1SLFB

Apostreptavidin, ph 5.6, two molecules of (so4)2 bound at the biotin binding site
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
123
structure length
123
Chain Sequence
b'AEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STREPTAVIDIN
publication title Binding to protein targets of peptidic leads discovered by phage display: crystal structures of streptavidin-bound linear and cyclic peptide ligands containing the HPQ sequence
pubmed doi rcsb
molecule tags Biotin-binding protein
total genus 26
structure length 123
sequence length 123
chains with identical sequence D
ec nomenclature
pdb deposition date 1995-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 1slfB00
4GJSA 2A5BA 1SWLA 2IZKA 2BC3A 1NQNA 1HY2A 4BX6B 4Z2VA 1SRIA 5IRAA 1RXJA 2UYWA 4GGTA 2RTNB 1STSB 1SWCA 3RY1A 1N43A 4JHQA 4GD9A 1RSUB 1SWKA 2RTLA 3EW1A 4BX7A 1HQQA 1IJ8A 3WZOA 3WZPA 1SWSA 1SREA 2FHLA 2Y32A 5JD2A 5IRUA 1KL5A 2UZ2A 1SLDB 2OF9A 3SZIA 1AVEA 1VWMB 5IRWA 1NBXA 2IZEB 2RTBB 1VWLB 1LUQA 2JGSA 1KL4A 3WZQA 3RDXA 2RTEB 4GJVA 4BX6A 5F2BA 2IZIA 3X00A 1Y55X 1SWTA 2WPUA 2GH7A 3VHMA 2C1SA 2RTDB 4JO6A 1LCVA 2OFBA 2RTKA 1SRJA 4CPIA 1N9YA 4CPHB 2QCBA 1RXHA 1MM9A 1RXKA 2IZHB 4OKAA 1SWQA 1NQMA 3SZHA 3T6LA 2IZGB 1MEPA 1VWEB 4CPFA 4BBOA 3RY2A 2A8GA 1DF8A 4Y59A 3RDUA 2RTHB 3RDOA 4BX5B 1SWAA 1MK5A 2IZBA 5CSEA 4Z27A 4EKVA 1VWBB 1VWPB 1KFFA 3VGWA 4DNEA 4YVBA 4CPEA 1LDOA 2RTCB 1VWGB 2G5LA 4CPHA 1SWHA 2RTPB 3SZJA 1VWJB 2ZSCA 4BCSA 4GGZA 1SRGA 2IZDB 1SLEB 3FDCA 2CAMA 1VWHB 2RTFB 3WYPA 1SWRA 1STPA 1LCZA 1NDJA 1VWCB 4Z28A 2Y3FA 2IZCB 1SRHA 4BX5A 1MOYA 3T2XA 2OFAA 1N7YA 2F01A 2IZAA 2RTMA 3MG5A 1VWKB 3PK2A 2Y3EA 2RTGB 1SWUA 1VWNB 2A5CA 3WYQA 1Y52X 3EW2A 1PTSA 4I60A 1SLGB 4IRWA 5K68A 4Z2OA 1SWJA 1RAVA 1VWFB 4JNJA 3T6FA 2RTAA 2RTQB 1N9MA 1SWEA 2MF6A 2AVIA 3RE6A 1VWOB 2FHNX 2RTIB 5CHKA 4Z2PA 1LCWA 1N4JA 2C4IA 1I9HA 5L3YA 1VWQB 1Y53X 2IZJA 1NC9A 2RTJA 3RDMA 4BJ8A 3RDSA 1VWDB 1SWPA 2RTOB 1LELA 4GDAA 1SRFA 1SWBA 1AVDA 1WBIA 2IZLB 3T2WA 1SWDA 1STRB 1KL3A 2C1QA 4Z6JA 4BX7B 1HXLA 1HXZA 1LDQA 1VYOA 3VHIA 1VWIB 1VWAB 5B5FA 2RTRB 2IZFB 3VHHA 2OF8A 1SWNA 3RDQA 1SWFA 1SWGA 1VWRB 1SLFB 3MM0A 4U46A 5K67A 4GGRA 4Y5DA 3WZNA 3RE5A 1RSTB 1SWOA 5B5GA
chains in the Genus database with same CATH superfamily
4I95A 4FQBB 3VG7A 3RZYA 5F6BA 1LNMA 1GM6A 4I9RA 2UYWA 1DZMA 1GT3A 4GGTA 4NV8A 1X89A 3CR6A 2OFMX 2WEWA 4UU2A 1S7DA 1HQQA 3MBTA 4YFRA 1IJ8A 3CWKA 1AQBA 4NYRA 3FA6A 1YIVA 4MEEA 2HMBA 3EYCA 4HFOA 5F7GA 5HAEA 2FKGA 1PMPA 2RCQA 3SZIA 4GNWA 3B2HA 3H3IA 1OPBA 2IZEB 5IRWA 4YKMA 2RA6A 2FT9A 5DPQA 1DZKA 4QRLA 1KL4A 2WQAE 3F9DA 3APXA 5LKFA 2GTFX 3FEPA 3NQKA 5H8TA 4BX6A 2IZIA 2AH7X 1E02A 1EPBA 1CBIA 4QYNA 2MO5A 3D95A 1JMZA 2RTDB 3BU9A 3FENA 4YDBA 2RTKA 4QAEA 3EMMA 2OL8O 4ORYA 4NLIA 3CMPA 1RXKA 5H9KA 5L8OA 3BRNA 3WVMA 2E4JA 4BBOA 2A8GA 3S26A 1EW3A 4Y59A 2L67A 1E2TA 1HMRA 1T0VA 3NPOA 1BBPA 3F8AA 2R74A 4I9SA 1BSOA 1FE3A 3RDOA 4HPDA 1OBPA 4ORSA 1KOIA 2GTLM 5CSEA 2RCTA 1VWBB 1VWPB 1IIUA 4DNEA 5KIDA 2FTBA 2ALLX 4YVBA 2FR2A 5H9NA 4OMXA 4D6AA 1VWGB 3MX7A 4HPAA 3D97A 3PH5A 1JQPA 1PBOA 2N93A 4ODDA 2ZSCA 3FW4A 4B55A 5BVTA 2QMIA 2FGSA 1SRGA 4Y0PA 5FAZA 3I17A 3WJGA 3FDCA 2Q4NA 1AVGI 3IA8A 2RTFB 3S5VA 2YG2A 4WBKA 4GUZA 1NDJA 1SY2A 1QFVA 2WWPA 2IZCB 5HA0A 1L6MA 5FQ8E 5L8IA 1N7YA 2F01A 3LHNA 3RBYA 2G78A 4PSQA 1QY2A 4I6SA 2Y3EA 1CBQA 3VPJE 3CQNA 4AZPA 3EM0A 2X55A 4ES7A 3KVNA 2A5CA 2JOZA 2F09A 3U9PC 1Y52X 3U03A 1PTSA 2A13A 2ACPX 1RAVA 2CM4A 3RE6A 2AL0X 4ZCBA 3B2KA 3KZAA 4BGFA 1N4JA 2C4IA 3EC5A 1FEMA 1I4UA 2IZJA 1X8UA 2WUTA 1O1UA 5FENA 3HK1A 4QZTA 3STMX 4Y0QA 1SRFA 1EIIA 1AVDA 1YUPA 3BX7A 3IFBA 3JQOA 4EXZA 1SMPI 1STRB 1KL3A 1SXXA 1X8QA 1VPRA 2L68A 2LB6A 2QOMA 3C76X 2NNDA 4XMFA 4A1YA 5HWZA 5EPQA 3VG2A 1RLBE 1X8OA 1E06A 3C77X 3HWDA 4YH0A 5B5FA 1LKEA 3STKA 1QQSA 1P6PA 2IZFB 3VHHA 2OF8A 4O3ZA 3S60A 4U8UM 1G85A 1SWNA 4XMDA 3V8UA 4IMNA 4AW8A 4DQ4A 1VWRB 1SLFB 2PY1A 4KC7A 5HZ8A 4GGRA 4Y5DA 3RE5A 1LIFA 2K62A 1FENA 2A5BA 4FBRA 1LF7A 1OEKA 1GX3A 5EZ2A 2VDFA 3ZUIA 2PI3O 4MIRA 4ORWA 3UEXA 4TKHA 5LJEA 1SRIA 2NNQA 1QFTA 2OL6O 1T68X 1STSB 2F73A 1AELA 1N43A 4JHQA 4GD9A 1RSUB 5AJCA 1JYDA 2WQ9A 5HCEC 4ZHGA 1DC9A 5K67A 3BU1A 1SWSA 2RQ0A 2R56A 2Y32A 1WUBA 5IRUA 1LFOA 2MM3A 2OZQA 5JD2A 4FBVA 4YMYA 1E5PA 2UZ2A 4IB9A 2JU8A 3HOEA 3B2JA 4RUUA 1B56A 1VWMB 1BSQA 3ZW1A 1ZNDA 2FKJA 1VWLB 1LUQA 2JGSA 2X34A 3VG3A 3ZW2A 2XKLA 3CKGA 2KTSA 3PEDA 3KFIA 2RTEB 3RDXA 3O2YA 2XSTA 4FBOA 5F2BA 4PJ2A 1EXSA 1UYOX 4GKCA 5FQ7E 3CKFA 1G74A 3GE2A 3PPTA 1SY1A 3FR4A 1ZNGA 2VFBA 2Z4IA 3ZW0A 4I3CA 2W2FA 1YWBA 1HQPA 2CBRA 1QG5A 2DM5A 3EBKA 4CPIA 1I78A 2QCBA 1RXHA 1MM9A 3DSZA 3PQSA 2IZGB 2IFBA 2QO6A 5L8NA 1U17A 1MEPA 1VWEB 2AT6X 1LICA 1DF8A 4NNSA 3FA7A 1KT7A 1ERBA 3FR2A 2GC9A 4MVEA 2K23A 4O4SA 1ERXA 1YP7A 2RTHB 3VG6A 4BVMA 4BX5B 4KT5A 1SWAA 1MK5A 4NV7A 5EEEA 4AZMA 3T1DA 2X4MA 4GE1A 5LKEA 3GAQA 1E00A 1ICNA 3FA8A 3PQUA 5BYPA 4CPEA 1O8VA 1LDOA 1UREA 1X8PA 2RTCB 1DV9A 1LIBA 1YWCA 2RTPB 4MISA 1KZXA 1TOWA 2A0AA 4GGZA 3P24A 1GX9A 1Y9TA 3BX8A 3BDRA 3LV4A 1SLEB 2G8CO 1STPA 3B2IA 1W5RA 5B10O 4Z28A 1SRHA 4TNNA 1MOYA 5CYBA 4KCAA 3MG5A 2RTMA 3PK2A 1Y0GA 4WFVA 2RTGB 2HKDA 3ELXA 1IW2A 1KT4A 1VWNB 1HMSA 3G7XA 3Q34A 3WYQA 5K68A 4CDFA 4YFPA 1SY3A 4I60A 3NQ3A 4NW4A 5D48A 2FRSA 4LKTA 1OPAA 4JNJA 2CZUA 1FDQA 3OBLA 4A8ZA 1ZNHA 4XMCA 1FTPA 3PP6A 2O62A 3SOTA 3FMZA 3VE2A 5CHKA 3P6FA 2FR3A 1R0UA 5HCDC 5LJKA 3RY1A 1JJJA 1VWQB 1NC9A 5H9LA 4ZH9A 1CJ5A 2RTJA 1JJXA 1EUOA 3WJFA 3RDSA 2FS7A 4DQ3A 2POAA 2VFCA 3QKGA 1SWBA 4XMGA 5HCCC 3VG4A 3PDFA 1EI5A 3AUMO 2CZTA 2GTLO 2Q2MA 5AEOA 2JW1A 1MDCA 4EQAC 2DJFA 5HZ6A 2JMBA 4Z6JA 1A18A 3P6DA 1HXLA 4BX7B 3D9WA 4JGLA 4N7CA 1VWAB 1JJUA 2MWHA 3APVA 1OBQA 4C5PA 2MHDA 5IO5A 3P6CA 3WBGA 1GT5A 5HA1A 3FW5A 4ZH6A 3SLTA 2JN3A 5D47A 1SWGA 2OY8A 3P02A 2HZRA 4YBPA 3N91A 2KD2A 2CBSA 1O1VA 1TOUA 4ZR2A 4ZFXA 4M7MA 4XMEA 4YGZA 3UAQA 3WZNA 3HWEA 2KT4B 4O3YA 5B5GA 1BLRA 2QO4A 1EPAA 2JU3A 2OY5O 2IZKA 1BRQA 2X8SA 2BC3A 2LA7A 1IKJA 1GX8A 4NP1A 3JSQA 1NQNA 2RN4A 5IO7A 2AMMX 4YGGA 4Z2VA 1IFCA 4O3XB 2ANSA 3SLJA 1SWKA 1GKAA 1A2DA 1KT6A 2RTLA 4WFUA 3WZOA 1OSPO 3WJEA 3HPEA 3KFHA 4OMWA 4IABA 5D8JA 1BM5A 1I05A 1PBYA 1YWDA 1MUPA 4FGIB 4NYQA 2QM9A 2AKQA 5IXGA 1BRPA 2OF9A 4O49A 2ASNX 1AVEA 1S44A 4QZUA 3WJDA 1NBXA 4L3RA 3FEKA 3BLGA 1N0SA 1Z24A 1YWAA 4LQZA 3TGBA 1Y9LA 4TLJA 1BJ7A 1ZNKA 2QO5A 1SY0A 2OVEA 4GJVA 1HN2A 1LIDA 1PM1X 1G5WA 1CBSA 4COTA 3X00A 1Y55X 1MVGA 1SWTA 3I0AA 3APWA 5B2AO 1DZJA 2GH7A 2NP1A 2C1SA 3TF6A 3D96A 4ORXA 3ZUOA 4R0BA 4QQ1A 2OFBA 5F6ZA 3ZQ3A 2FLJA 1N9YA 3FA9A 4CPHB 1SA8A 3O19A 1K3BA 1AB0A 2IZHB 4OKAA 1W4TA 5HBSA 2BT9A 3SZHA 3T6LA 4ZGFA 4AYHA 5KHPA 2BSZA 4GK9A 4GETA 3D4RA 4ALBA 4CPFA 1JYJA 1JIWI 4QGWA 4MVKA 1KGLA 2BLGA 2EU7X 4YKOA 3U0DA 2Z4HA 1A3YA 4TQ2A 1TXLA 4YCEA 1BEBA 5B11O 1JBHA 2IZBA 1EQDA 3FIQA 1DF3A 4UU3A 5F58A 4HPBA 4YDAA 5BVSA 3VGWA 4IB6A 2GTLN 2X46A 1KQWA 5D4AA 2G5LA 1VYGA 2LFOA 2I5ZO 3NX1A 2OVAA 5D45A 3FIDA 4GU8A 2AF5A 4KC8A 3WJBA 3ZZVA 1VWJB 2G7BA 4BCSA 3PECA 5HZ5A 3NR3A 5B27A 1ADLA 4LZVA 3RSWA 4EDEA 1VWHB 1MX7A 2OVDA 2RD7C 4LZUA 1W6FA 2OY7A 2BS6A 3NADA 1LCZA 2R73A 3NQ9A 4ZHFA 2Y3FA 5HZ9A 1B4MA 4BX5A 3S5XA 3T2XA 2OFAA 5B3MO 4O4XA 4YCHA 1VWKB 4AZQA 3TGCA 4WHIA 4CSBA 1DZPA 3P6HA 1HBPA 1UZ2X 3MVFA 3HWGA 2OL7A 3K3LA 3VU1A 2ZAGA 3PH6A 1EIOA 4O4UA 4IRWA 4ORRA 4XMHA 1VWFB 3AKNA 3T6FA 3FELA 2LKKA 2RTQB 4KIIA 1SWEA 2AVIA 3UEVA 1ACDA 4GDZA 2OY1O 4ZHCA 1KZWA 2RTIB 4TKJA 2M4LA 3FLLA 1RBPA 4TKBA 1LCWA 4IB8A 1I04A 3VG5A 1B0OA 2AT5X 1A57A 1Y53X 5F1EA 4ML7B 3VE1A 1VWDB 1SXUA 1SWPA 1CBRA 2RTOB 3B2LA 4NNTA 3ZW0B 1WBIA 2IZLB 1SWDA 4QNIA 3UEUA 4U9CA 1X8NA 3O22A 3WJCA 3ZWEA 4M6SA 2L9CA 1YP6A 2C1QA 3BY0A 4L1NA 4A60A 2I5VO 4CDDA 1HXZA 1LDQA 1VYOA 4ZHDA 1KT3A 1VWIB 2MJIA 3CQRA 1IKEA 4QGXA 5IO6A 2X56A 3FR5A 2FWVA 5FFHA 1GGLA 1JZUA 1JV4A 4MVLA 5H9AA 2P8GA 2QOSC 3RDQA 4NLJA 4BOEA 1SWFA 3P6EA 4ZJ0A 2WEXA 3MM0A 4K19A 2AT3X 2DJGA 1GT4A 4IMOA 3NBXX 4U46A 5IRAA 2GJ5A 1XCAA 2HYSA 1RSTB 1SWOA 2LBAA 4HPCA 4GJSA 4O9SA 4U8UN 1SWLA 5JR8A 5HZQA 4IAWA 4OS8A 5B29A 2KW1A 3EBWA 5EDBA 1HY2A 5AJBA 4BX6B 2YMSA 1QY0A 1RXJA 1TW4A 1ZRYA 1SXYA 2RTNB 1SWCA 2W2AA 2X8TA 2ZAIA 3DTQA 1FJ1E 3AEHA 3EW1A 2X8FA 3L4RA 4GNYA 4BX7A 3KQ0A 3WZPA 1SREA 2FHLA 5LJGA 4OELA 3TZSA 1KL5A 1U18A 1SLDB 4ARHA 4OS0A 2AT0X 4U3QA 4O3WA 2RTBB 1I06A 3FYFA 5EEDA 5AQ6A 1X71A 2LBVA 3WZQA 5CE4A 4ID2A 1KT5A 2Q39A 4IAXA 4CDEA 4GH7A 3WOVA 1ZNEA 1NP4A 1D3SA 4QGVA 1G7NA 1K24A 2HLVA 3TGAA 2AT8X 2WPUA 1HBQA 4LKPA 3VHMA 3JS1A 4JO6A 4KH8A 4ALOA 1LCVA 1SRJA 3E3CA 1DFVA 4QYPA 1OEJA 2WR6A 4YFQA 4ON1A 5EDCA 3LTWA 1SWQA 1NQMA 5KICA 4I3DA 2KTDA 2X45A 3APUA 3KFGA 2Q9SA 1BSYA 3ELZA 3RY2A 4CV7A 1IFBA 4IB7A 3RDUA 1QWDA 1NP1A 3AKMA 5C0NA 1NGLA 3OD9A 2Q2PA 3F6ZB 1GXAA 1U0XA 3CBSA 3QQ2A 4D6BA 5LJBA 4Z27A 4EKVA 1KFFA 1KXOA 2HNXA 4A1HA 1QABE 4CK4A 4CPHA 1SWHA 4EEJA 1FELA 4ZGUA 3SZJA 4INNA 2CM9A 2OFRX 3STNA 2A2GA 2IZDB 3BSZE 1TVQA 2CAMA 3HOLA 1JMXA 3WYPA 1OEEA 1SWRA 1ZNLA 1VWCB 1D2UA 1T8VA 1UYNX 2FS6A 1QY1A 3C78X 4OEMA 2IZAA 4CDCA 1GT1A 3OJYC 2X32A 3UEWA 1LPJA 4AZNA 2OYBO 3OE3A 1SWUA 1H91A 4TJZA 1GKAB 1VYFA 4Y0RA 4U8UO 4BQUA 4ORUA 3EW2A 4AZRA 1SLGB 4Z2OA 4IBAA 1SWJA 4HWMA 2NNEA 2RTAA 4ZHHA 2W2BA 4DCBA 1BWYA 1N9MA 2MF6A 5BVQA 5HTEA 5LJCA 1SXWA 1VWOB 2FHNX 2OVSA 2WSJA 4Z2PA 1PEEA 2G79A 1HMTA 4O4OA 4GZVA 1I9HA 2BHVA 5DG4A 3SAOA 5L3YA 1XKIA 3P6GA 3WXQA 1B8EA 3HTYA 4YGHA 3RDMA 4BJ8A 3RWXA 2ACOA 5K06A 2HZQA 4N7DA 1ICMA 4AZOA 1LELA 1ALBA 4GDAA 4RUNA 3T2WA 1S2PA 2BS5A 2A3FX 2L5PA 4GRJA 4MVIA 1KQXA 5LJDA 2A2UA 3RKGA 4EFGA 1MX8A 4OS3A 3KFFA 3NX2A 4Y0SA 3SLOA 3VHIA 5LJHA 4YBUA 1EALA 3BS2A 4I3BA 1OBUA 2RTRB 5HTDA 3HWFA 1LIEA 1CRBA 5FQ6E 3CBCA 3NP1A 3Q6LA 3ZW1B 2JU7A 3ZI8A 1ML7A
chains in the Genus database with same CATH topology
4GJSA 2A5BA 1SWLA 2IZKA 2BC3A 1NQNA 1HY2A 4BX6B 4Z2VA 1SRIA 5IRAA 1RXJA 2UYWA 4GGTA 2RTNB 1STSB 1SWCA 3RY1A 1N43A 4JHQA 4GD9A 1RSUB 1SWKA 2RTLA 3EW1A 4BX7A 1HQQA 1IJ8A 3WZOA 3WZPA 1SWSA 1SREA 2FHLA 2Y32A 5JD2A 5IRUA 1KL5A 2UZ2A 1SLDB 2OF9A 3SZIA 1AVEA 1VWMB 5IRWA 1NBXA 2IZEB 2RTBB 1VWLB 1LUQA 2JGSA 1KL4A 3WZQA 3RDXA 2RTEB 4GJVA 4BX6A 5F2BA 2IZIA 3X00A 1Y55X 1SWTA 2WPUA 2GH7A 3VHMA 2C1SA 2RTDB 4JO6A 1LCVA 2OFBA 2RTKA 1SRJA 4CPIA 1N9YA 4CPHB 2QCBA 1RXHA 1MM9A 1RXKA 2IZHB 4OKAA 1SWQA 1NQMA 3SZHA 3T6LA 2IZGB 1MEPA 1VWEB 4CPFA 4BBOA 3RY2A 2A8GA 1DF8A 4Y59A 3RDUA 2RTHB 3RDOA 4BX5B 1SWAA 1MK5A 2IZBA 5CSEA 4Z27A 4EKVA 1VWBB 1VWPB 1KFFA 3VGWA 4DNEA 4YVBA 4CPEA 1LDOA 2RTCB 1VWGB 2G5LA 4CPHA 1SWHA 2RTPB 3SZJA 1VWJB 2ZSCA 4BCSA 4GGZA 1SRGA 2IZDB 1SLEB 3FDCA 2CAMA 1VWHB 2RTFB 3WYPA 1SWRA 1STPA 1LCZA 1NDJA 1VWCB 4Z28A 2Y3FA 2IZCB 1SRHA 4BX5A 1MOYA 3T2XA 2OFAA 1N7YA 2F01A 2IZAA 2RTMA 3MG5A 1VWKB 3PK2A 2Y3EA 2RTGB 1SWUA 1VWNB 2A5CA 3WYQA 1Y52X 3EW2A 1PTSA 4I60A 1SLGB 4IRWA 5K68A 4Z2OA 1SWJA 1RAVA 1VWFB 4JNJA 3T6FA 2RTAA 2RTQB 1N9MA 1SWEA 2MF6A 2AVIA 3RE6A 1VWOB 2FHNX 2RTIB 5CHKA 4Z2PA 1LCWA 1N4JA 2C4IA 1I9HA 5L3YA 1VWQB 1Y53X 2IZJA 1NC9A 2RTJA 3RDMA 4BJ8A 3RDSA 1VWDB 1SWPA 2RTOB 1LELA 4GDAA 1SRFA 1SWBA 1AVDA 1WBIA 2IZLB 3T2WA 1SWDA 1STRB 1KL3A 2C1QA 4Z6JA 4BX7B 1HXLA 1HXZA 1LDQA 1VYOA 3VHIA 1VWIB 1VWAB 5B5FA 2RTRB 2IZFB 3VHHA 2OF8A 1SWNA 3RDQA 1SWFA 1SWGA 1VWRB 1SLFB 3MM0A 4U46A 5K67A 4GGRA 4Y5DA 3WZNA 3RE5A 1RSTB 1SWOA 5B5GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GJS A;  2A5B A;  1SWL A;  2IZK A;  2BC3 A;  1NQN A;  1HY2 A;  4BX6 B;  4Z2V A;  1SRI A;  5IRA A;  1RXJ A;  2UYW A;  4GGT A;  2RTN B;  1STS B;  1SWC A;  3RY1 A;  1N43 A;  4JHQ A;  4GD9 A;  1RSU B;  1SWK A;  2RTL A;  3EW1 A;  4BX7 A;  1HQQ A;  1IJ8 A;  3WZO A;  3WZP A;  1SWS A;  1SRE A;  2FHL A;  2Y32 A;  5JD2 A;  5IRU A;  1KL5 A;  2UZ2 A;  1SLD B;  2OF9 A;  3SZI A;  1AVE A;  1VWM B;  5IRW A;  1NBX A;  2IZE B;  2RTB B;  1VWL B;  1LUQ A;  2JGS A;  1KL4 A;  3WZQ A;  3RDX A;  2RTE B;  4GJV A;  4BX6 A;  5F2B A;  2IZI A;  3X00 A;  1Y55 X;  1SWT A;  2WPU A;  2GH7 A;  3VHM A;  2C1S A;  2RTD B;  4JO6 A;  1LCV A;  2OFB A;  2RTK A;  1SRJ A;  4CPI A;  1N9Y A;  4CPH B;  2QCB A;  1RXH A;  1MM9 A;  1RXK A;  2IZH B;  4OKA A;  1SWQ A;  1NQM A;  3SZH A;  3T6L A;  2IZG B;  1MEP A;  1VWE B;  4CPF A;  4BBO A;  3RY2 A;  2A8G A;  1DF8 A;  4Y59 A;  3RDU A;  2RTH B;  3RDO A;  4BX5 B;  1SWA A;  1MK5 A;  2IZB A;  5CSE A;  4Z27 A;  4EKV A;  1VWB B;  1VWP B;  1KFF A;  3VGW A;  4DNE A;  4YVB A;  4CPE A;  1LDO A;  2RTC B;  1VWG B;  2G5L A;  4CPH A;  1SWH A;  2RTP B;  3SZJ A;  1VWJ B;  2ZSC A;  4BCS A;  4GGZ A;  1SRG A;  2IZD B;  1SLE B;  3FDC A;  2CAM A;  1VWH B;  2RTF B;  3WYP A;  1SWR A;  1STP A;  1LCZ A;  1NDJ A;  1VWC B;  4Z28 A;  2Y3F A;  2IZC B;  1SRH A;  4BX5 A;  1MOY A;  3T2X A;  2OFA A;  1N7Y A;  2F01 A;  2IZA A;  2RTM A;  3MG5 A;  1VWK B;  3PK2 A;  2Y3E A;  2RTG B;  1SWU A;  1VWN B;  2A5C A;  3WYQ A;  1Y52 X;  3EW2 A;  1PTS A;  4I60 A;  1SLG B;  4IRW A;  5K68 A;  4Z2O A;  1SWJ A;  1RAV A;  1VWF B;  4JNJ A;  3T6F A;  2RTA A;  2RTQ B;  1N9M A;  1SWE A;  2MF6 A;  2AVI A;  3RE6 A;  1VWO B;  2FHN X;  2RTI B;  5CHK A;  4Z2P A;  1LCW A;  1N4J A;  2C4I A;  1I9H A;  5L3Y A;  1VWQ B;  1Y53 X;  2IZJ A;  1NC9 A;  2RTJ A;  3RDM A;  4BJ8 A;  3RDS A;  1VWD B;  1SWP A;  2RTO B;  1LEL A;  4GDA A;  1SRF A;  1SWB A;  1AVD A;  1WBI A;  2IZL B;  3T2W A;  1SWD A;  1STR B;  1KL3 A;  2C1Q A;  4Z6J A;  4BX7 B;  1HXL A;  1HXZ A;  1LDQ A;  1VYO A;  3VHI A;  1VWI B;  1VWA B;  5B5F A;  2RTR B;  2IZF B;  3VHH A;  2OF8 A;  1SWN A;  3RDQ A;  1SWF A;  1SWG A;  1VWR B;  1SLF B;  3MM0 A;  4U46 A;  5K67 A;  4GGR A;  4Y5D A;  3WZN A;  3RE5 A;  1RST B;  1SWO A;  5B5G A; 
#chains in the Genus database with same CATH topology
 4I95 A;  4FQB B;  3VG7 A;  3RZY A;  5F6B A;  1LNM A;  1GM6 A;  4I9R A;  2UYW A;  1DZM A;  1GT3 A;  4GGT A;  4NV8 A;  1X89 A;  3CR6 A;  2OFM X;  2WEW A;  4UU2 A;  1S7D A;  1HQQ A;  3MBT A;  4YFR A;  1IJ8 A;  3CWK A;  1AQB A;  4NYR A;  3FA6 A;  1YIV A;  4MEE A;  2HMB A;  3EYC A;  4HFO A;  5F7G A;  5HAE A;  2FKG A;  1PMP A;  2RCQ A;  3SZI A;  4GNW A;  3B2H A;  3H3I A;  1OPB A;  2IZE B;  5IRW A;  4YKM A;  2RA6 A;  2FT9 A;  5DPQ A;  1DZK A;  4QRL A;  1KL4 A;  2WQA E;  3F9D A;  3APX A;  5LKF A;  2GTF X;  3FEP A;  3NQK A;  5H8T A;  4BX6 A;  2IZI A;  2AH7 X;  1E02 A;  1EPB A;  1CBI A;  4QYN A;  2MO5 A;  3D95 A;  1JMZ A;  2RTD B;  3BU9 A;  3FEN A;  4YDB A;  2RTK A;  4QAE A;  3EMM A;  2OL8 O;  4ORY A;  4NLI A;  3CMP A;  1RXK A;  5H9K A;  5L8O A;  3BRN A;  3WVM A;  2E4J A;  4BBO A;  2A8G A;  3S26 A;  1EW3 A;  4Y59 A;  2L67 A;  1E2T A;  1HMR A;  1T0V A;  3NPO A;  1BBP A;  3F8A A;  2R74 A;  4I9S A;  1BSO A;  1FE3 A;  3RDO A;  4HPD A;  1OBP A;  4ORS A;  1KOI A;  2GTL M;  5CSE A;  2RCT A;  1VWB B;  1VWP B;  1IIU A;  4DNE A;  5KID A;  2FTB A;  2ALL X;  4YVB A;  2FR2 A;  5H9N A;  4OMX A;  4D6A A;  1VWG B;  3MX7 A;  4HPA A;  3D97 A;  3PH5 A;  1JQP A;  1PBO A;  2N93 A;  4ODD A;  2ZSC A;  3FW4 A;  4B55 A;  5BVT A;  2QMI A;  2FGS A;  1SRG A;  4Y0P A;  5FAZ A;  3I17 A;  3WJG A;  3FDC A;  2Q4N A;  1AVG I;  3IA8 A;  2RTF B;  3S5V A;  2YG2 A;  4WBK A;  4GUZ A;  1NDJ A;  1SY2 A;  1QFV A;  2WWP A;  2IZC B;  5HA0 A;  1L6M A;  5FQ8 E;  5L8I A;  1N7Y A;  2F01 A;  3LHN A;  3RBY A;  2G78 A;  4PSQ A;  1QY2 A;  4I6S A;  2Y3E A;  1CBQ A;  3VPJ E;  3CQN A;  4AZP A;  3EM0 A;  2X55 A;  4ES7 A;  3KVN A;  2A5C A;  2JOZ A;  2F09 A;  3U9P C;  1Y52 X;  3U03 A;  1PTS A;  2A13 A;  2ACP X;  1RAV A;  2CM4 A;  3RE6 A;  2AL0 X;  4ZCB A;  3B2K A;  3KZA A;  4BGF A;  1N4J A;  2C4I A;  3EC5 A;  1FEM A;  1I4U A;  2IZJ A;  1X8U A;  2WUT A;  1O1U A;  5FEN A;  3HK1 A;  4QZT A;  3STM X;  4Y0Q A;  1SRF A;  1EII A;  1AVD A;  1YUP A;  3BX7 A;  3IFB A;  3JQO A;  4EXZ A;  1SMP I;  1STR B;  1KL3 A;  1SXX A;  1X8Q A;  1VPR A;  2L68 A;  2LB6 A;  2QOM A;  3C76 X;  2NND A;  4XMF A;  4A1Y A;  5HWZ A;  5EPQ A;  3VG2 A;  1RLB E;  1X8O A;  1E06 A;  3C77 X;  3HWD A;  4YH0 A;  5B5F A;  1LKE A;  3STK A;  1QQS A;  1P6P A;  2IZF B;  3VHH A;  2OF8 A;  4O3Z A;  3S60 A;  4U8U M;  1G85 A;  1SWN A;  4XMD A;  3V8U A;  4IMN A;  4AW8 A;  4DQ4 A;  1VWR B;  1SLF B;  2PY1 A;  4KC7 A;  5HZ8 A;  4GGR A;  4Y5D A;  3RE5 A;  1LIF A;  2K62 A;  1FEN A;  2A5B A;  4FBR A;  1LF7 A;  1OEK A;  1GX3 A;  5EZ2 A;  2VDF A;  3ZUI A;  2PI3 O;  4MIR A;  4ORW A;  3UEX A;  4TKH A;  5LJE A;  1SRI A;  2NNQ A;  1QFT A;  2OL6 O;  1T68 X;  1STS B;  2F73 A;  1AEL A;  1N43 A;  4JHQ A;  4GD9 A;  1RSU B;  5AJC A;  1JYD A;  2WQ9 A;  5HCE C;  4ZHG A;  1DC9 A;  5K67 A;  3BU1 A;  1SWS A;  2RQ0 A;  2R56 A;  2Y32 A;  1WUB A;  5IRU A;  1LFO A;  2MM3 A;  2OZQ A;  5JD2 A;  4FBV A;  4YMY A;  1E5P A;  2UZ2 A;  4IB9 A;  2JU8 A;  3HOE A;  3B2J A;  4RUU A;  1B56 A;  1VWM B;  1BSQ A;  3ZW1 A;  1ZND A;  2FKJ A;  1VWL B;  1LUQ A;  2JGS A;  2X34 A;  3VG3 A;  3ZW2 A;  2XKL A;  3CKG A;  2KTS A;  3PED A;  3KFI A;  2RTE B;  3RDX A;  3O2Y A;  2XST A;  4FBO A;  5F2B A;  4PJ2 A;  1EXS A;  1UYO X;  4GKC A;  5FQ7 E;  3CKF A;  1G74 A;  3GE2 A;  3PPT A;  1SY1 A;  3FR4 A;  1ZNG A;  2VFB A;  2Z4I A;  3ZW0 A;  4I3C A;  2W2F A;  1YWB A;  1HQP A;  2CBR A;  1QG5 A;  2DM5 A;  3EBK A;  4CPI A;  1I78 A;  2QCB A;  1RXH A;  1MM9 A;  3DSZ A;  3PQS A;  2IZG B;  2IFB A;  2QO6 A;  5L8N A;  1U17 A;  1MEP A;  1VWE B;  2AT6 X;  1LIC A;  1DF8 A;  4NNS A;  3FA7 A;  1KT7 A;  1ERB A;  3FR2 A;  2GC9 A;  4MVE A;  2K23 A;  4O4S A;  1ERX A;  1YP7 A;  2RTH B;  3VG6 A;  4BVM A;  4BX5 B;  4KT5 A;  1SWA A;  1MK5 A;  4NV7 A;  5EEE A;  4AZM A;  3T1D A;  2X4M A;  4GE1 A;  5LKE A;  3GAQ A;  1E00 A;  1ICN A;  3FA8 A;  3PQU A;  5BYP A;  4CPE A;  1O8V A;  1LDO A;  1URE A;  1X8P A;  2RTC B;  1DV9 A;  1LIB A;  1YWC A;  2RTP B;  4MIS A;  1KZX A;  1TOW A;  2A0A A;  4GGZ A;  3P24 A;  1GX9 A;  1Y9T A;  3BX8 A;  3BDR A;  3LV4 A;  1SLE B;  2G8C O;  1STP A;  3B2I A;  1W5R A;  5B10 O;  4Z28 A;  1SRH A;  4TNN A;  1MOY A;  5CYB A;  4KCA A;  3MG5 A;  2RTM A;  3PK2 A;  1Y0G A;  4WFV A;  2RTG B;  2HKD A;  3ELX A;  1IW2 A;  1KT4 A;  1VWN B;  1HMS A;  3G7X A;  3Q34 A;  3WYQ A;  5K68 A;  4CDF A;  4YFP A;  1SY3 A;  4I60 A;  3NQ3 A;  4NW4 A;  5D48 A;  2FRS A;  4LKT A;  1OPA A;  4JNJ A;  2CZU A;  1FDQ A;  3OBL A;  4A8Z A;  1ZNH A;  4XMC A;  1FTP A;  3PP6 A;  2O62 A;  3SOT A;  3FMZ A;  3VE2 A;  5CHK A;  3P6F A;  2FR3 A;  1R0U A;  5HCD C;  5LJK A;  3RY1 A;  1JJJ A;  1VWQ B;  1NC9 A;  5H9L A;  4ZH9 A;  1CJ5 A;  2RTJ A;  1JJX A;  1EUO A;  3WJF A;  3RDS A;  2FS7 A;  4DQ3 A;  2POA A;  2VFC A;  3QKG A;  1SWB A;  4XMG A;  5HCC C;  3VG4 A;  3PDF A;  1EI5 A;  3AUM O;  2CZT A;  2GTL O;  2Q2M A;  5AEO A;  2JW1 A;  1MDC A;  4EQA C;  2DJF A;  5HZ6 A;  2JMB A;  4Z6J A;  1A18 A;  3P6D A;  1HXL A;  4BX7 B;  3D9W A;  4JGL A;  4N7C A;  1VWA B;  1JJU A;  2MWH A;  3APV A;  1OBQ A;  4C5P A;  2MHD A;  5IO5 A;  3P6C A;  3WBG A;  1GT5 A;  5HA1 A;  3FW5 A;  4ZH6 A;  3SLT A;  2JN3 A;  5D47 A;  1SWG A;  2OY8 A;  3P02 A;  2HZR A;  4YBP A;  3N91 A;  2KD2 A;  2CBS A;  1O1V A;  1TOU A;  4ZR2 A;  4ZFX A;  4M7M A;  4XME A;  4YGZ A;  3UAQ A;  3WZN A;  3HWE A;  2KT4 B;  4O3Y A;  5B5G A;  1BLR A;  2QO4 A;  1EPA A;  2JU3 A;  2OY5 O;  2IZK A;  1BRQ A;  2X8S A;  2BC3 A;  2LA7 A;  1IKJ A;  1GX8 A;  4NP1 A;  3JSQ A;  1NQN A;  2RN4 A;  5IO7 A;  2AMM X;  4YGG A;  4Z2V A;  1IFC A;  4O3X B;  2ANS A;  3SLJ A;  1SWK A;  1GKA A;  1A2D A;  1KT6 A;  2RTL A;  4WFU A;  3WZO A;  1OSP O;  3WJE A;  3HPE A;  3KFH A;  4OMW A;  4IAB A;  5D8J A;  1BM5 A;  1I05 A;  1PBY A;  1YWD A;  1MUP A;  4FGI B;  4NYQ A;  2QM9 A;  2AKQ A;  5IXG A;  1BRP A;  2OF9 A;  4O49 A;  2ASN X;  1AVE A;  1S44 A;  4QZU A;  3WJD A;  1NBX A;  4L3R A;  3FEK A;  3BLG A;  1N0S A;  1Z24 A;  1YWA A;  4LQZ A;  3TGB A;  1Y9L A;  4TLJ A;  1BJ7 A;  1ZNK A;  2QO5 A;  1SY0 A;  2OVE A;  4GJV A;  1HN2 A;  1LID A;  1PM1 X;  1G5W A;  1CBS A;  4COT A;  3X00 A;  1Y55 X;  1MVG A;  1SWT A;  3I0A A;  3APW A;  5B2A O;  1DZJ A;  2GH7 A;  2NP1 A;  2C1S A;  3TF6 A;  3D96 A;  4ORX A;  3ZUO A;  4R0B A;  4QQ1 A;  2OFB A;  5F6Z A;  3ZQ3 A;  2FLJ A;  1N9Y A;  3FA9 A;  4CPH B;  1SA8 A;  3O19 A;  1K3B A;  1AB0 A;  2IZH B;  4OKA A;  1W4T A;  5HBS A;  2BT9 A;  3SZH A;  3T6L A;  4ZGF A;  4AYH A;  5KHP A;  2BSZ A;  4GK9 A;  4GET A;  3D4R A;  4ALB A;  4CPF A;  1JYJ A;  1JIW I;  4QGW A;  4MVK A;  1KGL A;  2BLG A;  2EU7 X;  4YKO A;  3U0D A;  2Z4H A;  1A3Y A;  4TQ2 A;  1TXL A;  4YCE A;  1BEB A;  5B11 O;  1JBH A;  2IZB A;  1EQD A;  3FIQ A;  1DF3 A;  4UU3 A;  5F58 A;  4HPB A;  4YDA A;  5BVS A;  3VGW A;  4IB6 A;  2GTL N;  2X46 A;  1KQW A;  5D4A A;  2G5L A;  1VYG A;  2LFO A;  2I5Z O;  3NX1 A;  2OVA A;  5D45 A;  3FID A;  4GU8 A;  2AF5 A;  4KC8 A;  3WJB A;  3ZZV A;  1VWJ B;  2G7B A;  4BCS A;  3PEC A;  5HZ5 A;  3NR3 A;  5B27 A;  1ADL A;  4LZV A;  3RSW A;  4EDE A;  1VWH B;  1MX7 A;  2OVD A;  2RD7 C;  4LZU A;  1W6F A;  2OY7 A;  2BS6 A;  3NAD A;  1LCZ A;  2R73 A;  3NQ9 A;  4ZHF A;  2Y3F A;  5HZ9 A;  1B4M A;  4BX5 A;  3S5X A;  3T2X A;  2OFA A;  5B3M O;  4O4X A;  4YCH A;  1VWK B;  4AZQ A;  3TGC A;  4WHI A;  4CSB A;  1DZP A;  3P6H A;  1HBP A;  1UZ2 X;  3MVF A;  3HWG A;  2OL7 A;  3K3L A;  3VU1 A;  2ZAG A;  3PH6 A;  1EIO A;  4O4U A;  4IRW A;  4ORR A;  4XMH A;  1VWF B;  3AKN A;  3T6F A;  3FEL A;  2LKK A;  2RTQ B;  4KII A;  1SWE A;  2AVI A;  3UEV A;  1ACD A;  4GDZ A;  2OY1 O;  4ZHC A;  1KZW A;  2RTI B;  4TKJ A;  2M4L A;  3FLL A;  1RBP A;  4TKB A;  1LCW A;  4IB8 A;  1I04 A;  3VG5 A;  1B0O A;  2AT5 X;  1A57 A;  1Y53 X;  5F1E A;  4ML7 B;  3VE1 A;  1VWD B;  1SXU A;  1SWP A;  1CBR A;  2RTO B;  3B2L A;  4NNT A;  3ZW0 B;  1WBI A;  2IZL B;  1SWD A;  4QNI A;  3UEU A;  4U9C A;  1X8N A;  3O22 A;  3WJC A;  3ZWE A;  4M6S A;  2L9C A;  1YP6 A;  2C1Q A;  3BY0 A;  4L1N A;  4A60 A;  2I5V O;  4CDD A;  1HXZ A;  1LDQ A;  1VYO A;  4ZHD A;  1KT3 A;  1VWI B;  2MJI A;  3CQR A;  1IKE A;  4QGX A;  5IO6 A;  2X56 A;  3FR5 A;  2FWV A;  5FFH A;  1GGL A;  1JZU A;  1JV4 A;  4MVL A;  5H9A A;  2P8G A;  2QOS C;  3RDQ A;  4NLJ A;  4BOE A;  1SWF A;  3P6E A;  4ZJ0 A;  2WEX A;  3MM0 A;  4K19 A;  2AT3 X;  2DJG A;  1GT4 A;  4IMO A;  3NBX X;  4U46 A;  5IRA A;  2GJ5 A;  1XCA A;  2HYS A;  1RST B;  1SWO A;  2LBA A;  4HPC A;  4GJS A;  4O9S A;  4U8U N;  1SWL A;  5JR8 A;  5HZQ A;  4IAW A;  4OS8 A;  5B29 A;  2KW1 A;  3EBW A;  5EDB A;  1HY2 A;  5AJB A;  4BX6 B;  2YMS A;  1QY0 A;  1RXJ A;  1TW4 A;  1ZRY A;  1SXY A;  2RTN B;  1SWC A;  2W2A A;  2X8T A;  2ZAI A;  3DTQ A;  1FJ1 E;  3AEH A;  3EW1 A;  2X8F A;  3L4R A;  4GNY A;  4BX7 A;  3KQ0 A;  3WZP A;  1SRE A;  2FHL A;  5LJG A;  4OEL A;  3TZS A;  1KL5 A;  1U18 A;  1SLD B;  4ARH A;  4OS0 A;  2AT0 X;  4U3Q A;  4O3W A;  2RTB B;  1I06 A;  3FYF A;  5EED A;  5AQ6 A;  1X71 A;  2LBV A;  3WZQ A;  5CE4 A;  4ID2 A;  1KT5 A;  2Q39 A;  4IAX A;  4CDE A;  4GH7 A;  3WOV A;  1ZNE A;  1NP4 A;  1D3S A;  4QGV A;  1G7N A;  1K24 A;  2HLV A;  3TGA A;  2AT8 X;  2WPU A;  1HBQ A;  4LKP A;  3VHM A;  3JS1 A;  4JO6 A;  4KH8 A;  4ALO A;  1LCV A;  1SRJ A;  3E3C A;  1DFV A;  4QYP A;  1OEJ A;  2WR6 A;  4YFQ A;  4ON1 A;  5EDC A;  3LTW A;  1SWQ A;  1NQM A;  5KIC A;  4I3D A;  2KTD A;  2X45 A;  3APU A;  3KFG A;  2Q9S A;  1BSY A;  3ELZ A;  3RY2 A;  4CV7 A;  1IFB A;  4IB7 A;  3RDU A;  1QWD A;  1NP1 A;  3AKM A;  5C0N A;  1NGL A;  3OD9 A;  2Q2P A;  3F6Z B;  1GXA A;  1U0X A;  3CBS A;  3QQ2 A;  4D6B A;  5LJB A;  4Z27 A;  4EKV A;  1KFF A;  1KXO A;  2HNX A;  4A1H A;  1QAB E;  4CK4 A;  4CPH A;  1SWH A;  4EEJ A;  1FEL A;  4ZGU A;  3SZJ A;  4INN A;  2CM9 A;  2OFR X;  3STN A;  2A2G A;  2IZD B;  3BSZ E;  1TVQ A;  2CAM A;  3HOL A;  1JMX A;  3WYP A;  1OEE A;  1SWR A;  1ZNL A;  1VWC B;  1D2U A;  1T8V A;  1UYN X;  2FS6 A;  1QY1 A;  3C78 X;  4OEM A;  2IZA A;  4CDC A;  1GT1 A;  3OJY C;  2X32 A;  3UEW A;  1LPJ A;  4AZN A;  2OYB O;  3OE3 A;  1SWU A;  1H91 A;  4TJZ A;  1GKA B;  1VYF A;  4Y0R A;  4U8U O;  4BQU A;  4ORU A;  3EW2 A;  4AZR A;  1SLG B;  4Z2O A;  4IBA A;  1SWJ A;  4HWM A;  2NNE A;  2RTA A;  4ZHH A;  2W2B A;  4DCB A;  1BWY A;  1N9M A;  2MF6 A;  5BVQ A;  5HTE A;  5LJC A;  1SXW A;  1VWO B;  2FHN X;  2OVS A;  2WSJ A;  4Z2P A;  1PEE A;  2G79 A;  1HMT A;  4O4O A;  4GZV A;  1I9H A;  2BHV A;  5DG4 A;  3SAO A;  5L3Y A;  1XKI A;  3P6G A;  3WXQ A;  1B8E A;  3HTY A;  4YGH A;  3RDM A;  4BJ8 A;  3RWX A;  2ACO A;  5K06 A;  2HZQ A;  4N7D A;  1ICM A;  4AZO A;  1LEL A;  1ALB A;  4GDA A;  4RUN A;  3T2W A;  1S2P A;  2BS5 A;  2A3F X;  2L5P A;  4GRJ A;  4MVI A;  1KQX A;  5LJD A;  2A2U A;  3RKG A;  4EFG A;  1MX8 A;  4OS3 A;  3KFF A;  3NX2 A;  4Y0S A;  3SLO A;  3VHI A;  5LJH A;  4YBU A;  1EAL A;  3BS2 A;  4I3B A;  1OBU A;  2RTR B;  5HTD A;  3HWF A;  1LIE A;  1CRB A;  5FQ6 E;  3CBC A;  3NP1 A;  3Q6L A;  3ZW1 B;  2JU7 A;  3ZI8 A;  1ML7 A; 
#chains in the Genus database with same CATH homology
 4GJS A;  2A5B A;  1SWL A;  2IZK A;  2BC3 A;  1NQN A;  1HY2 A;  4BX6 B;  4Z2V A;  1SRI A;  5IRA A;  1RXJ A;  2UYW A;  4GGT A;  2RTN B;  1STS B;  1SWC A;  3RY1 A;  1N43 A;  4JHQ A;  4GD9 A;  1RSU B;  1SWK A;  2RTL A;  3EW1 A;  4BX7 A;  1HQQ A;  1IJ8 A;  3WZO A;  3WZP A;  1SWS A;  1SRE A;  2FHL A;  2Y32 A;  5JD2 A;  5IRU A;  1KL5 A;  2UZ2 A;  1SLD B;  2OF9 A;  3SZI A;  1AVE A;  1VWM B;  5IRW A;  1NBX A;  2IZE B;  2RTB B;  1VWL B;  1LUQ A;  2JGS A;  1KL4 A;  3WZQ A;  3RDX A;  2RTE B;  4GJV A;  4BX6 A;  5F2B A;  2IZI A;  3X00 A;  1Y55 X;  1SWT A;  2WPU A;  2GH7 A;  3VHM A;  2C1S A;  2RTD B;  4JO6 A;  1LCV A;  2OFB A;  2RTK A;  1SRJ A;  4CPI A;  1N9Y A;  4CPH B;  2QCB A;  1RXH A;  1MM9 A;  1RXK A;  2IZH B;  4OKA A;  1SWQ A;  1NQM A;  3SZH A;  3T6L A;  2IZG B;  1MEP A;  1VWE B;  4CPF A;  4BBO A;  3RY2 A;  2A8G A;  1DF8 A;  4Y59 A;  3RDU A;  2RTH B;  3RDO A;  4BX5 B;  1SWA A;  1MK5 A;  2IZB A;  5CSE A;  4Z27 A;  4EKV A;  1VWB B;  1VWP B;  1KFF A;  3VGW A;  4DNE A;  4YVB A;  4CPE A;  1LDO A;  2RTC B;  1VWG B;  2G5L A;  4CPH A;  1SWH A;  2RTP B;  3SZJ A;  1VWJ B;  2ZSC A;  4BCS A;  4GGZ A;  1SRG A;  2IZD B;  1SLE B;  3FDC A;  2CAM A;  1VWH B;  2RTF B;  3WYP A;  1SWR A;  1STP A;  1LCZ A;  1NDJ A;  1VWC B;  4Z28 A;  2Y3F A;  2IZC B;  1SRH A;  4BX5 A;  1MOY A;  3T2X A;  2OFA A;  1N7Y A;  2F01 A;  2IZA A;  2RTM A;  3MG5 A;  1VWK B;  3PK2 A;  2Y3E A;  2RTG B;  1SWU A;  1VWN B;  2A5C A;  3WYQ A;  1Y52 X;  3EW2 A;  1PTS A;  4I60 A;  1SLG B;  4IRW A;  5K68 A;  4Z2O A;  1SWJ A;  1RAV A;  1VWF B;  4JNJ A;  3T6F A;  2RTA A;  2RTQ B;  1N9M A;  1SWE A;  2MF6 A;  2AVI A;  3RE6 A;  1VWO B;  2FHN X;  2RTI B;  5CHK A;  4Z2P A;  1LCW A;  1N4J A;  2C4I A;  1I9H A;  5L3Y A;  1VWQ B;  1Y53 X;  2IZJ A;  1NC9 A;  2RTJ A;  3RDM A;  4BJ8 A;  3RDS A;  1VWD B;  1SWP A;  2RTO B;  1LEL A;  4GDA A;  1SRF A;  1SWB A;  1AVD A;  1WBI A;  2IZL B;  3T2W A;  1SWD A;  1STR B;  1KL3 A;  2C1Q A;  4Z6J A;  4BX7 B;  1HXL A;  1HXZ A;  1LDQ A;  1VYO A;  3VHI A;  1VWI B;  1VWA B;  5B5F A;  2RTR B;  2IZF B;  3VHH A;  2OF8 A;  1SWN A;  3RDQ A;  1SWF A;  1SWG A;  1VWR B;  1SLF B;  3MM0 A;  4U46 A;  5K67 A;  4GGR A;  4Y5D A;  3WZN A;  3RE5 A;  1RST B;  1SWO A;  5B5G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...