 1GAQA 2XE8A 4LF8B 1Z7GA 1N5LA 4DLTA 4FGZA 3ZKWA 4GSKA 1H2EA 5CJJA 1WDLA 2H7CA 3CG4A 3D5EA 1FYXA 3HRIA 2ZIUB 3E18A 3N8IA 4HTAA 2ZROA 4P3KA 3VVCA 3HUEA 4FBLA 1NYLA 1TF5A 2X9LA 4O4JB 3PQCA 4OEHA 1OILA 3A1NA 1G5FA 3EXHA 3OZGA 3UXEA 1TYDE 2EJWA 5E4YA 2HO4A 1QANA 4EQ6B 1STOA 4RZUA 4U7FA 3RROA 3TSWA 2FE4A 4DRXB 2JD0A 2O23A 3WRXC 4OXXA 4L7VA 1TX4B 2YRWA 3KTDA 4REOA 3S7TA 1QKKA 3IV7A 1W94A 2PS1A 3P20A 4LMAA 3S70A 4IO0A 2QROA 4U7GA 2PIAA 4RLQA 4A16A 3O8RA 1QU3A 4OHRA 3S2EA 1VYTA 3QVJA 3KSDO 1WCIA 4WPGA 4TYMA 3L07A 1RP7A 4D8VA 2YJGA 1B41A 2H16A 2JDIA 4XSVA 5BW6B 3MJEA 5JS6A 3R7WB 1E7SA 1SWVA 4YPOA 5LP6C 3S7ZA 1NR5A 3C15C 3D8BA 4ADSG 1ZRSA 3KTAA 1G3MA 1CBUA 2R8YA 3A6LA 4KQKA 2MYTA 2RAVA 4RHCA 2PMCA 1U8CB 1KQPA 1LBIA 1LPOA 1NBWB 1MEOA 1P0FA 1QOPB 3PI7A 2X0JA 3NQ41 4X20B 3V7YA 3HI4A 1WLYA 1SC3A 1E1YA 3WXBA 4DVJA 5LP6F 2IY7A 4O4HF 2JIDA 3UKDA 3EVNA 3HUFA 5GQSA 4GOMD 4KG7A 4D0RA 4YACA 1OI3A 4JT8A 2FZGA 1GEEA 2MHCA 3K1TA 1LLFA 3GJ3A 4YP7A 1C0PA 2V7TA 4J2TA 1YVDA 4YC7A 5JBNA 4F8EA 5C4IA 5GV7A 2W2OA 1VL2A 1Z8DA 3KKNA 3E3NA 4XCXA 3VU0A 3UWSA 3RI3A 2R4TA 3PD7A 4LN1A 2EV9A 4MJ7A 4LPSA 3A4LA 2PCLA 4JZYA 3C98A 2YVUA 1WEHA 1OTXA 4IIYA 3O9VA 3ZDXB 3ZXYA 3LLMA 2YHIB 2OC4A 1VL0A 5CG2A 3PHHA 4NCNA 4TL7A 1M8JA 3DWIA 2LPMA 2R96A 4UATA 3TLZA 3HKDB 3BFJA 1RI5A 1X9IA 4AWAA 4HVCA 1S5PA 1U65A 4TS3A 3MILA 4RIGA 4U2KA 4FYHA 2PUVA 2AB0A 2C5FA 3HDTA 2PJZA 4X6XA 4AY6A 1AB6A 4OD0A 1Q0ZA 3MTEA 3PDIA 4KH1A 5ICEA 3LCMA 4XQEA 1DARA 1U2ZA 3E1SA 5DT2A 2XV1A 3W1WA 5KPJA 1DAIA 6ABPA 1RRPA 3M9XA 2O19A 1NW9B 2ZRNA 3NUZA 4FS8A 3P45A 1DKRA 4YR9A 3OTOB 3N0XA 4AX8A 4HDOB 4QDTA 5JAZA 4OP2A 1Q77A 3SS8A 1ADYA 2DULA 1A98A 1L6RA 1EM8A 2G6BA 2ZE8A 2YV2A 3D4PA 3EXFA 3GGSA 4N7BA 4Z99A 4BZPA 4I9GA 1Z0AA 1QVZA 2VF2A 2YX1A 3K5HA 4PVCA 2X9VA 2HMAA 2NUBA 3HVUA 2BW0A 4EJSC 4RTNA 2Q9CA 4IVRA 2WP8J 4L9SA 3PUKA 4V2UA 3TRFA 1QX4A 3WK4A 5ARCA 1ISFA 4YT4A 4CNQA 2NP6A 1M9NA 4B17A 3PNBA 4IHKA 2VSXA 3MJVA 1XDSA 4TMYA 4WOBA 3RIMA 2QI9C 4KFRA 4XB2A 2YWRA 2UYOA 3FYSA 3HDHA 3KIPA 4KR9A 2W4QA 4FGJA 1M2HA 4MQ5A 2F8SA 5FO1A 4EFNA 4B3IA 2I3AA 1E4OA 4ZVVA 3ZIAA 2HEIA 3CUWA 3ZJUA 1N92A 1YE3A 5IDXA 3P2KA 1U2PA 2GFHA 4KO2S 2A57A 5F4ZA 4MRMA 4RE5A 3R7WA 5T5QA 3GL9A 2BTQB 1F3LA 3L41A 2A0UA 4TV8A 3O75A 2GAOA 3WGUA 3JZDA 3HVKA 3K70D 3M2TA 3OD1A 4IZHA 2FLVA 2Q4DA 2P6PA 3TRHA 1PQPA 4BWFB 1B3BA 3JQGA 1NW5A 3PC7A 3KJGA 1M2KA 1KTIA 3T5TA 1BFDA 4HQNA 4NFSA 1XTQA 2P6UA 3ACCA 3COSA 4QVKA 4F12A 3DP9A 3K9HA 1HOXA 3CUSA 1AZWA 4JUDX 1AKTA 3M9WA 3LOPA 1AHPA 5C5CA 1H8HD 1RNLA 2RBGA 2X5NA 1OT5A 2AX3A 3M83A 4HZUA 4JLWA 4I3HA 2PUTA 2RC6A 3DKIA 4AJEA 3VNBA 1HM5A 5JSHA 1JQKA 3O4VA 3NHFA 4H59A 4PC1A 2FW0A 4YV0A 3ZVMA 1C41A 3Q7SA 5KWIA 4MGYR 1ZVVA 1BJKA 4LS3A 4R31A 3QXCA 3PQ7A 4MEAA 1MMFB 2PVCA 1K7YA 2MMCA 5TF4A 4CDMA 4D97A 1TK9A 3CF2A 3Q6MA 1NSFA 2ZYSA 3LBYA 1W36D 1T6BY 3DV9A 2X7JA 3E2IA 4KXMA 5K3FB 2JAUA 3A9SA 4B8ZA 1G63A 1WX1A 3U3DA 5EHZA 1NBEA 5CNKA 4BB0A 1EYZA 1IQ0A 3AEUB 4ALLA 4N0EA 4KR6A 2ZJ3A 5FPHA 2K87A 1Z2OX 4QYMA 1ZWKA 4H6PA 2I6GA 1E5TA 3FMGA 2O6HA 5FTLA 5HTOA 2HHCA 2W71A 4B5LA 3D8RA 1UZUA 3DKPA 3IJEB 4J16A 1RADA 2GQ0A 4R40A 4ENWA 4XRGA 3M6AA 3AKDA 1OZFA 2B1JA 4Q9KA 2H08A 1J8VA 3VKUA 4B2YA 1T9GR 2JCXA 3PXBA 2P8JA 2FVYA 6REQA 2WAOA 1UKYA 3RBVA 3N5CA 4HJRA 1HV8A 1KSFX 1Z83A 2D59A 3PPWA 4L0CA 4ZGGA 5I7VA 3IPCA 5IU6A 3GJZA 4ZA2A 1TTPB 4EQZA 2C3UA 3I2HA 2PKRA 5H59A 4QD3A 3PIRA 3W8RA 3G5TA 4XJXA 4Z9AA 5IK2D 3U4CA 2O8FA 2IHBA 1DVRA 1JU9A 4Q37A 5CMLA 1DRKA 3ABSB 4EELA 2QRGA 3OP1A 4J0FA 4EKYA 1PR6A 2CNLA 5DU2A 1P1CA 1TFRA 4IIDA 1ZJZA 4K6HA 5COAA 3AOEA 4Y2TA 4BFVA 2D1RA 2PRSA 3I5YA 2HHHB 4PQRA 3VX3A 1TVCA 3VO1A 3I37X 2W6JD 3AF3A 2CVHA 3DOHA 1M1YA 4ZAWA 4UAGA 5JJKA 1Q74A 4JELA 5M5BA 1XTZA 1YRYE 3WHPA 1A96A 1TJYA 1G20E 3FI0A 3FSRA 3H84A 3H3FA 1FL9A 5FNVF 4RAOA 1E64A 4B5KA 4D0LB 2V59A 3JV7A 1SU8A 4UMEA 1UKZA 3ZHUA 2EF0A 3WQHA 1W0JD 1N7HA 5JQGA 2CKDA 1T9DA 5CEFA 3BD7A 1N9GB 1TTQB 3I04M 4O4IB 1P7CA 1MJHA 3GLKA 4IVPA 3GPDG 3TL2A 3O2NA 3QEAZ 1J20A 4OYYA 1G98A 4NZMA 1NA5A 5TR9A 4IRUB 4O3MA 1TUBA 4CUJA 1GAWA 4QSMA 4UBOA 4JBYA 4DLNA 4JI8B 2CNKA 3AFIA 3L6OO 3KLBA 1D7OA 1X1AA 4WEOA 2NACA 2OP0A 2XT9A 3SC2B 5JXJA 1IC6A 4AWBA 4GRDA 3BT7A 1FP4A 1SKQA 3SJAA 2C7QA 3BWMA 4RK7A 4MQEB 1CX9B 2GRAA 5CD9A 3RC2A 4EZEA 1DAMA 5J2TA 4MRPA 3VKGA 1DT3A 2Q6KA 3O8CA 1Z63A 1PK9A 3B60A 1TRHA 2HRCA 2YTZA 5LA6B 3WWEA 1QIMA 3D2AA 2BD0A 2IU3A 3N53A 2C61A 4J8PA 1DAFA 3JASA 1DADA 1H2ZA 4IRMA 2YWDA 3HSYA 3OPYA 3R8CA 3VO9A 4Z7OB 2XI4A 3HNOA 3SBEA 3ABOB 4G81A 2OD7A 4MCAA 3O8BA 5FV7A 3OE7D 1M0EA 4BO3A 3HI6A 2JGJA 3BFPA 3ZNQA 2XVZA 1GTSA 3KE9A 3LDUA 3ILXA 3PDHA 4IHJF 2PKCA 1A9QA 2QMZA 4DBVO 1UADA 2WFLB 1TB4A 5J4VA 4WKGA 4UXHA 2G1PA 1KYYA 3D1LA 1HNXB 3W4IA 3KSUA 2YMPA 1DRVA 2H2DA 5J47A 3D3KA 4QXMA 5CJ2A 2KW5A 4EO9A 4WKOA 3IVCA 1X1QA 3SU8A 3OCZA 5PNTA 2XNKA 3BXOA 4XWWA 4CV1A 1JBKA 3CPEA 2JGFA 3WSTA 2QMQA 3QZUA 4R6XA 2X2EA 2C99A 3GELA 3H0KA 4M8SA 5JCPA 1NHWA 2YUIA 2HCFA 3BULA 4KO8A 4XH9B 4XD2A 1AUQA 1P5ZB 2AOWA 4PONA 4W63A 5KSYA 4AJIA 2A9RA 3HYLA 5BV2P 4EA9A 3EIWA 4B7XA 4CW7A 4XYBA 2PGLA 4LOJA 5KYWA 3DVAA 4OO3A 4TV9B 2I4TA 2HWWA 2ZBGA 3A25A 4E7OA 5IPFA 4MV5A 4YEDA 3KPVA 1OASA 4Z49A 2ZDQA 1JNXX 1NNI1 3I3SR 1V1MB 1SCKA 1XDBA 3N0RA 5BV1A 3LPCA 2CHFA 1JA0A 5H5JA 1L5ZA 2YS6A 4GIBA 3LZCA 2NW6A 1CNMA 5KOYA 2Y1FA 5IDVA 1RHQA 5C7OO 1Z4IA 4OXRA 3RKSA 5BORA 4L5AA 2QTAA 5FL7D 3LC0A 4YCBA 1DIAA 2E37A 2AN4A 3RTAA 2QZPA 5H1YA 1UDAA 4G8JA 4O3FA 3W8FA 4UU1A 3FF4A 3SC2A 1PDVA 5CLHA 1II0A 4B0PA 2NO4A 3HWSA 5C5IA 1PFWA 4CF5A 3GLFE 2BEJA 1K8ZB 1YZYA 2H2HA 2PA3A 4DMCA 4CEJB 3USCS 3OX4A 5AM0A 4BX2A 3FTEA 3GA0A 1M8PA 4YRCA 4IGKA 3D9QX 1PV2A 4M1KA 1XA4A 2ZRMA 4E5KA 4RSMA 3FNBA 2DHEA 1OVMA 3VZRA 2WYIA 3PR3A 1SHZA 3A9WA 4RVNA 1WR8A 3SQXA 4KLNA 3EJWA 3ROPA 3QX7A 4AJPA 4YMVA 5LXTA 2CDCA 3QVVA 1VJ0A 3L8HA 2Z2KA 1BE1A 2GEVA 5FWDA 3LUJA 4JY7A 5TY0A 1DDGA 4PZ0A 2QRVA 2ZVDA 3HCFA 3I6MA 1GKUB 4KFSA 4N5NA 3TZHA 4ERXA 3ZJTA 1ZA1A 2W6OA 2WTXA 3D1JA 4M9SA 4MIKA 1NVKA 3TPFA 4FZ5A 1IUNA 3C7TA 4LSMA 1HC7A 2E4VA 3WLFA 1J2YA 4RZQA 4G0VA 3MWFA 3ZDQA 1MA0A 1QDUA 2TSYB 4CGZA 3HWX1 3HXPA 4H15A 2X14A 3TL6A 3LF1A 2OQVA 2WVGA 1TU0A 4IRXA 1G7SA 4OGGA 4L0QA 2PXXA 4U7JA 5DYGA 1JHAA 2A1UB 3WA7A 1AXRA 3T3NA 4LFAB 3LJKA 3TG8A 4AUEA 5CEEA 5F98A 4Z86A 1GUYA 2R4UA 3OETA 3K0AB 4DCUA 4LC1A 1JN0A 3N58A 3RC9A 4LDPA 4ZQIA 4L08A 4PSAA 5T41A 2B0JA 4UTZA 4DC0A 1U5CA 2DHDA 4JOSA 4PG4A 1H5QA 3NDIA 1G8AA 4S1PA 1P1BA 3ER6A 5G41A 2DP4E 3RREA 3W2TA 1UL1X 1MQ8B 5JZMA 3IEVA 2IXGA 3A4VA 3NTLA 1FQOA 4J7XA 4CM6A 1E7WA 3IMCA 5L45A 1BA3A 4RWZA 1RBQA 3IXMA 4O4HB 5E9JA 1T4BA 4G5HA 4Y1FA 5FBKA 5HTKA 2IC5A 5AKLA 4MR8A 1Y34E 1YUNA 2B82A 1IQPA 1LC3A 1WU7A 4S12A 2F3SA 4DDHA 5JRZA 4Q7EA 1CKEA 1FMTA 1JI0A 3INNA 4KCGA 5D85A 2HAEA 1FDSA 3MMPA 1ELOA 3RHTA 2AK2A 3ZJ5A 1YI1A 1QJCA 2XCQA 4GPAA 1FRQA 1TKAA 2AQ8A 2GEBA 2IDKA 2JJ8A 2BHSA 4LBYA 1UKCA 5AVJA 1SU4A 2NWQA 3SDBA 4E6EA 1N7IA 1F06A 1H05A 5CBKA 1SCIA 1Q91A 1XTKA 4K87A 3NOQA 4WY2A 2AWOA 5L3QA 4GEGA 3ZVNA 3UB3A 2Z1DA 1I1QB 3AF4A 5H4GA 1FVOA 1ZK4A 2XZDA 4FHEA 5AKJA 1W85A 2B4KA 2QQEA 3AR3A 3C1AA 3N2GB 4KH0A 1BWPA 4GX5A 3S1SA 1X7XB 1EUDA 2XY4A 2Y66A 3E23A 5KNBD 4WOCA 4C03A 1U3WA 2EZUA 4IDQA 3OLYA 4LJ4A 2VXCA 5A2GA 3N8NA 3Q10A 5I47A 1YQGA 5CYPA 2NU9B 2G72A 4D74A 2C94A 2JW5A 1UJ2A 4KL8S 5BQOA 4YWJA 1V7QA 1K63A 4GZ3A 3OICA 3HCAA 3QU5A 4P80A 4A1OA 3JQGB 2PXCA 4ERNA 3A14A 1KMIY 2BLNA 4ZYWA 3LUDA 3SCZA 1IY0A 1IHDA 4NEQA 4A8JC 3IP7A 4B3HA 1L5FA 2G4VA 2O07A 2OV4A 4B6QA 4RXUA 4J3JA 1GZHB 1HKHA 2GZSA 4CKXA 4NZZA 1AKEA 4RO0A 4BKQA 4C7OB 2EFDB 3HV2A 3DMGA 4HGOA 4DA9A 4POOA 4C4TA 1JXOA 3RRXA 4QT4A 1OB5A 1WXFA 3BIWA 4KIJA 2PKEA 5K6AC 2PGAA 3D5QA 1PJ3A 1BX0A 3TWOA 3H4IA 2R86A 1ZN9A 3P9IA 4XGIA 4KE8A 4FFRA 1W0KA 4URYR 3KX2A 3AUJB 3KHUA 3NHAA 3TOSA 2IEZA 2DB3A 3O1IC 1QGED 3QUSA 5J59A 4NCHA 3NVKI 3I9FA 1GZ4A 3ZU5A 4PPYA 1Q1GA 1DMSA 4B2LA 2BF4A 3HA7A 4HUQA 5KTSA 3ROTA 1BVHA 1NVFA 2PWYA 2BI7A 1U5BA 1GTVA 3GROA 3UW3A 5IVHA 5EPEA 4YDSA 3RIYA 2XB9A 2XW6A 4F97A 1HT2E 3G8YA 2YZ2A 2IV7A 3MT9A 1UFOA 1Z22A 3QLVA 1L4MA 4QEKA 1HT0A 1Y42X 2FSSA 2OWEA 2PSDA 3N8DA 4G2TA 3ICOA 2XX3A 4US2R 2Y71A 3GJTA 4NL4H 3PGA1 1KVSA 1EUCB 3LT0A 3HCBA 2PO5A 4NE9A 3MSCA 3JZMA 2FEWB 3AHCA 3GJRA 2F3RA 1RKXA 1KL7A 3OQBA 1JT2A 1DBIA 3H1AA 1JE0A 3P1JA 3ZV6A 3CF6R 3G2JA 4JYCA 2W37A 2X7HA 4LRWA 3RKUA 1SIWA 4DY4A 5JAOA 5L3QB 1UBNA 4MVYA 5F7XA 4YI5A 3OM1A 1DBPA 3U7HB 2RCYA 5ICCA 4WOPA 2F90A 1JT9A 2FG6C 2OMKA 2X0RA 4BECA 9LDTA 1MJGA 1YQDA 5ICMA 3J81k 2EFYA 2VQEB 5LOVF 1JR4A 2YUTA 3TTTA 2N47A 2Q6IA 1MG0A 1H6BA 3G3EA 4MO2A 4WIAA 4WKNA 3X2EA 4PG5A 4OL9A 3DE4X 2FCAA 1DC7A 2P5TB 1R8XA 5F3WB 4NDNE 1V43A 1JHUA 4RX1A 2XLBA 5KZMB 3B38A 2SHKA 1GL9B 1L0BA 1HLPA 1XLTA 1G7RA 1YZ3A 1JNYA 3TQSA 3ND5A 1Y1TA 1B3RA 3R5FA 2OT3B 3SSMA 2EHJA 2QP3A 4DZRA 2YZKA 2B30A 3BFVA 3OZUA 1JHRA 4LOLA 1YS9A 4E2XA 2O8CA 1GVHA 1EVIA 4EG8A 1DAGA 1QS0B 3SWWA 4PHFA 3G0OA 5FLEX 1BH6A 3SYRA 3WFZA 2OGSA 2RFLA 5CYGA 3J81A 2DQKA 1MC1A 4Q4LA 4WT7A 3VSAA 2FVXA 2GD0A 1IJFA 4TLBA 2YHUA 3C45A 3ZY3A 1EJBA 4CT4B 1T9AA 1MFPA 4UMDA 1EK0A 2BFPA 1YQWA 4U5QA 4AYWA 4UAUA 3WGZA 1E7QA 2Z98A 4EW6A 4ER7A 2O7VA 3USES 2FG7C 4KODA 3NDBB 4EGSA 2YYSA 5IJZA 2BE7A 4WDQA 4N0PA 3G0GA 3RLFA 3QFHA 5E2AA 1RRVA 1CXZA 1UPAA 3QEOA 1YFZA 2ADMA 4Y6LA 5EIBD 5GINE 3L7YA 1VCHA 3AM3A 2HSEA 3EOBI 3VKHA 4BAZA 4ND8B 1E9CA 3GJ6A 4HQOA 1E2IA 4KN6A 4B6GA 1GITA 1K3UB 4HDRB 3QLTA 3MCAA 4YUAA 2G3YA 3WYDA 2WMNB 4DDTA 3QKRB 4TV8B 1M73E 4MK4A 4OBBA 3RSLA 4CLOB 4RV9A 3CLKA 1D2CA 1M1NA 3ZPXA 1VIVA 2JAPA 1L5KA 1TJ5A 1WKBA 4K1LA 5ESRA 2JIBA 4LZLA 5EIFA 4BP3A 2ZU0C 1E92A 1LTHR 2TYSB 2UZ1A 5MFZA 2VA8A 4EY3A 4CEHB 1QHGA 1OE0A 2HIMA 1JTFA 4DUGD 1W88B 4MQLA 1Q15A 3SXPA 2R6DA 5G0UA 2G9VA 3DLIA 2XDYA 3PXAA 1CUAA 2V5AA 1PTKA 4JLKA 1P4AA 1BCRA 3GT0A 1PYOA 1SXHA 1KQNA 1DQNA 1H4SA 4LRUA 2GA8A 2IZ6A 1JPNA 4IG4A 4L8YA 4X3OA 5TMDA 2PWAA 2FLWA 2PFGA 4J49A 5KDOA 3ETLA 4D44A 2OP1A 2JJYA 2IY8A 4BNDB 1WQ3A 2JKZA 1VDMA 4WBXC 4UM8B 4YRSA 3A9VA 3NRCA 4XLLA 3S4YA 5F2OA 2OCBA 1SVUA 3L1VA 1RHMA 2AF3C 2LUOA 1DE0A 3F3KA 1SD5A 3T7TA 3TRKA 1WSWA 1CRPA 1WUIS 2VQDA 1NLMA 3D6HA 1JEDA 1YU9A 3UANA 2EX1A 4BE9A 2O8BB 1RJFA 3P0FA 2H1LA 1UKVY 1GTG1 1PJCA 1SAYA 2AW3A 4JUAA 1TIPA 5AOBA 2CLCX 2Z43A 2YV5A 4Q16A 4V0NA 5JXGA 1XPOA 3U4QB 2WTEA 1K8QA 4DLKA 3L92A 2H17A 1KO7A 2PMBA 5E9QA 3UT0A 4EMBA 2O1EA 3LWDA 5BV0A 1XVTA 2YQ5A 2V7EA 2A5DA 3I72A 3CZ5A 4U1RA 1GQQA 3L02A 4V0RA 1G2OA 1KP3A 3FNQA 4EG5A 3CX7A 5D01A 1H66A 1NXVA 3OX2A 1TGVA 3R5KA 4LJKA 3I62A 2P2SA 5ALIA 2ZSFA 3OZVA 4R2IA 3IT1A 5CIWA 1T6ZA 1DC6A 4MAAA 4KAJA 2REXB 3MGAA 1ZOLA 2AXEA 3QFFA 4B4KA 1Z5OA 2G0TA 2VL7A 1XWFA 2DT8A 3EFOB 3G89A 3LQKA 3P2YA 2ZP1A 3FRJA 5DHUA 2FY8A 2NTVA 3FLBA 1XRJA 3T0IA 4AY3A 2PK3A 1U4SA 4AJNA 4GRIA 3VJMA 3LP8A 7MHTA 2W6NA 5IAJA 2QVCA 5CURA 4KC0A 3RUDA 2PGXA 4HNVA 5TJ9A 4KN9S 3CISA 4ZZ2A 2XGOA 1VYUA 3EXAA 4OAPA 4BN5A 1P60A 3DBRB 4Z3OA 3JQ9C 1NJ2A 2JFHA 4OMUA 5AXAA 2VSYA 1Y1KE 4MR8B 1SOUA 3THOA 3EPPA 3D81A 2ZSBA 3V4OA 3MCZA 4EHAA 5SICE 3ZG6A 3ZE8A 4A5OA 1DL5A 5DMHA 2GHQA 2ENWA 1R4NB 1MZVA 2A30A 2JBAB 2XXAA 3DMHA 4Q1DA 5AQEA 4DRXA 1KEZA 4NMXB 1YDGA 1AF7A 4KE7A 5FLXA 3JQAA 4LXGA 3H8VA 5K03A 3UENA 2X4DA 4G89A 5FQNA 3OQJA 4EDHA 3BRWA 4BCBA 3KQHA 2OEPA 3TOVA 1L4LA 4LZPA 1RYYA 4FDUA 4XVUA 1LDYA 1TMGE 1VLJA 4PZCA 1MH9A 3ID6C 3ZBTA 2DPLA 3HLTA 1QO0A 821PA 5LYYA 3M6WA 3R0QA 3WMEA 1ZZGA 2GJ9A 2OK8A 4V02A 4CUZA 4JVLA 1DG1G 2WTUA 4G1BA 2IXFA 1UH5A 3CN9A 5HMLA 3ADPA 4OH1A 4N9WA 5GVRA 2D1TA 4REQA 3DEFA 1T10A 1UIRA 5G0WA 5BN4A 2IH5A 3B6MA 2PL1A 1CSEE 1MB3A 1S8NA 3HB4X 3W6NA 4CN8A 2J9GA 3X1XA 1TIBA 1GPUA 3H13A 3JYLA 4ZO7A 3AHDA 5I3ZA 4M88A 4FMDF 1EEHA 3OQMA 5JDIC 3KVVA 1MD9A 4BO7A 4DANA 2CHUA 4QDKA 2W83A 3Q5EA 3VJRA 4HAIA 2XCLA 1X2BA 1MX1A 1PVVA 4X94A 3SNKA 4H3SA 1N6KA 4QAJA 3PUWA 2IXTA 3Q98A 3PT5A 2CFCA 2WSMA 4KV9A 1DB3A 3GY0A 4U02A 5I45A 2XDQB 2P7HA 3TIVA 4M0LA 5LQSA 3UXHA 2I2FA 4J0EA 3SJZA 3UPTA 2XGSA 4CG1A 5EKUA 4LYGA 5IRCD 3T95A 5EE5B 1VHJA 1UBEA 4UEQA 1QIFA 4LSWA 2H06A 4YH1A 2WB4A 3MCUA 4RKRA 1ZUIA 5CU7A 4GE0A 1Y5NA 1GZ6A 2ZSDA 4CHTA 1CQJB 4EJFA 2ZJBA 2QYTA 3IAS6 4HRVA 3UPUA 1XA0A 1L5QA 3H18A 5ILOA 3O8OA 5LQCA 2GMWA 1OU0A 1Q2UA 2D54A 4DREA 2FH5B 4GWGA 2G36A 1UDXA 2EG5A 1JU4A 2B7LA 3LW7A 2DWCA 3WRYC 2A0FA 1ZM4A 2OHXA 5FWAA 4JXZA 1WZCA 1BE0A 3O2JA 3OQIB 4NU8X 3SKVA 3DM5A 2DXIA 1YRWA 1GJRA 1KI2A 2IUFA 1ZK3A 2M6SA 1Y4ZA 4KVZA 3UBMA 1YJAA 2BH9A 5CDGA 5HKAA 1I7SB 4KNYA 2XBUA 3KUKA 1GDTA 2XQFA 4GMGA 5A5FA 2OE2A 3H1PA 3AJEA 1OIXA 2WHEA 3DF7A 1I2DA 4G4GA 2RK6A 2B21A 1AGYA 2OO3A 2RC5A 2MSLA 2PFSA 3PXXA 4UNPA 5LLSA 1NBHA 4YQEA 1NBME 2Q4TA 1FFSA 4KQ9A 1DEKA 5E6UB 1UJMA 2XWJI 1W49A 4J90A 4JJFA 4OXNA 5G0TA 2BI4A 5TNXA 3UAXA 3FYUC 1W1WA 1S2GA 4EH1A 1BSVA 3DVAB 4TV9A 4FHZA 4X1KA 2O5EA 1LQTA 1IHPA 1P9OA 2NSJA 3EGDB 3KYDA 4MUFA 1TYZA 5F5LA 4COOA 4PIVA 3QW4B 3E27A 4M9UA 2F8MA 2CKMA 4F71A 4JP2A 5GGXA 4LJ5A 3RPEA 3JWGA 3FCEA 4YBZA 3TOXA 3O4GA 1AKYA 4O33A 3TX2A 4ZD6A 2UZAA 2IYTA 1Z37A 1ZVMA 2ZUBA 3DT9A 3G2PA 3JTEA 3W9YA 3VXKA 5J2UB 3RD5A 1EGQA 1BHJA 3ZW9A 1TVKB 2ATIA 2M1XA 2FRDC 2FFBA 5JW6A 2D5CA 1U7WA 2VPWA 1T5HX 4JU9A 3NUGA 3CUYA 5HZGA 3S8YA 3KJNA 3RADC 1P5HA 3UCEA 5AVUA 4WN9B 4JLNA 4XQ0A 3QMMA 4PCVA 1XYGA 2AKAB 3PJDA 1A9TA 4WY8A 3K15A 3AR7A 4L5YA 4Q6BA 4DMMA 2H0RA 5SZIA 4WZ6A 3PGJA 1HPLA 3UICA 5JQGF 1CIJA 2QN9A 3FVTA 1I30A 4JJ8A 2R65A 3OX3A 1UOOA 4M60A 2A88A 3DV0B 3CWQA 3OCCA 4FC6A 1ZMRA 4DR1B 2DH6A 4DW8A 1XD8A 1ZAKA 1VG1A 5DRYA 1ZONA 4HH4A 3JAKB 1O8CA 1WE2A 4QBKA 4YJGA 5CTJA 3M4ZA 5IAOA 2H85A 2A1UA 2VQ3A 2BKAA 3SKYA 4BBPA 1RKBA 4GNKA 4RCZA 3SS9X 3VNSA 4RJJA 4UM7A 1U9JA 3R41A 1DJOA 1TJ3A 3BL8A 5P21A 1LBHA 4ND6A 1NFRA 2XUDA 2O50A 4CG3A 2RGUA 3FHCB 2PX5A 4R8RA 5G1NA 2YVLA 4Q01A 4Y8VA 1ZK2A 1WB6A 3T9FA 2X13A 1ZVJA 3PRKE 5JO0A 2AK3A 1S3IA 2YICA 3MOIA 5NULA 5JZBA 1CUHA 4BBAA 2BKVA 4ZAFA 1SBNE 4JKOA 4AJ4A 4O4HA 3KT6A 4F2DA 2DZDA 2WJHA 5C1PA 6GPBA 1BGWA 5DYNA 1EFRA 5K3SA 1Z25A 1NY6A 3U4IA 4RYDA 3WWPA 5GVSA 2G6TA 5FT9A 3I2FA 1NT2A 2WTAA 1KK1A 4EENA 2HYIC 2WIJA 1GZ7A 2GPAA 1FTSA 3SC4A 3BM5A 3FYCA 5DM0A 3K0CA 3OOEA 1FYDA 3OBBA 3R3HA 1K6XA 4GSYA 4HVAA 5JNVA 3T3OA 1K5HA 1U90A 2DPXA 1JLRA 1JEJA 2AN3A 2IKQA 1OW3B 2WVHA 2X4LA 3OLZA 3SX2A 1O94C 1OBHA 3ECSA 3BWVA 3RRZA 1AF4A 1SKUA 4ZPJA 4PNEA 4AMUA 5C8YB 3EIOA 5I5GA 2IIQA 2PRIA 4RL4A 3KVRA 3U39A 4XB6B 1R37A 2QP4A 4OHOA 4CCSA 4OI0A 1G3QA 2KYRA 1VDZA 2VO1A 3RRBA 5ENVA 3SF8B 1USIA 2PTGA 3DLPX 4BU1A 3WMXA 4B8YA 4DN6A 4OQQA 4BWVA 1HKUA 1T8PA 3QK7A 3STXA 1GRNA 1UC8A 1XLTC 2D74A 5J4KA 5JDIA 3MHTA 3ZNNA 1XYYA 2GKSA 3KUDA 1YMVA 2E49A 2IU0A 5K0SA 4IIHA 2I62A 4G5RA 2ZGVA 1PJLA 3A1CA 3E4CA 5G1OA 1E9SA 4C1NA 4QEDA 2VCYA 4J0CA 4DWWA 4R8LA 2QGFA 5KYTA 2R6ZA 3W8DA 1CP3A 3CLUC 2IS4A 1JHXA 1YCGA 2A92A 3L01A 1KFBB 1AGNA 1P61B 1DUSA 4RENA 4NG4A 1AOXA 1IOLA 3R6GA 1RD4A 4YMTA 2JH3A 4FVTA 1T36B 3M6FA 4G1FA 5DI9A 5ILGA 2LGJA 3RS4A 5EWLA 4UTPA 1NXQA 5KQRA 3GNQA 3KEGA 1MRZA 3ZHZA 1JFRA 1O97D 4MW1A 1UMCA 1Y3IA 4KB5A 5DTJA 2WMOB 1DWQA 5ALHA 3L8YA 1GARA 5IZCC 2HRRA 1T0JB 2W2KA 2X2OA 1N2GA 4KLAA 4Q7LA 1GA1A 1C8BA 3CF4G 4U9IS 4LCJA 5DHTA 5LUBA 5K8TA 3CVYA 3KAPA 2WSSA 2B4YA 1SU6A 3LKZA 3H2YA 4K9MA 5T64A 2A4KA 2R1TA 4XPIB 5JNTA 5DFAA 3ZI0A 4Y2RA 1VGQA 3GZ4A 4JBNA 2GKGA 4X6LA 4EGAA 2AMJA 4EYGA 3U80A 2DHQA 5A0FA 4B35A 4QM7A 3QWAA 1YK0A 5DF1A 4YHHB 1Z7WA 3MWDA 3IT2A 4UU7A 3ZW8A 4Z7QB 3W4JA 4N82A 1JQBA 1A88A 1BMQA 2LXNA 4C5AA 4OSOA 1YS1X 1A76A 1EVYA 2QRMA 3OZDA 1IQUA 2DY0A 3SZOA 1Z5ZA 5FPYA 1J4AA 1K06A 1G7CA 3IP1A 1JZSA 1NW3A 3WLMA 3WVNA 3BB1A 2VXOA 1TCVA 1DXOA 3B3AA 3NDJA 2OXFA 3M4XA 1CZHA 1EWVA 1EHYA 3I0ZA 1L4YA 4DLYA 3PNSA 1VI2A 4E31A 2Q5OA 1OVGA 3L6DA 1WMAA 5CUQA 1JKMA 3F3SA 5KVQA 3LQFA 3O3OB 1M34E 2JIZA 1R8QA 4KQHA 2RHJA 3HBMA 1LVHA 2CFTA 3EGXB 4Y2UA 5BYBA 2JHCA 4YRKA 2EW1A 3EDMA 1PEYA 4NU6A 2CFOA 4I19A 1L4GA 2UYQA 4I6EA 3S2UA 4BASA 5BSEA 5B6JA 3D7MA 3GPBA 3IVMA 1CR0A 2JLYA 3R7DA 1N2XA 1RI2A 3UV7A 3FYUB 4TMKA 4L5BA 1XAGA 1YA4A 1R12A 4K9OA 3L7KA 2IF0A 2RBKA 1Z6AA 1U7PA 3T7EA 3E3AA 3MJSA 4O5OA 3GPIA 1QH1B 2P2LA 4PN3A 4ID3A 3KZVA 4JVOA 3NONA 4R68A 4MROA 3VSCA 1MO5A 2XD9A 2ZM5A 5AW4A 1IY8A 1UXIA 4HPJB 3UGTA 2HI0A 1TPZA 4OQZA 4NCBA 4DILA 1MOSA 4M49A 1FRNA 2CB0A 3VYWA 5CIYA 3ESDA 3GVPA 3LIPA 4QVIA 2CLDX 3GG2A 1X3SA 4Q03A 1M6HA 3EDCA 3KLMX 2WZQA 1E6CA 2XYHA 5CH3A 3I04A 3KSRA 1JU3A 2W6IA 2Y3IA 4NMHA 4BO0A 2GYYA 1EU1A 1ZD9A 3UA3A 5BSGA 4TLEA 1K5DA 3V6MA 3W3AH 3EPJA 1XK7A 1ZC3A 3DE2X 5KOHB 1R3DA 1X0XA 4INAA 3NKVA 1B26A 1OWOA 1YU6A 5INTA 1X1RA 2A9FA 3GEEA 3F3MA 5ALSA 4Z54A 1ACJA 5IKXA 4ZC1A 1KEVA 3GLFB 2HNBA 1L6IA 2XIJA 3QLVC 3FE2A 1AXGA 1QBKC 2C4UA 3NB0A 3TW4A 3ZQUA 2ZFUA 2WWHA 3PKJA 4XQGA 3EGEA 3MMNA 3ROFA 1I3KA 1X19A 2CBZA 3LKVA 1MB4A 1FFXB 1BHQ1 3ZZMA 1M2VA 5CFQA 4R16A 5TLSA 1C2TA 5D5HA 1C7JA 2WP0A 2FMXA 4R8KA 2XCRB 4ZT6A 4UD2A 1KVUA 1O9GA 3LUKA 4MW6A 1EKXA 3WO0A 4RPGA 1T25A 3USZA 5K8CA 1XEFA 3ZE0B 3RYIB 3WB2A 2BGIA 3NIBA 1WD7A 2JFNA 1A5TA 3WB9A 1QWOA 3IDFA 2OLEA 4LJ7A 4I08A 2PKQP 1ZJ6A 4FSHA 3TTSA 5MFPA 3WSWA 2GZDA 3BTUA 2WUVA 3PGKA 1XWWA 2NSHA 2I2WA 3NHBA 4MUIA 1I24A 2HMTA 4TKVA 1FFYA 3GRRA 1S1CA 4A4DA 4BB9A 4QYIA 3CKKA 4X65B 3F78A 2J7PA 3Q6IA 2F00A 1E79A 1KU0A 1H1LA 4V0ME 1QQTA 4I99A 1DQZA 4ZVMA 3C0KA 3UG6A 2QNRA 3MERA 3E9EA 1UBMS 2V5VA 5HXAA 8MHTA 2ZQ5A 4L4UA 3MBIA 3OA0A 5SY4A 1ZUD1 1UCFA 5C34B 2OGWA 1EDEA 3HH8A 1F4VA 1PHRA 1VKZA 5NLLA 3RIEA 4EG6A 5H16A 5KTMA 1NAIA 3JU3A 5I8PA 1SIBE 5E38A 4A8TA 1FU4A 1SNYA 4EG0A 7REQB 4ZREA 2QN7A 3GLGE 1QQ6A 4KYTA 2K7FA 3OIFA 3HZZA 4F6LA 1OXXK 1W5EA 4JYZA 4WJLA 5FJJA 5I4CA 4H6XA 3WGTA 2Q5EA 2QRLA 4HDMB 3PSAA 3AZOA 2I8AA 2VJBA 4L4YA 1CZKA 3HABA 2BFCB 1R3UA 1U6IA 3A4YA 4HSEA 3WMWA 4EI7A 1M67A 2BCEA 2PGNA 4PLPA 4QTUB 4BX0A 5DGIA 3C4JA 1P9WA 1BYUA 4KACA 1J6UA 5DMXA 2C4NA 4D6PA 2FMIA 2VQ6A 1I9CA 4P53A 2FP3A 4LDRA 4YJ3F 2UUAB 4AMBA 5LZ2A 1R9JA 3EMBA 3FYDA 4ZHSA 5J5CA 1UBSB 1ZD2P 4MW4A 2PSHA 3QUBA 1CR1A 1CNFA 1S2NA 2BJVA 4PAMA 3I6YA 4TOIA 4BNKA 4JQSA 4KPYA 4F3YA 2ZR9A 1GGKA 1UM9A 4UBKA 3HVIA 3PX2A 3L43A 1UDBA 4DCOA 3GJ8A 5AW8A 1N3BA 4E51A 4X62B 1Z4LA 1H6AA 2BUAA 3SD7A 2FGJA 1Z0JA 4Q02A 1NDHA 3IKJA 3VBEA 1M2VB 4M1OA 2VBFA 4YCNA 1WB4A 5T57A 3WKCA 3PVSA 4IS3A 5BVGA 3TQCA 2GXSA 1QMGA 1CTQA 1LJ8A 1OHHD 4NYJQ 4HXEB 3L1JA 4ITVA 3U40A 4NV3A 4HUTA 3OZ7A 5JCJA 3V97A 4B32A 5BVHB 3LBFA 4QTTB 2ZYGA 4QKQA 3GDFA 2XAUA 5JAPA 2ZCVA 1APBA 2VT6A 4X93A 1FB5A 4BC1A 1MZPA 5KQGA 2Y1LA 2WM9B 2W70A 5F76A 4AD8A 4JI6B 4G56A 1R66A 2Z6VA 2ZWOA 3WBKA 3MS4A 4BJHB 2EBFX 3HXTA 4XWGA 2JLQA 4ILKA 5JASA 3CS3A 5JSQA 2OFXA 1HK7A 4N3CA 2G7ZA 2M98A 3IFSA 5E7IA 4FBGA 1QYVA 3JQ7A 3DBRA 4LWPA 2X1VA 4W1RA 1EINA 3R09A 3WWDA 3HA3A 4BO4A 4OQPA 1KMHB 3KQMA 3V4RA 4FE3A 5AVKA 4WBNF 4KIWA 5T6BA 2V98A 1TUGA 1QHEA 1SZJG 2JAOA 4L07A 2CYBA 3JQ8B 4DSNA 3GFQA 3CPHA 4LDZA 2YFHA 1PJ2A 1UBTS 3BMQA 3QBVA 4ZYZA 3WZLA 1FFWA 1ECGA 2YV3A 3GR6A 4Q39A 2QPTA 1JI3A 5AVRA 2YHAA 3NEAA 1WW2A 3GZNA 1JLMA 1UP6A 1IULA 3TL3A 3NATA 5I51A 5EIXA 1PVOA 3EASA 4RK0A 2DKOA 1IHOA 1ONOA 2QYOA 1HE3A 1P1IA 1T5TA 4XM1A 3P52A 4EA8A 1FTYA 2W2LA 3OESA 4AUKA 5KSOA 4OX9Y 3LQ4A 2XDQA 2ZI5A 5JNLA 1QQ7A 1SC9A 3KB8A 1FIUA 5JS2A 3H3XA 1Q17A 1CUZA 3B2QA 2DBYA 2H4YA 2YDXA 4NU5A 4ZVPA 5CGQB 3RVKA 5FOSA 2WF5A 3JALA 2W5UA 2YY7A 1RQ7A 3GMDA 3W3AA 5ES3A 5JC1A 2HK7A 4BMOB 1PTJC 3FKSD 2NT3A 1WUYA 4YRTA 1HY3A 2W0SA 3AR8A 2OCPA 2PX0A 4HAXA 4X24A 1PBNA 1IEQA 1BDIA 2P62A 3DOOA 2D62A 3ZC3A 4D2IA 2BL4A 4KBFA 1RTKA 1NMEA 2Z2JA 1QK5A 3CW2A 2HHLA 2BN4A 3CLRC 1T3LA 4B3DA 3JZIA 1G5QA 1ULUA 3BE8A 2H7VA 1XJWA 1NW6A 2Q4OA 3IIJA 1NMQA 3VO2A 4DWVA 3N1UA 3K0EA 1R1DA 3NCHA 3SHWA 5FUMA 1OBFO 2WYWA 3DYVA 1U3UA 3NTRA 5H02A 3LH5A 1N36B 2Q0QA 1PZHA 5DGXA 1XPRA 2RGXA 3EE6A 4HGZA 5LNK6 3AWDA 2AZXA 2G83A 3DTYA 1ZHOA 4OFBA 4ZO6A 5IT4A 2WYOA 3N74A 3U37A 4ZQFA 3CMCO 3KVOA 4LE2A 4OP1A 2QRKA 2JFUA 2JJ2D 4IDPA 5EERA 1HYBA 5AOCA 2Q7XA 4BZWA 4NZOA 2EWWA 1JDZA 1J09A 1NVAA 4XPIA 2I1VB 2V7UA 3DPUA 3ZTWA 4EB3A 5L3SB 4UUNA 1Z8FA 1TI7A 3H83A 1BFUA 4XM2A 3OZEA 3ON5A 5HYVA 1SN7A 3QMWA 2OZEA 5BW4A 2O1XA 1QO0D 5DBOA 2O2GA 4UUQA 3BS4A 1H2HA 3GLVA 1T26A 2V0CA 2JZOA 2X8BA 2OM2A 1QTNA 1B6TA 3F5DA 4FGSA 4FYVA 4JEUA 3WB0A 1X8KA 2RHTA 3EBLA 2PCJA 2BMDA 3SZGA 3G88A 4KXYA 1HA3A 3FFWA 1U98A 4RMIA 1MIHA 2QDXA 1CB7A 3TOCA 1Q1AA 4CCAA 1XDDA 4FYYA 1XALA 2MMGA 5CB4B 4ND1A 2J48A 2FETA 1NUUA 5KAPA 4QO7A 1OCEA 1NJ5A 1ZCZA 3RUPA 3ZVKA 1HO3A 1YRAA 1Z3IX 3OP4A 1KI9A 2FZLA 1DG9A 2JH9A 3I8XA 3ILHA 3MAJA 4P22A 4Y7CA 5IC5A 3ZWYA 5CK5A 3GP5A 3CLTD 1WMFA 1XZ8A 2NZJA 4DCMA 2Y1DA 4KOAA 4KWIA 1W75A 4PRLA 2XCUA 3EXIA 1Z2EA 2LW7A 4F7DA 6YASA 5HFAA 1BWQA 4C5CA 4JEIA 4WFQA 5FYDA 3AHFA 4FFBA 4FHDA 3T54A 1HFEL 1MT3A 5F2EA 4D3YA 5LP1A 3HHEA 3BDIA 4YMWA 3KPWA 4TRRA 3U7JA 4EVSA 1B8OA 1SOMA 1N6LA 2X9QA 2XHZA 3VA7A 3T5CA 2ZTLA 2J33A 2KWIA 2ZI3A 3CLSD 2RKBA 4QRHA 2BP7B 2OHHA 4RVUA 3QOFA 2JL1A 1CY8A 2COEA 2QM8A 1NDUA 1LVGA 2IYOA 2PUEA 1CDEA 1YO6A 3F8WA 2P75A 1NKTA 3LUFA 4G5XA 5DCLA 3EUEA 1QHSA 1N4AA 1RMTA 3MJFA 3OKCA 3TIFA 4E88A 2EEPA 1Y4AE 5DDIP 5TJHA 2ZCJA 2ZBPA 3W04A 4I1SA 1TQDA 2WWVD 4FFLA 4RDXA 1N3YA 4JB2A 4IYRA 1GN8A 2CSXA 2NU6B 2H1FA 1HE1C 4LYFA 1PKEA 3GGOA 5L7YA 4S2EA 1RRCA 3AFOA 5L7WA 2QRUA 1YNSA 3ES9A 2AW5A 2E89A 2JZCA 2QLBA 2VYVA 2ZWVA 5C8XA 3DF9A 5FAXA 3TKAA 1ZITA 1C9NA 2ZJ0A 3BWXA 3GHYA 4MMYB 4R1UA 4M1MA 5AI9A 1T9BA 5EQTA 3E5MA 2EBWA 5MGBA 1JG4A 1A8IA 3ED1A 2JFVA 3MWGA 1ADCA 2GO1A 2HT6A 4YY3B 2Z1MA 3R8FA 2V6JA 3FPLA 2X2FA 3V5NA 4KUHA 1EE9A 2H2IA 4PC6A 1JZTA 3I8SA 3DB1A 3WR5A 1V71A 2X9GA 3CONA 2IYLD 2OPHA 4CIDA 5HWSA 4D46A 1JDUA 1S02A 4AG5A 2Y93A 3VZPA 1KH1A 4B9AA 2YV1A 4EO7A 1AKMA 2UZIR 4QTXA 2AG5A 1AQUA 3ETEA 3T9DA 5J1SB 2V65A 3DZFA 1GGFA 3OIDA 4JUFA 2AFIB 1B23P 3CTPA 3M8KA 4HLNA 5REQA 5C5DA 2FOLA 2QQ0A 4D79A 3GC6A 4LHWA 4ZVSA 2L69A 3DR5A 1DX6A 2H8KA 3P9XA 4MEJA 1H94A 3H2GA 4Y6SA 5AT1A 5CM8B 4HNAB 2XE6A 4GLBA 3A10A 4IFEA 5TC4A 1IQRA 1S89A 3V2GA 1AGXA 2RK3A 4HAYA 1T5DX 5K2OA 1OBVA 1VB3A 1V2GA 5ICGA 3FNRA 4FIDA 3SYTA 4DAOA 2XUJA 2B1QA 5K8UA 1A9RA 4JLJA 3VPDA 4LDAA 5K0ZA 3IBCA 4JHXA 4MCHA 5DSZA 1Z33A 2VOJA 5FP0A 1UQRA 5IM4F 4OP3A 3PEVA 2Y0BA 3GGGA 4L95C 4MI3A 1OXKB 5KEIA 4BKUA 3IELA 1ORRA 3DOEA 3E8MA 4OHPA 4V0KA 1K92A 1U8UA 1N57A 2QUIA 3UJCA 4BVLA 2CV1A 4WNIA 2AYYA 3NHZA 4CIWA 2XB6A 2ZJ2A 3H5NA 1QG4A 1O57A 3QH4A 1QSGA 3BK2A 1D4AA 4IH4A 4PRYA 4UDOA 3SMQA 2RGEA 1FU7A 1T2VA 3ANNA 5JV5A 1GADO 1NVDA 2O2DA 4FYMA 5HK9A 1K7XB 1Q0HA 2NQTA 2WA2A 3EDRA 4R4JA 5CNIA 5CA1F 4J7AA 4NTZA 1MIOA 3X1DA 3CRVA 1E5QA 2RGYA 2ZRFA 1RRKA 5GZ3A 2RKWA 2ZJZA 5IDQA 2PO7A 4UQLA 4Q1AA 1RLMA 3GBPA 3CLHA 4QPDA 3K6SA 2ZSUA 3FSEA 4I9NA 2BWJA 5EXTA 1LRLA 3PL1A 3OQIA 3DP7A 1WXDA 4I4IA 4Q4HA 3U1TA 3QE4A 4P93A 2GCPA 3OMXA 2G5PA 3IPYA 4A23A 4BLVA 3UC9A 4KSYA 4YRAA 1WPRA 4KW7A 5DGDA 5BWCA 1PP4A 5JMTA 1ODKA 4OYHA 1J21A 4K5QA 4Q1FA 2BEVB 2CZCA 1XDWA 5GJCA 4ZIRB 4I46A 1WB9A 3I6BA 2O3RA 2NNLD 5AMXA 3QVKA 1AZSC 4R8SA 4B79A 3BC1A 1X39A 4FE4A 4G01B 5F12A 3AVOA 5GGYA 5ESXA 3QUAA 3V2UA 3REOA 4EQ6A 4OQNA 2G80A 1NSYA 4MWTA 4HGYA 2PQ0A 4KQMA 3B36A 2MYPA 5JAUA 3SM3A 4LZJA 1VIYA 4FLEA 1PYGA 1NP7A 6PFKA 4X1YA 1JS1X 3BRWD 5HK8A 4D9NA 4TSRA 4OQDA 1BCSB 3GQBA 5HIIA 1E3MA 3HXLA 2G1UA 1ZINA 3EEQA 4I2VA 4PFKA 5GJVC 1O94D 1UC5B 1BU5A 2GZMA