1SLDB

Streptavidin, ph 7.5, bound to cyclic disulfide-bonded peptide ligand ac-chpqfc-nh2
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
121
structure length
121
Chain Sequence
b'AEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STREPTAVIDIN
publication title Binding to protein targets of peptidic leads discovered by phage display: crystal structures of streptavidin-bound linear and cyclic peptide ligands containing the HPQ sequence
pubmed doi rcsb
molecule tags Complex(biotin-binding protein/peptide)
total genus 24
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 1995-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 1sldB00
1SWPA 1LDQA 1NQMA 4BCSA 1VWJB 1MK5A 1SWDA 1MOYA 2RTMA 1AVDA 1DF8A 1VWCB 3RY1A 3SZJA 5IRWA 4IRWA 1SRHA 4GGZA 5IRAA 1MEPA 1SWOA 2C1SA 1SRJA 4GDAA 5L3YA 1LCVA 2IZJA 1HQQA 2RTIB 3SZHA 3WYQA 4GGTA 1SWJA 3WZPA 1SLDB 1SRIA 1LDOA 1VWKB 3RE5A 2BC3A 2FHNX 5CHKA 4YVBA 2G5LA 1N43A 1VWAB 2RTAA 1NDJA 2ZSCA 4BX7B 1STPA 1LCZA 3MM0A 2IZBA 1HY2A 2RTFB 1SWSA 2A8GA 4U46A 4CPHB 1VWLB 2AVIA 5CSEA 4Z2PA 3RDXA 2IZFB 3VHHA 1VWPB 1MM9A 2IZLB 1SWFA 2IZAA 2RTCB 4Z2OA 1Y55X 3T2WA 4JNJA 3RDQA 1SLGB 1VWEB 3VGWA 4BJ8A 2IZDB 4Y5DA 4Z2VA 4BX6B 2C4IA 1HXLA 1SWCA 3VHIA 1N4JA 1WBIA 1VWBB 5JD2A 1LCWA 1SWTA 2IZIA 3RE6A 2Y32A 1VWNB 4Y59A 1SWGA 4CPEA 3SZIA 1VWIB 2GH7A 4BX5B 4CPHA 2RTNB 1SLEB 2RTQB 1VWRB 5K67A 1SWKA 2IZEB 2CAMA 4I60A 4OKAA 1VWQB 1KL5A 2JGSA 2RTPB 2Y3EA 4Z27A 1SWLA 3T6LA 3T2XA 2MF6A 1AVEA 4EKVA 1SWUA 1STSB 1SLFB 2A5CA 1VWMB 2RTDB 1RSUB 3PK2A 2OF9A 3EW1A 3MG5A 1SRGA 2RTGB 4GJSA 5B5GA 1KL3A 1SWQA 4GGRA 4JO6A 4Z28A 2UZ2A 1SREA 2RTLA 1PTSA 1RAVA 1N9YA 3RDOA 1SWEA 2IZGB 2OFBA 1Y52X 3WZNA 1I9HA 2IZKA 1NC9A 3X00A 3RDMA 1NQNA 2OF8A 4BX5A 4BX7A 1SWNA 1NBXA 1VWDB 1SWAA 1VWOB 1VYOA 2IZHB 3RDUA 3VHMA 2RTJA 4CPIA 1RXHA 2RTBB 1LELA 4BBOA 1KFFA 2RTHB 2C1QA 1IJ8A 3WZQA 5K68A 1HXZA 1VWFB 1RXJA 2IZCB 2WPUA 1Y53X 2UYWA 4CPFA 1SWHA 2FHLA 1N9MA 1KL4A 2QCBA 1RXKA 3WZOA 4BX6A 2OFAA 4JHQA 5B5FA 1VWHB 1RSTB 2F01A 1VWGB 3EW2A 2Y3FA 1SWRA 4GD9A 2A5BA 5F2BA 3RDSA 3FDCA 4Z6JA 2RTOB 4GJVA 1N7YA 3WYPA 3T6FA 2RTRB 2RTKA 4DNEA 2RTEB 1LUQA 1SRFA 5IRUA 3RY2A 1SWBA 1STRB
chains in the Genus database with same CATH superfamily
1I4UA 1SWPA 2O62A 1LIBA 3VU1A 3EC5A 4LKTA 1VYGA 1FELA 5B11O 4DQ3A 4IAWA 1AVDA 3UEUA 4IRWA 4A1YA 2FR3A 4ZHDA 4O9SA 1JJXA 2RA6A 3VE1A 3OJYC 1SRJA 4GETA 4IBAA 4ZJ0A 1OPBA 4OS3A 2X32A 4QAEA 2GTFX 5HZ8A 1OPAA 2IZJA 5DPQA 4CDDA 5HCDC 4YMYA 1SWJA 1NGLA 3CKFA 4HWMA 3HTYA 5HTDA 4GE1A 1SY1A 1B8EA 2G7BA 2R73A 4YVBA 2FRSA 1N43A 2RTAA 2KW1A 3D9WA 2BHVA 4BX7B 3NADA 1FDQA 1OEKA 4LKPA 3ZW0B 3MM0A 2CZUA 3LTWA 1EW3A 1L6MA 1MUPA 2RTFB 2FTBA 3FIDA 3APXA 1ZNHA 2F73A 5FQ8E 2FR2A 1X8QA 5CSEA 3DSZA 5F58A 1EPBA 3VG3A 2EU7X 3RDXA 4ZH6A 4O3ZA 3VHHA 1MM9A 3ELZA 3KFIA 1O8VA 3F9DA 1X8NA 4YFRA 3NX1A 4Z2OA 3RZYA 5AEOA 1VWEB 3VGWA 1E06A 1LNMA 3H3IA 4BX6B 1HXLA 4FGIB 4UU3A 4OMWA 3VHIA 1DV9A 2Q2PA 3APUA 5EEDA 3D4RA 2QO5A 3C78X 1PBYA 2LB6A 1X71A 3ZW0A 3I0AA 4QQ1A 4UU2A 2OL6O 3PQUA 5DG4A 2WEWA 3FMZA 3ZW1B 2RTNB 1IFBA 1SWKA 3KZAA 4ML7B 3FA6A 4OKAA 3BY0A 4COTA 3EBWA 5AJCA 5IO5A 3FIQA 4LZUA 4KC8A 1U0XA 1AVEA 1CBIA 5KIDA 1JYJA 1STSB 3NQKA 1SLFB 1HBQA 2QMIA 2QO6A 5KHPA 1RSUB 4ZHGA 3FEKA 1ZNEA 4KCAA 1SRGA 2OY1O 3RSWA 4KIIA 4GGRA 1JZUA 4Z28A 2GTLO 1HMTA 5C0NA 4WFUA 3PH6A 3TGBA 4HPAA 2IZGB 2WEXA 1OBQA 4ZH9A 5LJEA 2IZKA 2NNQA 3QQ2A 5JR8A 2LFOA 3RDMA 3ZQ3A 2L67A 3EBKA 3S26A 1QWDA 3WBGA 3WJGA 1EXSA 1SWAA 1VWOB 2ANSA 2IZHB 3P6EA 4YGHA 4GUZA 1BBPA 1RXHA 2OVSA 3DTQA 2I5ZO 4A1HA 4BBOA 4WBKA 1ZNKA 4NYRA 3U03A 5IO6A 1ZRYA 3EYCA 5D4AA 3SLOA 3WZQA 2K23A 2XSTA 4OELA 4R0BA 4FBRA 1BSQA 3P6GA 4CPFA 4EXZA 2Z4IA 5LJDA 1IIUA 4ALOA 1N9MA 2CM4A 1UZ2X 3FA7A 5BVQA 3FELA 3BU9A 1Y0GA 5B5FA 2OVAA 2F01A 2K62A 3O2YA 3Q34A 1GKAA 1SWRA 1T8VA 1I78A 2A5BA 2CM9A 5F2BA 3F8AA 4NV8A 4GJVA 1N7YA 2HZRA 2HYSA 1O1VA 4NNSA 4O3XB 5H9AA 4WHIA 1KQWA 1T0VA 3EMMA 3P02A 4I95A 4ARHA 4TQ2A 3TGCA 1LUQA 5F1EA 4IABA 4O3YA 4NNTA 2LBAA 1R0UA 4ZHFA 1QFTA 1STRB 2AKQA 1UYOX 1SA8A 4KH8A 1LDQA 5L8NA 2MM3A 3QKGA 4OS8A 4PJ2A 4YKMA 3T1DA 1K24A 1UYNX 1G74A 4AZRA 3RY1A 1AVGI 3SZJA 2BSZA 4TKHA 4U8UN 1SRHA 1ALBA 3UEWA 4GGZA 3U9PC 1GT5A 3FR2A 3SLTA 1YWBA 2KD2A 2L68A 2YG2A 4AZNA 1SXXA 4GDAA 1O1UA 1TOWA 1CBSA 4YFQA 4I3DA 5H9KA 1LKEA 3F6ZB 5K06A 1CJ5A 1HQQA 4GGTA 2FGSA 5CYBA 4PSQA 1QY1A 1SLDB 2MWHA 2WQ9A 3E3CA 1LDOA 1VWKB 3TF6A 2AT3X 3FENA 3VG2A 2X45A 1JBHA 1JIWI 5CHKA 2A2UA 1BRQA 5FAZA 5IO7A 1GX8A 2G5LA 1X8PA 1VWAB 2R56A 5L8OA 1BLRA 2ACPX 1STPA 3C77X 4KC7A 1LCZA 3NPOA 4ES7A 5F6ZA 2HZQA 1LPJA 4IAXA 4ALBA 1QY0A 4ORRA 1KZWA 4CPHB 1KQXA 1E02A 2CBRA 4XMGA 4QYPA 4YCHA 1BSYA 1VWPB 4CK4A 1SWFA 2FS6A 3NR3A 3HWEA 2HMBA 4IMOA 4Z2VA 4QGXA 1N4JA 1WBIA 4B55A 1VWBB 3MBTA 4GRJA 3STMX 5HA1A 2IZIA 2Q2MA 2Q9SA 3L4RA 3O19A 3BSZE 3ZI8A 2OYBO 4YGZA 3AKNA 1E00A 1VWNB 1DF3A 2ALLX 1SWGA 1VWIB 2GH7A 2PI3O 2MO5A 4GU8A 1SLEB 4QNIA 4BX5B 4CPHA 2IZEB 2CAMA 4I60A 1ERBA 1VWQB 1NP1A 5HZ6A 2RTPB 4M6SA 1DZPA 2Y3EA 3T6LA 3CBSA 1QY2A 3G7XA 1EPAA 2CBSA 1OBPA 1CRBA 3PEDA 1ZNLA 1RBPA 4D6AA 2JU3A 1MX8A 4ORSA 1VWMB 5F6BA 3PK2A 1BWYA 2OF9A 1LFOA 3EW1A 5B5GA 3CQNA 4HFOA 5HTEA 1SREA 2Q39A 4O4SA 4GK9A 1N9YA 1W5RA 1SWEA 1YIVA 2OFBA 4GKCA 4O4UA 4Y0RA 2ZAIA 4GNYA 1GX9A 1DC9A 1IKJA 1NQNA 2GTLN 3ZUIA 1A18A 4BX5A 4BX7A 1SWNA 4GH7A 3SOTA 2WWPA 2R74A 1VYOA 4N7CA 3CWKA 3VHMA 4YCEA 2FLJA 4CPIA 4FQBB 3FW5A 4HPCA 4ODDA 4RUUA 5B27A 1MDCA 3BX7A 3B2JA 2PY1A 1KFFA 2RTHB 2C1QA 1IJ8A 4YH0A 2OY7A 3VG6A 5H8TA 1EALA 2FS7A 3FA9A 5HWZA 1S2PA 1X8OA 2WPUA 1RLBE 1SWHA 3D95A 3KFFA 4BX6A 4QRLA 4YGGA 1SXUA 3PECA 3KVNA 2X4MA 1RSTB 1GT3A 4QGWA 2AT5X 1D3SA 1VWGB 3EW2A 2F09A 2MJIA 3FW4A 4I9RA 5HA0A 1LIEA 3WJFA 2BS5A 5L8IA 2YMSA 2A2GA 2NP1A 3IFBA 3WYPA 4D6BA 4CDFA 1AB0A 5LJCA 1LF7A 2OL7A 4NYQA 5HBSA 2RTKA 3RKGA 4MVEA 3ZW1A 2RTEB 4EEJA 1XKIA 3FEPA 1GT1A 3LHNA 1SWBA 4XMDA 1NP4A 1MK5A 1SWDA 3PP6A 1SXYA 3BS2A 4N7DA 1MOYA 2RTMA 3AUMO 3LV4A 1KT4A 1WUBA 1DF8A 4OEMA 4AW8A 3P6HA 2OVEA 5IRAA 4TKBA 2XKLA 3N91A 1MEPA 3FA8A 3HWFA 3WVMA 4QZTA 1LCVA 1PMPA 4FBOA 4CV7A 1SY2A 3S5VA 2RN4A 3STNA 4MIRA 1IKEA 3SAOA 2RTIB 1JMZA 1SXWA 4IB6A 3SZHA 3KQ0A 1ICMA 3V8UA 4YDBA 3WYQA 3WZPA 4A60A 1SRIA 5BVTA 4IMNA 4AYHA 3P6CA 1GGLA 3HPEA 4NLJA 1EQDA 2X34A 5IRWA 3OBLA 1DZKA 1HMSA 1BM5A 3APVA 3RWXA 4QZUA 1I06A 2IZBA 1HY2A 2AF5A 4O4OA 2Q4NA 4OMXA 2AMMX 4MEEA 1SWSA 4ID2A 5BVSA 1VWLB 3ZZVA 1FJ1E 2AVIA 2L9CA 4GZVA 4XMCA 4YBUA 4DCBA 1SMPI 2IZFB 3HOLA 2IZLB 2IZAA 4TNNA 4L3RA 5B29A 1KOIA 4O3WA 1Y55X 4MVKA 3T2WA 3RDQA 2M4LA 4QYNA 2IZDB 1FE3A 4HPBA 3WJCA 5B10O 1HQPA 4I6SA 3CR6A 3ZUOA 1OSPO 2FT9A 4ORXA 3GE2A 3HWDA 4O49A 3BU1A 4YDAA 1LCWA 4U8UM 1OBUA 2OZQA 3O22A 1BRPA 3APWA 4CSBA 4TJZA 2Y32A 1KZXA 4K19A 4TKJA 1BJ7A 2W2BA 2HLVA 4Y59A 3SZIA 2ACOA 2OL8O 3BRNA 1G85A 2RTQB 4ZFXA 2JU7A 1YP6A 1KL5A 2AL0X 1BEBA 1MVGA 3VG4A 4CDEA 3B2LA 1QABE 1SWLA 1X89A 3S5XA 4Z27A 4M7MA 3T2XA 5HAEA 4EKVA 1YP7A 4INNA 1D2UA 1N0SA 3OD9A 1TVQA 1Z24A 1KT7A 2RTDB 3AEHA 4FBVA 2WQAE 2FKGA 5K68A 2RTGB 4GJSA 1KL3A 1SWQA 1DFVA 2G79A 1QFVA 4NW4A 1E2TA 1PTSA 1RAVA 2RTLA 2AH7X 3OE3A 3RDOA 5HCCC 4U3QA 2LBVA 1HMRA 3CMPA 1FEMA 3IA8A 1I9HA 1NC9A 3X00A 2JOZA 3PPTA 3EM0A 4NV7A 3S60A 2OFRX 2OF8A 2LA7A 2QOSC 2W2AA 2ZAGA 1NBXA 2HKDA 4GDZA 4I3BA 3SLJA 4YBPA 5FENA 1X8UA 3RDUA 4I3CA 4DQ4A 2AT6X 4U8UO 3TGAA 1B56A 2RD7C 3ZW2A 5EDCA 2JMBA 1JYDA 1ZNDA 1GM6A 1K3BA 4Y0SA 4AZMA 1OEEA 2QOMA 3VG7A 3K3LA 1RXJA 2IZCB 2WR6A 3MVFA 4BQUA 2FHLA 1AELA 1VYFA 3WOVA 1H91A 2QCBA 1YWCA 2OY8A 3WZOA 2X8FA 1VWHB 2G8CO 3FR4A 3VPJE 3STKA 3GAQA 2ASNX 4TLJA 5D47A 3CBCA 3FDCA 2X46A 3WJEA 4ZHHA 1T68X 3C76X 2RTRB 4DNEA 1ERXA 1SRFA 4QGVA 4BOEA 5EEEA 4U9CA 4Z6JA 1JJUA 3UAQA 2X55A 4MISA 1LIDA 1NQMA 1VWJB 3UEXA 3NX2A 4BCSA 4C5PA 2IFBA 3NP1A 1BSOA 2DJGA 3P6FA 4WFVA 1KT5A 1VWCB 3CKGA 2BT9A 2GTLM 1G7NA 1HN2A 4OS0A 4ORYA 5HZQA 5LJBA 2BS6A 2X56A 1JJJA 1G5WA 1S44A 1SWOA 3HK1A 2C1SA 4IB9A 5LJHA 2HNXA 4ORWA 5L3YA 1P6PA 4L1NA 3UEVA 4AZQA 2X8SA 3Q6LA 1JMXA 2BLGA 2MHDA 2JW1A 3B2KA 4LZVA 2P8GA 5D8JA 4A8ZA 5BYPA 1QG5A 2GC9A 1A57A 5B3MO 1EUOA 4AZOA 5LJKA 1KGLA 4XMEA 4YFPA 4LQZA 1CBRA 5F7GA 4ZHCA 2RQ0A 1AQBA 3RE5A 2BC3A 2FHNX 1A3YA 1YWDA 2L5PA 5KICA 5AQ6A 2JN3A 1IW2A 3P6DA 2ZSCA 3BLGA 1NDJA 3WJBA 2QM9A 1VPRA 1A2DA 2A3FX 1JQPA 2G78A 4IB7A 1KXOA 2KTDA 2QO4A 3FLLA 3KFHA 2VFCA 4RUNA 5FQ6E 1YUPA 1U18A 2A8GA 3FYFA 4U46A 1YWAA 5LKEA 1I05A 4Z2PA 1U17A 5D45A 4EQAC 3RBYA 1B0OA 3B2IA 4O4XA 4BVMA 2RTCB 3D96A 2DJFA 4JGLA 4JNJA 3HOEA 3PQSA 1SLGB 4HPDA 5FFHA 4BJ8A 1TXLA 4KT5A 2VDFA 1EIOA 1ML7A 4Y5DA 2C4IA 1SWCA 1DZMA 3ELXA 4BGFA 2KTSA 1CBQA 5AJBA 5JD2A 4NP1A 1SWTA 5HZ9A 2AT8X 1GKAB 2KT4B 3RE6A 3B2HA 1KT3A 1PBOA 2A0AA 1ICNA 4CPEA 4EFGA 3TZSA 1IFCA 4ZGUA 1VWRB 4XMHA 4MVIA 5K67A 3U0DA 5H9LA 2JGSA 1KT6A 3PH5A 1W6FA 2OY5O 2MF6A 5D48A 1SWUA 1ADLA 3NBXX 4NLIA 3KFGA 3PDFA 2A5CA 3D97A 5HZ5A 3MX7A 2VFBA 5EDBA 2DM5A 3JSQA 1XCAA 2WUTA 3MG5A 4Y0PA 5EPQA 4GNWA 2LKKA 1SY3A 1ZNGA 1FENA 2UZ2A 4JO6A 1E5PA 3VG5A 3BDRA 3JS1A 2OFMX 4ORUA 1Y52X 4ZGFA 3WZNA 4XMFA 2RCQA 4MVLA 1EIIA 5EZ2A 1JV4A 5H9NA 5IXGA 3WJDA 1GT4A 1VWDB 3ZWEA 2FWVA 2A13A 2RTJA 3WXQA 2RTBB 1GXAA 1OEJA 1LELA 1QQSA 4I9SA 3VE2A 3HWGA 1Y9TA 2X8TA 1PEEA 2I5VO 3JQOA 5CE4A 1B4MA 2NNEA 4IB8A 1HBPA 4ON1A 2W2FA 1HXZA 3CQRA 1VWFB 1LICA 1W4TA 4YKOA 1ACDA 1Y53X 2UYWA 3NQ3A 1I04A 4Y0QA 2N93A 4AZPA 2FKJA 1KL4A 1TW4A 1RXKA 1LIFA 2CZTA 2OFAA 2E4JA 3AKMA 2RCTA 1FTPA 1PM1X 2JU8A 3NQ9A 4JHQA 1DZJA 2NNDA 1MX7A 5FQ7E 2GJ5A 5HCEC 5LJGA 2WSJA 3FR5A 2AT0X 4GD9A 1S7DA 2Y3FA 4ZR2A 1EI5A 4CDCA 2Z4HA 3RDSA 2RTOB 2OVDA 3BX8A 5LKFA 3T6FA 1SY0A 4ZCBA 3I17A 1Y9LA 2POAA 4EDEA 1GX3A 1TOUA 5IRUA 1UREA 3RY2A 3P24A 5B2AO
chains in the Genus database with same CATH topology
1SWPA 1LDQA 1NQMA 4BCSA 1VWJB 1MK5A 1SWDA 1MOYA 2RTMA 1AVDA 1DF8A 1VWCB 3RY1A 3SZJA 5IRWA 4IRWA 1SRHA 4GGZA 5IRAA 1MEPA 1SWOA 2C1SA 1SRJA 4GDAA 5L3YA 1LCVA 2IZJA 1HQQA 2RTIB 3SZHA 3WYQA 4GGTA 1SWJA 3WZPA 1SLDB 1SRIA 1LDOA 1VWKB 3RE5A 2BC3A 2FHNX 5CHKA 4YVBA 2G5LA 1N43A 1VWAB 2RTAA 1NDJA 2ZSCA 4BX7B 1STPA 1LCZA 3MM0A 2IZBA 1HY2A 2RTFB 1SWSA 2A8GA 4U46A 4CPHB 1VWLB 2AVIA 5CSEA 4Z2PA 3RDXA 2IZFB 3VHHA 1VWPB 1MM9A 2IZLB 1SWFA 2IZAA 2RTCB 4Z2OA 1Y55X 3T2WA 4JNJA 3RDQA 1SLGB 1VWEB 3VGWA 4BJ8A 2IZDB 4Y5DA 4Z2VA 4BX6B 2C4IA 1HXLA 1SWCA 3VHIA 1N4JA 1WBIA 1VWBB 5JD2A 1LCWA 1SWTA 2IZIA 3RE6A 2Y32A 1VWNB 4Y59A 1SWGA 4CPEA 3SZIA 1VWIB 2GH7A 4BX5B 4CPHA 2RTNB 1SLEB 2RTQB 1VWRB 5K67A 1SWKA 2IZEB 2CAMA 4I60A 4OKAA 1VWQB 1KL5A 2JGSA 2RTPB 2Y3EA 4Z27A 1SWLA 3T6LA 3T2XA 2MF6A 1AVEA 4EKVA 1SWUA 1STSB 1SLFB 2A5CA 1VWMB 2RTDB 1RSUB 3PK2A 2OF9A 3EW1A 3MG5A 1SRGA 2RTGB 4GJSA 5B5GA 1KL3A 1SWQA 4GGRA 4JO6A 4Z28A 2UZ2A 1SREA 2RTLA 1PTSA 1RAVA 1N9YA 3RDOA 1SWEA 2IZGB 2OFBA 1Y52X 3WZNA 1I9HA 2IZKA 1NC9A 3X00A 3RDMA 1NQNA 2OF8A 4BX5A 4BX7A 1SWNA 1NBXA 1VWDB 1SWAA 1VWOB 1VYOA 2IZHB 3RDUA 3VHMA 2RTJA 4CPIA 1RXHA 2RTBB 1LELA 4BBOA 1KFFA 2RTHB 2C1QA 1IJ8A 3WZQA 5K68A 1HXZA 1VWFB 1RXJA 2IZCB 2WPUA 1Y53X 2UYWA 4CPFA 1SWHA 2FHLA 1N9MA 1KL4A 2QCBA 1RXKA 3WZOA 4BX6A 2OFAA 4JHQA 5B5FA 1VWHB 1RSTB 2F01A 1VWGB 3EW2A 2Y3FA 1SWRA 4GD9A 2A5BA 5F2BA 3RDSA 3FDCA 4Z6JA 2RTOB 4GJVA 1N7YA 3WYPA 3T6FA 2RTRB 2RTKA 4DNEA 2RTEB 1LUQA 1SRFA 5IRUA 3RY2A 1SWBA 1STRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SWP A;  1LDQ A;  1NQM A;  4BCS A;  1VWJ B;  1MK5 A;  1SWD A;  1MOY A;  2RTM A;  1AVD A;  1DF8 A;  1VWC B;  3RY1 A;  3SZJ A;  5IRW A;  4IRW A;  1SRH A;  4GGZ A;  5IRA A;  1MEP A;  1SWO A;  2C1S A;  1SRJ A;  4GDA A;  5L3Y A;  1LCV A;  2IZJ A;  1HQQ A;  2RTI B;  3SZH A;  3WYQ A;  4GGT A;  1SWJ A;  3WZP A;  1SLD B;  1SRI A;  1LDO A;  1VWK B;  3RE5 A;  2BC3 A;  2FHN X;  5CHK A;  4YVB A;  2G5L A;  1N43 A;  1VWA B;  2RTA A;  1NDJ A;  2ZSC A;  4BX7 B;  1STP A;  1LCZ A;  3MM0 A;  2IZB A;  1HY2 A;  2RTF B;  1SWS A;  2A8G A;  4U46 A;  4CPH B;  1VWL B;  2AVI A;  5CSE A;  4Z2P A;  3RDX A;  2IZF B;  3VHH A;  1VWP B;  1MM9 A;  2IZL B;  1SWF A;  2IZA A;  2RTC B;  4Z2O A;  1Y55 X;  3T2W A;  4JNJ A;  3RDQ A;  1SLG B;  1VWE B;  3VGW A;  4BJ8 A;  2IZD B;  4Y5D A;  4Z2V A;  4BX6 B;  2C4I A;  1HXL A;  1SWC A;  3VHI A;  1N4J A;  1WBI A;  1VWB B;  5JD2 A;  1LCW A;  1SWT A;  2IZI A;  3RE6 A;  2Y32 A;  1VWN B;  4Y59 A;  1SWG A;  4CPE A;  3SZI A;  1VWI B;  2GH7 A;  4BX5 B;  4CPH A;  2RTN B;  1SLE B;  2RTQ B;  1VWR B;  5K67 A;  1SWK A;  2IZE B;  2CAM A;  4I60 A;  4OKA A;  1VWQ B;  1KL5 A;  2JGS A;  2RTP B;  2Y3E A;  4Z27 A;  1SWL A;  3T6L A;  3T2X A;  2MF6 A;  1AVE A;  4EKV A;  1SWU A;  1STS B;  1SLF B;  2A5C A;  1VWM B;  2RTD B;  1RSU B;  3PK2 A;  2OF9 A;  3EW1 A;  3MG5 A;  1SRG A;  2RTG B;  4GJS A;  5B5G A;  1KL3 A;  1SWQ A;  4GGR A;  4JO6 A;  4Z28 A;  2UZ2 A;  1SRE A;  2RTL A;  1PTS A;  1RAV A;  1N9Y A;  3RDO A;  1SWE A;  2IZG B;  2OFB A;  1Y52 X;  3WZN A;  1I9H A;  2IZK A;  1NC9 A;  3X00 A;  3RDM A;  1NQN A;  2OF8 A;  4BX5 A;  4BX7 A;  1SWN A;  1NBX A;  1VWD B;  1SWA A;  1VWO B;  1VYO A;  2IZH B;  3RDU A;  3VHM A;  2RTJ A;  4CPI A;  1RXH A;  2RTB B;  1LEL A;  4BBO A;  1KFF A;  2RTH B;  2C1Q A;  1IJ8 A;  3WZQ A;  5K68 A;  1HXZ A;  1VWF B;  1RXJ A;  2IZC B;  2WPU A;  1Y53 X;  2UYW A;  4CPF A;  1SWH A;  2FHL A;  1N9M A;  1KL4 A;  2QCB A;  1RXK A;  3WZO A;  4BX6 A;  2OFA A;  4JHQ A;  5B5F A;  1VWH B;  1RST B;  2F01 A;  1VWG B;  3EW2 A;  2Y3F A;  1SWR A;  4GD9 A;  2A5B A;  5F2B A;  3RDS A;  3FDC A;  4Z6J A;  2RTO B;  4GJV A;  1N7Y A;  3WYP A;  3T6F A;  2RTR B;  2RTK A;  4DNE A;  2RTE B;  1LUQ A;  1SRF A;  5IRU A;  3RY2 A;  1SWB A;  1STR B; 
#chains in the Genus database with same CATH topology
 1I4U A;  1SWP A;  2O62 A;  1LIB A;  3VU1 A;  3EC5 A;  4LKT A;  1VYG A;  1FEL A;  5B11 O;  4DQ3 A;  4IAW A;  1AVD A;  3UEU A;  4IRW A;  4A1Y A;  2FR3 A;  4ZHD A;  4O9S A;  1JJX A;  2RA6 A;  3VE1 A;  3OJY C;  1SRJ A;  4GET A;  4IBA A;  4ZJ0 A;  1OPB A;  4OS3 A;  2X32 A;  4QAE A;  2GTF X;  5HZ8 A;  1OPA A;  2IZJ A;  5DPQ A;  4CDD A;  5HCD C;  4YMY A;  1SWJ A;  1NGL A;  3CKF A;  4HWM A;  3HTY A;  5HTD A;  4GE1 A;  1SY1 A;  1B8E A;  2G7B A;  2R73 A;  4YVB A;  2FRS A;  1N43 A;  2RTA A;  2KW1 A;  3D9W A;  2BHV A;  4BX7 B;  3NAD A;  1FDQ A;  1OEK A;  4LKP A;  3ZW0 B;  3MM0 A;  2CZU A;  3LTW A;  1EW3 A;  1L6M A;  1MUP A;  2RTF B;  2FTB A;  3FID A;  3APX A;  1ZNH A;  2F73 A;  5FQ8 E;  2FR2 A;  1X8Q A;  5CSE A;  3DSZ A;  5F58 A;  1EPB A;  3VG3 A;  2EU7 X;  3RDX A;  4ZH6 A;  4O3Z A;  3VHH A;  1MM9 A;  3ELZ A;  3KFI A;  1O8V A;  3F9D A;  1X8N A;  4YFR A;  3NX1 A;  4Z2O A;  3RZY A;  5AEO A;  1VWE B;  3VGW A;  1E06 A;  1LNM A;  3H3I A;  4BX6 B;  1HXL A;  4FGI B;  4UU3 A;  4OMW A;  3VHI A;  1DV9 A;  2Q2P A;  3APU A;  5EED A;  3D4R A;  2QO5 A;  3C78 X;  1PBY A;  2LB6 A;  1X71 A;  3ZW0 A;  3I0A A;  4QQ1 A;  4UU2 A;  2OL6 O;  3PQU A;  5DG4 A;  2WEW A;  3FMZ A;  3ZW1 B;  2RTN B;  1IFB A;  1SWK A;  3KZA A;  4ML7 B;  3FA6 A;  4OKA A;  3BY0 A;  4COT A;  3EBW A;  5AJC A;  5IO5 A;  3FIQ A;  4LZU A;  4KC8 A;  1U0X A;  1AVE A;  1CBI A;  5KID A;  1JYJ A;  1STS B;  3NQK A;  1SLF B;  1HBQ A;  2QMI A;  2QO6 A;  5KHP A;  1RSU B;  4ZHG A;  3FEK A;  1ZNE A;  4KCA A;  1SRG A;  2OY1 O;  3RSW A;  4KII A;  4GGR A;  1JZU A;  4Z28 A;  2GTL O;  1HMT A;  5C0N A;  4WFU A;  3PH6 A;  3TGB A;  4HPA A;  2IZG B;  2WEX A;  1OBQ A;  4ZH9 A;  5LJE A;  2IZK A;  2NNQ A;  3QQ2 A;  5JR8 A;  2LFO A;  3RDM A;  3ZQ3 A;  2L67 A;  3EBK A;  3S26 A;  1QWD A;  3WBG A;  3WJG A;  1EXS A;  1SWA A;  1VWO B;  2ANS A;  2IZH B;  3P6E A;  4YGH A;  4GUZ A;  1BBP A;  1RXH A;  2OVS A;  3DTQ A;  2I5Z O;  4A1H A;  4BBO A;  4WBK A;  1ZNK A;  4NYR A;  3U03 A;  5IO6 A;  1ZRY A;  3EYC A;  5D4A A;  3SLO A;  3WZQ A;  2K23 A;  2XST A;  4OEL A;  4R0B A;  4FBR A;  1BSQ A;  3P6G A;  4CPF A;  4EXZ A;  2Z4I A;  5LJD A;  1IIU A;  4ALO A;  1N9M A;  2CM4 A;  1UZ2 X;  3FA7 A;  5BVQ A;  3FEL A;  3BU9 A;  1Y0G A;  5B5F A;  2OVA A;  2F01 A;  2K62 A;  3O2Y A;  3Q34 A;  1GKA A;  1SWR A;  1T8V A;  1I78 A;  2A5B A;  2CM9 A;  5F2B A;  3F8A A;  4NV8 A;  4GJV A;  1N7Y A;  2HZR A;  2HYS A;  1O1V A;  4NNS A;  4O3X B;  5H9A A;  4WHI A;  1KQW A;  1T0V A;  3EMM A;  3P02 A;  4I95 A;  4ARH A;  4TQ2 A;  3TGC A;  1LUQ A;  5F1E A;  4IAB A;  4O3Y A;  4NNT A;  2LBA A;  1R0U A;  4ZHF A;  1QFT A;  1STR B;  2AKQ A;  1UYO X;  1SA8 A;  4KH8 A;  1LDQ A;  5L8N A;  2MM3 A;  3QKG A;  4OS8 A;  4PJ2 A;  4YKM A;  3T1D A;  1K24 A;  1UYN X;  1G74 A;  4AZR A;  3RY1 A;  1AVG I;  3SZJ A;  2BSZ A;  4TKH A;  4U8U N;  1SRH A;  1ALB A;  3UEW A;  4GGZ A;  3U9P C;  1GT5 A;  3FR2 A;  3SLT A;  1YWB A;  2KD2 A;  2L68 A;  2YG2 A;  4AZN A;  1SXX A;  4GDA A;  1O1U A;  1TOW A;  1CBS A;  4YFQ A;  4I3D A;  5H9K A;  1LKE A;  3F6Z B;  5K06 A;  1CJ5 A;  1HQQ A;  4GGT A;  2FGS A;  5CYB A;  4PSQ A;  1QY1 A;  1SLD B;  2MWH A;  2WQ9 A;  3E3C A;  1LDO A;  1VWK B;  3TF6 A;  2AT3 X;  3FEN A;  3VG2 A;  2X45 A;  1JBH A;  1JIW I;  5CHK A;  2A2U A;  1BRQ A;  5FAZ A;  5IO7 A;  1GX8 A;  2G5L A;  1X8P A;  1VWA B;  2R56 A;  5L8O A;  1BLR A;  2ACP X;  1STP A;  3C77 X;  4KC7 A;  1LCZ A;  3NPO A;  4ES7 A;  5F6Z A;  2HZQ A;  1LPJ A;  4IAX A;  4ALB A;  1QY0 A;  4ORR A;  1KZW A;  4CPH B;  1KQX A;  1E02 A;  2CBR A;  4XMG A;  4QYP A;  4YCH A;  1BSY A;  1VWP B;  4CK4 A;  1SWF A;  2FS6 A;  3NR3 A;  3HWE A;  2HMB A;  4IMO A;  4Z2V A;  4QGX A;  1N4J A;  1WBI A;  4B55 A;  1VWB B;  3MBT A;  4GRJ A;  3STM X;  5HA1 A;  2IZI A;  2Q2M A;  2Q9S A;  3L4R A;  3O19 A;  3BSZ E;  3ZI8 A;  2OYB O;  4YGZ A;  3AKN A;  1E00 A;  1VWN B;  1DF3 A;  2ALL X;  1SWG A;  1VWI B;  2GH7 A;  2PI3 O;  2MO5 A;  4GU8 A;  1SLE B;  4QNI A;  4BX5 B;  4CPH A;  2IZE B;  2CAM A;  4I60 A;  1ERB A;  1VWQ B;  1NP1 A;  5HZ6 A;  2RTP B;  4M6S A;  1DZP A;  2Y3E A;  3T6L A;  3CBS A;  1QY2 A;  3G7X A;  1EPA A;  2CBS A;  1OBP A;  1CRB A;  3PED A;  1ZNL A;  1RBP A;  4D6A A;  2JU3 A;  1MX8 A;  4ORS A;  1VWM B;  5F6B A;  3PK2 A;  1BWY A;  2OF9 A;  1LFO A;  3EW1 A;  5B5G A;  3CQN A;  4HFO A;  5HTE A;  1SRE A;  2Q39 A;  4O4S A;  4GK9 A;  1N9Y A;  1W5R A;  1SWE A;  1YIV A;  2OFB A;  4GKC A;  4O4U A;  4Y0R A;  2ZAI A;  4GNY A;  1GX9 A;  1DC9 A;  1IKJ A;  1NQN A;  2GTL N;  3ZUI A;  1A18 A;  4BX5 A;  4BX7 A;  1SWN A;  4GH7 A;  3SOT A;  2WWP A;  2R74 A;  1VYO A;  4N7C A;  3CWK A;  3VHM A;  4YCE A;  2FLJ A;  4CPI A;  4FQB B;  3FW5 A;  4HPC A;  4ODD A;  4RUU A;  5B27 A;  1MDC A;  3BX7 A;  3B2J A;  2PY1 A;  1KFF A;  2RTH B;  2C1Q A;  1IJ8 A;  4YH0 A;  2OY7 A;  3VG6 A;  5H8T A;  1EAL A;  2FS7 A;  3FA9 A;  5HWZ A;  1S2P A;  1X8O A;  2WPU A;  1RLB E;  1SWH A;  3D95 A;  3KFF A;  4BX6 A;  4QRL A;  4YGG A;  1SXU A;  3PEC A;  3KVN A;  2X4M A;  1RST B;  1GT3 A;  4QGW A;  2AT5 X;  1D3S A;  1VWG B;  3EW2 A;  2F09 A;  2MJI A;  3FW4 A;  4I9R A;  5HA0 A;  1LIE A;  3WJF A;  2BS5 A;  5L8I A;  2YMS A;  2A2G A;  2NP1 A;  3IFB A;  3WYP A;  4D6B A;  4CDF A;  1AB0 A;  5LJC A;  1LF7 A;  2OL7 A;  4NYQ A;  5HBS A;  2RTK A;  3RKG A;  4MVE A;  3ZW1 A;  2RTE B;  4EEJ A;  1XKI A;  3FEP A;  1GT1 A;  3LHN A;  1SWB A;  4XMD A;  1NP4 A;  1MK5 A;  1SWD A;  3PP6 A;  1SXY A;  3BS2 A;  4N7D A;  1MOY A;  2RTM A;  3AUM O;  3LV4 A;  1KT4 A;  1WUB A;  1DF8 A;  4OEM A;  4AW8 A;  3P6H A;  2OVE A;  5IRA A;  4TKB A;  2XKL A;  3N91 A;  1MEP A;  3FA8 A;  3HWF A;  3WVM A;  4QZT A;  1LCV A;  1PMP A;  4FBO A;  4CV7 A;  1SY2 A;  3S5V A;  2RN4 A;  3STN A;  4MIR A;  1IKE A;  3SAO A;  2RTI B;  1JMZ A;  1SXW A;  4IB6 A;  3SZH A;  3KQ0 A;  1ICM A;  3V8U A;  4YDB A;  3WYQ A;  3WZP A;  4A60 A;  1SRI A;  5BVT A;  4IMN A;  4AYH A;  3P6C A;  1GGL A;  3HPE A;  4NLJ A;  1EQD A;  2X34 A;  5IRW A;  3OBL A;  1DZK A;  1HMS A;  1BM5 A;  3APV A;  3RWX A;  4QZU A;  1I06 A;  2IZB A;  1HY2 A;  2AF5 A;  4O4O A;  2Q4N A;  4OMX A;  2AMM X;  4MEE A;  1SWS A;  4ID2 A;  5BVS A;  1VWL B;  3ZZV A;  1FJ1 E;  2AVI A;  2L9C A;  4GZV A;  4XMC A;  4YBU A;  4DCB A;  1SMP I;  2IZF B;  3HOL A;  2IZL B;  2IZA A;  4TNN A;  4L3R A;  5B29 A;  1KOI A;  4O3W A;  1Y55 X;  4MVK A;  3T2W A;  3RDQ A;  2M4L A;  4QYN A;  2IZD B;  1FE3 A;  4HPB A;  3WJC A;  5B10 O;  1HQP A;  4I6S A;  3CR6 A;  3ZUO A;  1OSP O;  2FT9 A;  4ORX A;  3GE2 A;  3HWD A;  4O49 A;  3BU1 A;  4YDA A;  1LCW A;  4U8U M;  1OBU A;  2OZQ A;  3O22 A;  1BRP A;  3APW A;  4CSB A;  4TJZ A;  2Y32 A;  1KZX A;  4K19 A;  4TKJ A;  1BJ7 A;  2W2B A;  2HLV A;  4Y59 A;  3SZI A;  2ACO A;  2OL8 O;  3BRN A;  1G85 A;  2RTQ B;  4ZFX A;  2JU7 A;  1YP6 A;  1KL5 A;  2AL0 X;  1BEB A;  1MVG A;  3VG4 A;  4CDE A;  3B2L A;  1QAB E;  1SWL A;  1X89 A;  3S5X A;  4Z27 A;  4M7M A;  3T2X A;  5HAE A;  4EKV A;  1YP7 A;  4INN A;  1D2U A;  1N0S A;  3OD9 A;  1TVQ A;  1Z24 A;  1KT7 A;  2RTD B;  3AEH A;  4FBV A;  2WQA E;  2FKG A;  5K68 A;  2RTG B;  4GJS A;  1KL3 A;  1SWQ A;  1DFV A;  2G79 A;  1QFV A;  4NW4 A;  1E2T A;  1PTS A;  1RAV A;  2RTL A;  2AH7 X;  3OE3 A;  3RDO A;  5HCC C;  4U3Q A;  2LBV A;  1HMR A;  3CMP A;  1FEM A;  3IA8 A;  1I9H A;  1NC9 A;  3X00 A;  2JOZ A;  3PPT A;  3EM0 A;  4NV7 A;  3S60 A;  2OFR X;  2OF8 A;  2LA7 A;  2QOS C;  2W2A A;  2ZAG A;  1NBX A;  2HKD A;  4GDZ A;  4I3B A;  3SLJ A;  4YBP A;  5FEN A;  1X8U A;  3RDU A;  4I3C A;  4DQ4 A;  2AT6 X;  4U8U O;  3TGA A;  1B56 A;  2RD7 C;  3ZW2 A;  5EDC A;  2JMB A;  1JYD A;  1ZND A;  1GM6 A;  1K3B A;  4Y0S A;  4AZM A;  1OEE A;  2QOM A;  3VG7 A;  3K3L A;  1RXJ A;  2IZC B;  2WR6 A;  3MVF A;  4BQU A;  2FHL A;  1AEL A;  1VYF A;  3WOV A;  1H91 A;  2QCB A;  1YWC A;  2OY8 A;  3WZO A;  2X8F A;  1VWH B;  2G8C O;  3FR4 A;  3VPJ E;  3STK A;  3GAQ A;  2ASN X;  4TLJ A;  5D47 A;  3CBC A;  3FDC A;  2X46 A;  3WJE A;  4ZHH A;  1T68 X;  3C76 X;  2RTR B;  4DNE A;  1ERX A;  1SRF A;  4QGV A;  4BOE A;  5EEE A;  4U9C A;  4Z6J A;  1JJU A;  3UAQ A;  2X55 A;  4MIS A;  1LID A;  1NQM A;  1VWJ B;  3UEX A;  3NX2 A;  4BCS A;  4C5P A;  2IFB A;  3NP1 A;  1BSO A;  2DJG A;  3P6F A;  4WFV A;  1KT5 A;  1VWC B;  3CKG A;  2BT9 A;  2GTL M;  1G7N A;  1HN2 A;  4OS0 A;  4ORY A;  5HZQ A;  5LJB A;  2BS6 A;  2X56 A;  1JJJ A;  1G5W A;  1S44 A;  1SWO A;  3HK1 A;  2C1S A;  4IB9 A;  5LJH A;  2HNX A;  4ORW A;  5L3Y A;  1P6P A;  4L1N A;  3UEV A;  4AZQ A;  2X8S A;  3Q6L A;  1JMX A;  2BLG A;  2MHD A;  2JW1 A;  3B2K A;  4LZV A;  2P8G A;  5D8J A;  4A8Z A;  5BYP A;  1QG5 A;  2GC9 A;  1A57 A;  5B3M O;  1EUO A;  4AZO A;  5LJK A;  1KGL A;  4XME A;  4YFP A;  4LQZ A;  1CBR A;  5F7G A;  4ZHC A;  2RQ0 A;  1AQB A;  3RE5 A;  2BC3 A;  2FHN X;  1A3Y A;  1YWD A;  2L5P A;  5KIC A;  5AQ6 A;  2JN3 A;  1IW2 A;  3P6D A;  2ZSC A;  3BLG A;  1NDJ A;  3WJB A;  2QM9 A;  1VPR A;  1A2D A;  2A3F X;  1JQP A;  2G78 A;  4IB7 A;  1KXO A;  2KTD A;  2QO4 A;  3FLL A;  3KFH A;  2VFC A;  4RUN A;  5FQ6 E;  1YUP A;  1U18 A;  2A8G A;  3FYF A;  4U46 A;  1YWA A;  5LKE A;  1I05 A;  4Z2P A;  1U17 A;  5D45 A;  4EQA C;  3RBY A;  1B0O A;  3B2I A;  4O4X A;  4BVM A;  2RTC B;  3D96 A;  2DJF A;  4JGL A;  4JNJ A;  3HOE A;  3PQS A;  1SLG B;  4HPD A;  5FFH A;  4BJ8 A;  1TXL A;  4KT5 A;  2VDF A;  1EIO A;  1ML7 A;  4Y5D A;  2C4I A;  1SWC A;  1DZM A;  3ELX A;  4BGF A;  2KTS A;  1CBQ A;  5AJB A;  5JD2 A;  4NP1 A;  1SWT A;  5HZ9 A;  2AT8 X;  1GKA B;  2KT4 B;  3RE6 A;  3B2H A;  1KT3 A;  1PBO A;  2A0A A;  1ICN A;  4CPE A;  4EFG A;  3TZS A;  1IFC A;  4ZGU A;  1VWR B;  4XMH A;  4MVI A;  5K67 A;  3U0D A;  5H9L A;  2JGS A;  1KT6 A;  3PH5 A;  1W6F A;  2OY5 O;  2MF6 A;  5D48 A;  1SWU A;  1ADL A;  3NBX X;  4NLI A;  3KFG A;  3PDF A;  2A5C A;  3D97 A;  5HZ5 A;  3MX7 A;  2VFB A;  5EDB A;  2DM5 A;  3JSQ A;  1XCA A;  2WUT A;  3MG5 A;  4Y0P A;  5EPQ A;  4GNW A;  2LKK A;  1SY3 A;  1ZNG A;  1FEN A;  2UZ2 A;  4JO6 A;  1E5P A;  3VG5 A;  3BDR A;  3JS1 A;  2OFM X;  4ORU A;  1Y52 X;  4ZGF A;  3WZN A;  4XMF A;  2RCQ A;  4MVL A;  1EII A;  5EZ2 A;  1JV4 A;  5H9N A;  5IXG A;  3WJD A;  1GT4 A;  1VWD B;  3ZWE A;  2FWV A;  2A13 A;  2RTJ A;  3WXQ A;  2RTB B;  1GXA A;  1OEJ A;  1LEL A;  1QQS A;  4I9S A;  3VE2 A;  3HWG A;  1Y9T A;  2X8T A;  1PEE A;  2I5V O;  3JQO A;  5CE4 A;  1B4M A;  2NNE A;  4IB8 A;  1HBP A;  4ON1 A;  2W2F A;  1HXZ A;  3CQR A;  1VWF B;  1LIC A;  1W4T A;  4YKO A;  1ACD A;  1Y53 X;  2UYW A;  3NQ3 A;  1I04 A;  4Y0Q A;  2N93 A;  4AZP A;  2FKJ A;  1KL4 A;  1TW4 A;  1RXK A;  1LIF A;  2CZT A;  2OFA A;  2E4J A;  3AKM A;  2RCT A;  1FTP A;  1PM1 X;  2JU8 A;  3NQ9 A;  4JHQ A;  1DZJ A;  2NND A;  1MX7 A;  5FQ7 E;  2GJ5 A;  5HCE C;  5LJG A;  2WSJ A;  3FR5 A;  2AT0 X;  4GD9 A;  1S7D A;  2Y3F A;  4ZR2 A;  1EI5 A;  4CDC A;  2Z4H A;  3RDS A;  2RTO B;  2OVD A;  3BX8 A;  5LKF A;  3T6F A;  1SY0 A;  4ZCB A;  3I17 A;  1Y9L A;  2POA A;  4EDE A;  1GX3 A;  1TOU A;  5IRU A;  1URE A;  3RY2 A;  3P24 A;  5B2A O; 
#chains in the Genus database with same CATH homology
 1SWP A;  1LDQ A;  1NQM A;  4BCS A;  1VWJ B;  1MK5 A;  1SWD A;  1MOY A;  2RTM A;  1AVD A;  1DF8 A;  1VWC B;  3RY1 A;  3SZJ A;  5IRW A;  4IRW A;  1SRH A;  4GGZ A;  5IRA A;  1MEP A;  1SWO A;  2C1S A;  1SRJ A;  4GDA A;  5L3Y A;  1LCV A;  2IZJ A;  1HQQ A;  2RTI B;  3SZH A;  3WYQ A;  4GGT A;  1SWJ A;  3WZP A;  1SLD B;  1SRI A;  1LDO A;  1VWK B;  3RE5 A;  2BC3 A;  2FHN X;  5CHK A;  4YVB A;  2G5L A;  1N43 A;  1VWA B;  2RTA A;  1NDJ A;  2ZSC A;  4BX7 B;  1STP A;  1LCZ A;  3MM0 A;  2IZB A;  1HY2 A;  2RTF B;  1SWS A;  2A8G A;  4U46 A;  4CPH B;  1VWL B;  2AVI A;  5CSE A;  4Z2P A;  3RDX A;  2IZF B;  3VHH A;  1VWP B;  1MM9 A;  2IZL B;  1SWF A;  2IZA A;  2RTC B;  4Z2O A;  1Y55 X;  3T2W A;  4JNJ A;  3RDQ A;  1SLG B;  1VWE B;  3VGW A;  4BJ8 A;  2IZD B;  4Y5D A;  4Z2V A;  4BX6 B;  2C4I A;  1HXL A;  1SWC A;  3VHI A;  1N4J A;  1WBI A;  1VWB B;  5JD2 A;  1LCW A;  1SWT A;  2IZI A;  3RE6 A;  2Y32 A;  1VWN B;  4Y59 A;  1SWG A;  4CPE A;  3SZI A;  1VWI B;  2GH7 A;  4BX5 B;  4CPH A;  2RTN B;  1SLE B;  2RTQ B;  1VWR B;  5K67 A;  1SWK A;  2IZE B;  2CAM A;  4I60 A;  4OKA A;  1VWQ B;  1KL5 A;  2JGS A;  2RTP B;  2Y3E A;  4Z27 A;  1SWL A;  3T6L A;  3T2X A;  2MF6 A;  1AVE A;  4EKV A;  1SWU A;  1STS B;  1SLF B;  2A5C A;  1VWM B;  2RTD B;  1RSU B;  3PK2 A;  2OF9 A;  3EW1 A;  3MG5 A;  1SRG A;  2RTG B;  4GJS A;  5B5G A;  1KL3 A;  1SWQ A;  4GGR A;  4JO6 A;  4Z28 A;  2UZ2 A;  1SRE A;  2RTL A;  1PTS A;  1RAV A;  1N9Y A;  3RDO A;  1SWE A;  2IZG B;  2OFB A;  1Y52 X;  3WZN A;  1I9H A;  2IZK A;  1NC9 A;  3X00 A;  3RDM A;  1NQN A;  2OF8 A;  4BX5 A;  4BX7 A;  1SWN A;  1NBX A;  1VWD B;  1SWA A;  1VWO B;  1VYO A;  2IZH B;  3RDU A;  3VHM A;  2RTJ A;  4CPI A;  1RXH A;  2RTB B;  1LEL A;  4BBO A;  1KFF A;  2RTH B;  2C1Q A;  1IJ8 A;  3WZQ A;  5K68 A;  1HXZ A;  1VWF B;  1RXJ A;  2IZC B;  2WPU A;  1Y53 X;  2UYW A;  4CPF A;  1SWH A;  2FHL A;  1N9M A;  1KL4 A;  2QCB A;  1RXK A;  3WZO A;  4BX6 A;  2OFA A;  4JHQ A;  5B5F A;  1VWH B;  1RST B;  2F01 A;  1VWG B;  3EW2 A;  2Y3F A;  1SWR A;  4GD9 A;  2A5B A;  5F2B A;  3RDS A;  3FDC A;  4Z6J A;  2RTO B;  4GJV A;  1N7Y A;  3WYP A;  3T6F A;  2RTR B;  2RTK A;  4DNE A;  2RTE B;  1LUQ A;  1SRF A;  5IRU A;  3RY2 A;  1SWB A;  1STR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...