1SLJA

Solution structure of the s1 domain of rnase e from e. coli
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
96
structure length
96
Chain Sequence
GSHMLEQKKANIYKGKITRIEPSLEAAFVDYGAERHGFLPLKEIAREYFPANYSAHGRPNIKDVLREGQEVIVQIDKEERGNKGAALTTFISLAGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of the RNase E S1 domain and identification of its oligonucleotide-binding and dimerization interfaces.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Ribonuclease E
total genus 15
structure length 96
sequence length 96
ec nomenclature ec 3.1.26.12: Ribonuclease E.
pdb deposition date 2004-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1sljA00
1E1OA 4YCVA 3HOVG 4JI6L 1S3OA 1X56A 2UXBL 2GN5A 4YWKA 4YWMA 1X65A 4LFBL 4KLKA 1J6QA 4LW1A 4JOIC 4LFAQ 3KF6A 3U4VA 4EX5A 1PH2A 1TWHH 3S24A 1NY4A 1E7ZA 4UP9A 5IYCH 1A62A 1VQ5A 1YJNA 1IBLQ 1I5FA 3S1NH 3M7NA 1N36Q 1PH6A 3CAMA 3L2PA 2K14A 4OX9L 1XPUA 2I5LX 2XTIA 3S2HH 4X64L 3DM3A 1KRSA 2N49A 1Q81C 5JEAG 3CP0A 5IWAL 3KDFB 4BBSH 2D0PA 4TVAB 3CCVA 4HJAA 1SLJA 3G6EA 2NVXH 1AE3A 4IPGA 4A3DG 1PVOA 3PIPA 1U5KA 5IP7G 4HIDA 1WOCA 4IPCA 4BXXG 1EUJA 1TXYA 3S1MH 2LXKA 3KLWA 4GS3A 1NBWA 4A3FH 4JI6Q 3PUZA 1IZ6A 1VQMA 2OWOA 3S17H 1NTGA 3HOYG 4A3FG 4OWXB 1VQ4A 1UE5A 2PMZE 1HZ9A 2Q2UA 3ERSX 4OONA 1LUZA 1HR0W 3PUXA 4HJ7A 1XNQL 3TEHB 4ALPA 4DR2L 4B3TQ 4LF6L 2YYZA 5JEAJ 3KFUA 4DR6L 3U50C 1JMCA 4L5TA 4DKAC 4A3IH 3OYYA 4LF8L 1C9OA 2K4KA 1Q12A 1CKMA 4NPSA 2CQOA 2AHOB 2UUBQ 3BZKA 4AYBG 3UDIA 2R92H 3DLLA 1S72A 1XJVA 1EWIA 5M5YH 1B7YB 2R7ZH 2KHJA 5GROA 4QQBX 2YTXA 1H95A 2WB1G 3HOXG 4B3SQ 2ZJRA 2VS1A 4YY3L 2OTLA 4C3IH 4DV6Q 4AYBE 4DR3Q 4DR7L 4YHHL 1KAWA 4BXXH 3HOUG 4LF7Q 4JBMA 1PYSB 2VQEL 3RN5A 3CCRA 4JI4Q 4JI5L 5IYCG 4R4CA 1Y1WG 3PUVA 4QY7A 1WCMG 1KHIA 2MFIA 4BBRG 3VDYA 4DV0Q 5C4XG 2VZAA 1HNWQ 4X6AH 2RCNA 4GN5A 1X9NA 3GTLH 4DR6Q 3K7AH 1FJGQ 5ELNA 1Q7YC 4JI5Q 2YV5A 4LFAL 1JB7A 2VW9A 5IY0A 5LMUQ 4GNXB 4JI1L 2MNAA 2F52A 2ZM6L 1QZHA 3I4NH 1YNXA 4GKJL 1UE7A 1OXSC 1MJCA 2K5NA 4GN3B 3AEVA 1GO3E 1N8RC 1IYJB 1EIFA 1NJIC 2A1AA 4OX9Q 3D0FA 3RZDH 2E5LQ 3S15H 1CKNA 3I56A 4JYAL 2UUAQ 3S1QH 1CSQA 1X3GA 2OCEA 1XMOL 4OO1G 2N8NA 1T9HA 3G71A 3I7FA 2ZJPA 4IJHA 3CCUA 1PA6A 1O7IA 2AKWB 1N36L 1J5EL 5GQOA 4R4OA 2GVBA 3F2BA 1YEZA 3CQZH 1KC8C 3U4ZA 4GLVB 4A3KG 1JJ2A 1HJPA 4ME3A 5C44G 1Q1EA 3W1BA 3PF5A 1QVGA 1ASZA 2VQFL 2EXDA 1XNRL 2PNHA 4QIWE 4A75A 1VQLA 3CCJA 1HNXQ 1YHBA 2VY3A 5IWAQ 3GTPH 1BKBA 1VQDA 1L1OB 4GNXA 3L0OA 5GADC 3GTKH 4A93G 1XMQL 4IFDJ 1CUKA 3CMAA 2Q2IA 1EQRA 2NN6I 1L1OA 4PZ6A 1D8LA 1A8VA 1NMFA 4OO1I 2HIXA 4A3EG 1VQOA 1HNXL 1EYGA 3CC4A 5BR8Q 3OTOQ 4UP8A 4P72A 2HT1A 4A3BH 3ICEA 3KJOA 4JI0Q 1G291 2I5HA 3K0XA 1PH4A 3D31A 1YBYA 3KF6B 3G4SA 2JE6I 4IPHA 4A3CG 1XPOA 2WP8J 3TS2A 4DV5Q 1WCMH 3HKZG 4BBRH 4AQYL 3HOUH 2ZTCA 4DNIA 4L5SA 2JA6H 5E7NA 1YVCA 4BA1I 5C3EH 3J81c 4DV6L 2PQAB 3TQYA 4DR3L 4IJLA 5LMNW 1SN8A 2NZOA 2Y0SE 1NE3A 1GKHA 2N3SA 4J15A 1HH2P 4JCVE 4C2MH 4GLXA 1PH8A 2JJQA 1MJEA 3EBEA 1PYBA 3G48A 5IYDG 2VUMH 5AJ3Q 4DK3C 1RL2A 2UUBL 2CKZB 1N34L 2R7FA 3CXCA 3CCMA 1HR0L 1QUQB 4A3DH 4JV5Q 2A8VA 4DUZL 1U0LA 5C0XI 1FJGL 4YWLA 1A0IA 1I50H 4JBWA 4YCWA 4C3JH 1M1KC 2KCMA 3JC66 5BR8L 1WJJA 3OTOL 5LMUL 1KD1C 3RZOH 4A3BG 2NVQH 4JI3L 2Z6KC 1YHQA 3L7ZC 2ZM6Q 2EQSA 2H5XA 3M4PA 3A0JA 3KJPA 3T1YQ 1HR0Q 1XNQQ 2B63H 4DR7Q 3PV0A 2YTYA 3IRBA 1BBUA 2C35B 1K73C 1IL2A 4A3EH 2JA6G 4GKKQ 3CCSA 4TQUS 2JA5G 3PO3G 2F3IA 1Z47A 5C3EG 5C44H 4JI3Q 2VL6A 3I2ZA 1N33L 1HNZQ 1YI2A 1VQ8A 4LWCA 5FLXc 1VQNA 1R9TH 1G6PA 1XMOQ 1TWGH 1KQSA 2JK8A 3GDEA 1K9MC 3GTQH 3WWVA 2MO0A 5HY6A 4A3KH 5FJ8G 2AMCB 1IXRA 1WYDA 3CF5A 2NZHA 4YY3Q 1K0RA 3STBD 4DV4Q 1VQ6A 5M3FH 1N32Q 5GAEC 3AQQA 3CPWA 1JJCB 4YHHQ 3RLOA 1VQAA 2WAQG 1VQEA 1QUQA 1VQCA 4LF4L 1UEBA 3STBC 5IP9H 2OTJA 4Y7NH 2CFMA 2HQLA 2VNUD 4APVA 4LFCL 2UUAL 3F1ZA 2ZTDA 2A19A 3S1RH 4DR1L 4DUYL 1EQQA 1IBLL 4LUZA 3A74A 1QVFA 1G51A 2D0OA 3GTMH 3NENA 4NXNQ 1PV4A 3NEMA 4HJ9A 4LNQA 2ASBA 4A3GH 1JT8A 3ER0A 1RIPA 1IBKQ 3GO5A 3S2DH 4JI1Q 4B3MQ 4GOPC 3H0GH 1P16A 1TWAH 2QGQA 2YU9H 1XTDA 4DAMA 2VQEQ 3CC2A 4JI4L 3J7ZC 4NXNL 5FJ8H 1XNRQ 3ULJA 5IYBG 5K36G 4KHPQ 3AYHB 4X62L 1EFWA 4MZ9A 1IBKL 1UE6A 1X3FA 4DV4L 1N32L 1VQHA 4O0AA 3Q8DA 3I4OA 4UY8C 2KENA 4HIKA 2PQAA 4QJFA 3GTOH 3JAMc 1X55A 2VUMG 3MEFA 1KRTA 3BJUA 1V9PA 3PUYA 4HJ8A 5JJIA 3K7UC 5M5WH 1E3PA 1B8AA 2CWPA 4KI0A 1J5EQ 4X64Q 4OWWB 1OXTA 2L15A 3PUWA 1L0WA 3SGIA 3CCQA 1IBML 2XGTA 3AFQA 1Q46A 2RHSB 2WAQE 4DV2L 4LFCQ 3RLNA 3F2CA 2ES2A 2NVYH 4IO9A 3KOJA 1QVCA 4B3TL 2N78A 4XIGS 4JV5L 4JI2Q 4JI8L 2GVAA 2QA4A 3U58A 4LUVA 4NB3A 3T1HQ 4DR4Q 3TREA 1JJGA 2MO1A 2ATWA 1LM0A 2WB1E 1Y1WH 1UWVA 1PFSA 1QZGA 1W3SA 3FHWA 3ULPA 4UP7A 2K52A 4IPDA 5ELOA 1LTLA 2AWNA 4X62Q 5DLQE 3J80i 2E2JH 2RF4A 2LXJA 4L5RC 2F4VQ 5H1SE 2Q2TA 4GKKL 2B29A 1PH7A 1YHAA 4BY7H 1V1QA 3M3YH 4A93H 2OQKA 4LFBQ 3CPFA 2VQFQ 1HNZL 3PCOB 4UPAA 4DK6C 3PIOA 4PZ7A 3I4NG 4BA2I 3UE0A 1GD7A 1BBWA 4P75A 3J80c 2BA0A 4JBJA 2ZTEA 3GTJH 4JOIA 4H02A 4A3CH 1HNWL 1OXUA 3M4QA 4JI8Q 2IHFA 4JC0A 4XTCS 1Q86C 5LMNQ 3H3VI 4LF4Q 1Z9FA 3MXNB 4A3JG 3HOWG 2UXCQ 1PHJA 4A3GG 2HHHQ 4GKJQ 4WJ3M 2K5VA 3PO3H 4DR5L 5IE8A 4EQ5A 4OWTB 1VQBA 3HOZG 5IYDH 3UDXA 4AQYQ 3HFZB 1E24A 2UXCL 3BU2A 4RG1A 3F2DA 1I3QH 3OW2A 3E9IA 2CWAA 1EIYB 3RNUA 4P71A 5JJLA 1JE5A 4QL5A 3I55A 1LYLA 2R6GA 2R93H 4DV7L 4P73A 3S14H 1YJ9A 2JA7G 3J81j 3JAMi 1AH9A 1VCIA 5FLMG 4KHPL 4POFA 2B63G 4WJ4A 1N33Q 3H15A 4DR1Q 1NMGA 2EIFA 2E2HH 3RN2A 4A3JH 4LF5L 3J7A5 1SROA 4PMWA 4JI7Q 2KBNA 2WFWA 4AIMA 4A3MH 1PH1A 3I4MH 1X6OA 2OQ0A 4PZ8A 4JYAQ 3FP9A 5EAYA 3CD6A 1CKNB 1FVIA 1X54A 4DV2Q 2Q2HA 2K75A 3HKSA 2PI2E 1K83H 3ULLA 1K8GA 1D7QA 1Q8KA 2JA9A 5C4JH 1PH3A 4JI2L 3A5UA 3CCEA 4NXML 3W5OA 5M3MH 1FGUA 2KHIA 4A3IG 1XPRA 1YZ6A 2K5HA 4DV3L 5M5XH 1L1OC 1Q82C 4DUYQ 2ID0A 2UXBQ 4A4IA 4O2DA 3BZCA 1YITA 3W1GA 1VQ7A 4BY7G 4AH6A 3FKIG 1YJWA 1GM5A 5IP9G 2MQHA 1Y1VG 4B3RL 4JBKA 3M85A 1OTCA 2AWOA 4GOPB 4A76A 3UDGA 2E5LL 2R93G 1IBMQ 3K81C 2I5MX 2BH2A 4R1JA 4DV3Q 2NN6G 1Y14B 4BBSG 4K0KL 3KYHC 3GTGH 4IFDI 3CMEA 1VQPA 1M90C 2IY5B 4KHZA 1I94L 4Y52H 3F8TA 1K3RA 2JQOA 1C7YA 3E0EA 5IT9c 1E22A 4P74A 4GNXC 4JI0L 2ALYB 3UDFA 5GAHC 3HOZH 4FDBA 2E2IH 3HOWH 2JA5H 1KIXA 4LF6Q 5C4XH 4DUZQ 2R7DA 1CKOA 4R4IA 4DV1Q 3PSIA 1I94Q 2QEXA 4B3ML 3KF8B 1VQJA 3PO2G 3HKZE 3M9BA 1OXXK 1TWFH 4LF8Q 1P8LA 3ZJYC 4A3LG 3FKIH 3T1YL 1SRUA 2KCTA 5FLMH 2Y0SG 2IT1A 4L5QA 5M3FG 3T1HL 2BA1A 4DR4L 5GAGC 3H3VH 1BVSA 1VQIA 3RR5A 1VQ9A 1L2FA 1PH5A 2JA7H 3NELA 1SE8A 3UE1A 5C0XJ 3I4MG 4BY1H 5LMNL 1N9WA 1VQKA 4DV5L 2D62A 2R7ZG 3K80C 5J3BA 2JEBI 3J81i 3HOYH 3E9HA 4JG2A 4MTNA 3KDFA 4X66L 2HHHL 1XMQQ 5HGQA 2YTVA 4DR5Q 1SMXA 1PH9A 2BH8A 4LF9Q 1E1TA 3H0GG 1S40A 2UU9Q 3A5ZB 4A3LH 3B6YA 4POGA 2LSSA 1HZBA 5IYBH 4DR2Q 2UXDQ 3CW2C 3EN2A 4LF7L 5M3MG 1AE2A 1HZAA 2F4VL 2UU9L 4GN4B 5C0XG 2IX1A 2JEAI 1GVPA 1DGSA 2R92G 1UE1A 2HIVA 4QGUA 3M4OH 1I6HH 5IP7H 4DV0L 2UUCQ 1W2BA 2V1CC 2UXDL 4BY1G 4HIOA 4PG3A 3HOXH 1VS0A 1KL9A 4LF5Q 3PF4A 4YCUA 2B3GA 4GOPA 3GD7A 3CCLA 2JA8G 1CSPA 2DUDA 5AJ3L 3TS0A 2Z0SA 1WI5A 4RMFA 3LGJA 2FXQA 4X66Q 4B3SL 1KXLA 1N34Q 2DGYA 1Q1BA 1C0AA 1VQGA 1SFOH 2IX0A 1HZCA 1VQFA 4X65L 4IOCA 4LF9L 2PI2A 4B3RQ 4DV7Q 3PO2H 4MNOA 1MKHA 4NXMQ 4HIMA 4IFDG 3K8AA 2IHEA 1FL0A 3CC7A 2ZJQA 1OXVA 4C3HH 4X65Q 4DAYB 5JJKA 3NBHB 3PGZA 1K8AC 1SR3A 4JI7L 2K50A 1YIJA 1WFQA 3TRZA 2Z6KA 4DV1L 4DPGA 2NVTH 1B70B 2UUCL 3RLFA 1Y1VH 2CCZA 4K0KQ 4R4TA 3AFPA 4R4QA 1MIUA 1A63A 1EOVA 2JA8H 4LUOA 3EIVA 4A3MG 1V43A 4GLAC 1ASYA 3HOVH 3S16H 2RHQB 2E8GA 4HJ5A 1X3EA 4OXPA 1TWCH 2I0QA 4IOAA
chains in the Genus database with same CATH superfamily
1E1OA 2UXBL 1X56A 4YWKA 1F9QA 1J6QA 4JOIC 1IKLA 1B50A 1PH2A 1TWHH 1LTAD 4HEDA 1A62A 4JVZA 1STGA 1VQ5A 2CH4W 1C48A 1I5FA 4XXEA 3S1NH 3M7NA 1EIYB 1PH6A 4WRDA 2NTSA 3L2PA 4OX9L 3QO2A 2XTIA 4C3IB 1SYCA 1SFOB 3DM3A 1Q81C 3CP0A 2F0LA 3KDFB 1L0XB 4TVAB 5ELDA 1I4RA 5C6AA 1SLJA 2NVXH 1AE3A 4IUTA 5I9OA 2KUMA 1Z6HA 4E6IA 4BXXG 1STBA 2IPKD 3H94A 4KN4C 3NWSA 4OWXB 1VQ4A 4JPBW 2N55A 1MGSA 3ERSX 1LT4D 1LUZA 1QCBD 3H3VC 1XNQL 4DAPA 2KA7A 3RZOB 4ALPA 4DR2L 4B3TQ 2X6LA 1ET9A 3KFUA 4KMUC 5FO9B 3U50C 2HCIA 4F87A 1LV9A 1Q12A 4NPSA 2CHBD 3J7AF 2F0PA 2DY8A 1FYCA 1EWIA 1A6XA 5FK9C 2KHJA 5GROA 3S1NB 2YTXA 2XN9C 2RKSA 2VS1A 4C3IH 1KAWA 1SNDA 3KBXA 3VA5A 4JBMA 4JI4Q 4LF7Q 4JI5L 4TKOB 4R4CA 5IYCG 3KLSX 4K6LA 1D5MC 1IW7D 1BDOA 5BN3A 1KHIA 2L11A 2RCNA 1Q7YC 3SEBA 5I6YA 3CHBD 1V1PA 2EDGA 2EVBA 5IY0A 5K36H 5EQ0A 2ZM6L 3I4NH 3PO2B 5ELEA 1BCPD 3AEVA 3EJIA 1GO3E 1N8RC 4IZ8A 2YU9B 3D0FA 1GJXA 3RZDH 1X3GA 2KQ3A 2VUMB 1T9HA 3NPPA 3F2BA 4WJWA 4A3KG 1HJPA 1RTOA 2F0IA 1KAAA 1ASZA 4GZYC 1YNJD 2VQFL 4X3UA 3JAME 1NR4A 4ZAIA 3CCJA 1HNXQ 3GTPH 1SYGA 4A93G 4IUUA 2NN6I 1D8LA 5CBEE 1NMFA 1HNXL 2B8FA 4UP8A 2HT1A 4A3BH 3ICEA 3H91A 1F9SA 3KF6B 2F0OA 4CHTB 2JE6I 1D1IA 1WD0A 4A93B 4K6DA 2WP8J 3SK8A 4DNIA 2JA6H 2A74C 2QILA 2JSOA 1SN8A 1NE3A 1GKHA 4J15A 1QNKA 3TP7A 2JJQA 1LABA 5AJ3Q 1RL2A 2CKZB 1N34L 3CXCA 1HR0L 4FXDA 3MZ5A 3CQZB 1A0IA 2F3VA 1SE3A 1D2BA 1EZ8A 1WJJA 2EY1A 5BR8L 1A3UA 4KY7A 1EY8A 4C3JG 2H5XA 3I73A 4ZRZA 1XTCD 2EY2A 2K5WA 1HR0Q 1CFMA 3PV0A 1I3QB 2C35B 2BE5C 4TQUS 5A2QE 5EKKA 3I70A 1Z47A 3SE0A 1N33L 5DM73 1YI2A 4LWCA 1CK1A 5FLXc 1R9TH 1XMOQ 3Q22A 2JK8A 1STHA 2Z6BA 4LAAA 3VR5A 2MO0A 3CF5A 5EBCA 1VQ6A 4DV4Q 5F2DA 4RAUC 3F2UA 5GAEC 3AQQA 5M3FH 3CPWA 3HOUB 1R4PB 4LF4L 1VQCA 5CGKA 3STBC 4DAYA 5TSSA 4X3KA 3P1HA 3FPPA 1Y8PB 3G7LA 2UUAL 2ZTDA 3F1ZA 2OF1A 5E4WC 1G51A 2JP1A 1O7YA 1PV4A 3NEMA 2ASBA 1DCZA 1ET6A 1RIPA 3S2DH 4O1NA 4JI1Q 1P16A 2HQEA 2YU9H 1XTDA 2F1MA 2ZXRA 2VQEQ 2NUCA 5DEHA 5FJ8H 5EKIA 4WORA 3ULJA 5K36G 1UNSA 3I4LA 4KHPQ 4X62L 3GTJB 3I4OA 2KENA 3JAMc 1X55A 2RA4A 3PUYA 3OIPA 3A7LA 1EY9A 4KI0A 2ENBA 1B44D 3HOWB 1IBML 1Q46A 2B2TA 2RHSB 2EYFA 2WKDA 4IQZA 4IO9A 2L9HA 4G7ZC 3U58A 3P20A 3BG3A 4LUVA 3T1HQ 1F9RA 2BCOA 1JJGA 2MO1A 2ATWA 1GUWA 5M9OA 1UWVA 1PFSA 1HQRD 1W3SA 2F0MA 4R8NA 2AWNA 4X62Q 5DLQE 1U4LA 2RF4A 4PNYA 4GKKL 3GTMB 1PH7A 4KY6A 4RH6A 5A35A 2RBMA 3A55A 3M3YH 4ULLA 4NW2A 4U673 4ZQ3A 3MFYA 1HNZL 1DONA 4DK6C 4MN3A 5D65A 4RA8A 2C5CA 5DNFA 4KJNA 4HTHA 3TSSA 3I4NG 5C3EB 2F0UA 3J80c 1O7LA 2SNSA 4QMGA 5JEAH 1HNWL 3IFDA 3M4QA 2FMMA 5M3MB 4JC0A 3C2PA 1WTWA 5M5XB 4QUFA 2HHHQ 1ILPA 2K5VA 4O42A 1H9KA 3HOZG 5IYDH 2ZT9C 1PXUA 1LTRD 3HFZB 5IGDA 4DK1A 1YNNC 2E76C 3E9IA 4B08A 3DEOA 2F0KA 3K5LA 3OW2A 3RNUA 2QDLA 5C5MA 2R93H 1LYLA 3S14H 1YJ9A 1X3PA 1PZJD 1AH9A 5FLMG 3HOZB 1GOZA 2HDLA 1I4GA 4FNFA 4A3JH 1DYQA 4JI7Q 1BOSA 4A3MH 4HAEA 5FLXE 4G7OC 2OQ0A 3MAQA 1R4QB 4CJ0B 5EAYA 1BQQT 2PI2E 2K75A 3HRZC 3ULLA 3VA7A 4FF4A 2F0WA 1PH3A 2PPBC 3W5OA 1FGUA 2K5HA 5CYUA 5DM63 3HOVB 3S16B 1Q82C 1C8CA 4DUYQ 4A3GB 2UXBQ 1YITA 3P7JA 3BZCA 4O2DA 1VQ7A 4BY7G 2RSNA 1ILQA 4AH6A 1YJWA 1GM5A 3FVQA 3H0GB 1TWAB 2AWOA 2KEEA 4LJZC 2R93G 2XIWA 2K28A 3CRLC 2ICEC 2WIIB 4BBSG 1ONLA 1VQPA 2IY5B 4Y52H 3F8TA 1EQVA 1RJTA 1C7YA 3S14B 4FDBA 4IFDH 4LF6Q 4DN4M 4BBSB 2R7DA 1I6HB 2E74C 4DV1Q 3MC0B 2QEXA 1VQJA 3HKZE 1P8LA 3SR1A 2PW5A 4A3LG 1EYAA 5KNBA 5E1FA 3J7YW 5C5LA 2Y0SG 1Q8IA 2MUYA 3C3LA 1LTSD 5C4JB 3MWYW 2JA7H 4TRDA 5C0XJ 3NP8A 1EL0A 2D62A 3WOEA 4K5WA 4RGMA 3I3CA 3K58A 4DAVA 4V190 2YTVA 4DR5Q 1SMXA 3R8BA 2BH8A 2NVTB 1S40A 2L1BA 2UU9Q 1K0SA 4K2LA 4POGA 2LSSA 4ZUIA 1A2UA 3CW2C 5C0XH 3HS0C 2F4VL 4NKLA 5CV9A 2UU9L 5C0XG 2JN4A 1B9NA 3M4OH 5IP7H 1JICA 4PG3A 2F0TA 4H0LC 1KL9A 2CW0C 2B3GA 3FKIB 1EQTA 2Z0SA 4RMFA 5C3WA 3TS0A 3FDTA 4DFAA 5J22A 1KXLA 2L4NA 1VQGA 1SFOH 1BF4A 1G8ZD 1I4PA 1Y8NB 2IX0A 1VQFA 5IGGA 4X65L 4DV7Q 1STYA 1ENFA 4MNOA 5T1GA 2F0EA 5IIFA 2IHEA 1OXVA 3K5MA 5G3LF 1MSHA 1G2TA 2OEOA 2PZUA 5JJKA 1SR3A 1YIJA 2PNRC 2NVTH 3OWEB 3V2TA 3KBGA 3AFPA 4R4QA 3BDOA 1NSNS 3EIVA 3BS1A 1V43A 4GLAC 3HOVH 3A56A 3S16H 4HJ5A 2JYOA 4A3EH 1BCPF 1Q90A 5D14A 3BZDB 4JI6L 2DY7A 4ZKCB 1X65A 1JOQA 4LFAQ 3U4VA 2HCCA 3KF6A 4EX5A 2TMPA 3GTKB 1NY4A 1DOMA 1E7ZA 2NZ1D 1IBLQ 5M5YB 5FO7B 3ITPA 4CKBA 2K14A 2I5LX 4ZKBB 3OMGA 1X3QA 5EJWA 1EEID 4BBSH 3MXUA 2D0PA 4L8JA 1CHPD 1GUTA 4IUQA 4A3DG 4HIDA 1WOCA 1EUJA 2LXKA 4JI6Q 3NWTA 1IZ6A 1VQMA 3S17H 2PMZB 1NTGA 2IX3A 3HOYG 3TDQA 1YNND 3I4NB 4N9TA 2PMZE 5J39A 4A3DB 1QILA 2B2WC 3GP7A 1IKMA 3E5SA 4HJ7A 4H7BA 4WFN3 1I50B 1X32A 1JMCA 2K33A 4A3IH 3S1QB 3MTSA 4LF8L 1C9OA 2K4KA 1RD9D 2F0GA 2UUBQ 3BZKA 5T1IA 4AYBG 3AB9A 2R92H 1B53A 1S5BD 1B7YB 1H95A 4DF7A 5E4XA 3HOXG 5KYIA 3GV3A 1F2YA 4DV6Q 4DR3Q 4AYBE 2RVLA 1BUVT 4J1MA 3CCRA 4AYBB 2A6HD 3I72A 3T51B 4XQNA 3S9WA 3H09A 4FF2A 1FGBD 1WCMG 1VDZA 4DV0Q 5C4XG 4X6AH 1UAPA 1FJGQ 1CQFA 4A3FB 3S1RB 4KD3A 1JB7A 1ZYRC 3KUPA 4HMJA 4KTAA 4GNXB 4HSVA 4JI1L 2F52A 2MNAA 1YNXA 2DJGC 1OXSC 1MJCA 4GN3B 1WCMB 1YNJC 2EZVA 2F0VA 2M00A 2B2VA 1CKNA 4JYAL 2D2CC 3FMCA 4A3IB 2UUAQ 1CSQA 1XMOL 5L37A 4IJHA 1PA6A 4BS9A 2AKWB 2EPBA 3J80L 3MA2B 3CQZH 3U4ZA 2NWGA 4GLVB 4ME3A 1SNQA 1DM0B 5C44G 1Q1EA 3L9AX 1AFPA 2LS01 4QCLA 4Q5VA 2EXDA 1K3BC 4QIWE 4A75A 5FO8B 2NVYB 1YHBA 2VY3A 2R61A 1BKBA 1VQDA 1CT1D 4GNXA 3W2DA 1PFNA 2SOBA 5HGTA 5C44B 1Y1WB 1SAPA 1A8VA 4OO1I 2HIXA 3MXPA 1MHWC 3OTOQ 2IJ0A 3KJOA 2I5HA 3K0XA 1S5FD 1KNEA 1YBYA 3D31A 4QB4A 1PRTC 4OO1H 1TT2A 3PIP3 5ISRA 1TVXA 1WCMH 4KKUA 4AQYL 5FKAC 3TP5A 2A6HC 5LL6X 5C3EH 4IJLA 1XXGA 2B2TC 5LMNW 4GLXA 4EVOA 2N3SA 2QEJC 4JCVE 1HH2P 1PH8A 1MJEA 2SNMA 3G48A 5IYDG 1GUGA 2EYHA 1PFBA 5CMDA 2KCCA 2R7FA 3CCMA 1ESRA 4JV5Q 4A3DH 4J6HA 2A69D 3QOLA 1O7ZA 1I50H 4JBWA 4YCWA 4C3JH 3JC66 3RZOH 3OTOL 4A3BG 4JI3L 2Z6KC 1YHQA 3A0JA 3KJPA 2B63H 5NUCA 4DR7Q 1SYDA 2YTYA 3OIQA 4EQPA 1BBUA 1BR9A 4GKKQ 2JA6G 2F3IA 1WTRA 4UAIA 3OMCA 2VL6A 1JORA 1QWYA 2XWBB 3GDEA 1D6EC 5HY6A 3OOCA 3NHHA 1IXRA 1JOOA 2NZHA 4YY3Q 1N32Q 2QF7A 3HP3A 1PFMA 3RLOA 5FLXL 1VQAA 2WAQG 4HMIA 2J4XA 2BDNA 2EYMA 5IP9H 1ENAA 2CFMA 1TU2B 2VNUD 4APVA 3K7AB 1IW7C 1V8QA 3K0YA 1QVFA 4LUZA 3NENA 4NXNQ 4HJ9A 2DJFC 2F0JA 2RDHA 1LTGD 1VMCA 3GO5A 4RGNA 2TSSA 3QB3A 3H0GH 4GOPC 2I07B 5IGEA 4DAMA 3CC2A 5I2XA 2VB3X 3S15B 3NQIA 1XNRQ 2A68C 3NSWA 5IYBG 3AYHB 3GTGB 1N32L 1VQHA 1SJED 3Q8DA 3KF8A 4HIKA 2A69C 2PQAA 3MEFA 5I4DA 1V9PA 4RHSA 5M5WH 1E3PA 2XNAC 1B8AA 2F0SA 2B39A 3OPOA 2F03A 4OWWB 3M7GA 1TWGB 2Z4IA 1L0WA 3SGIA 4LFCQ 2HUGA 4ODGA 4M8AA 1PTOB 2K5QA 4M1UB 3DEPA 2ES2A 2NVYH 3KOJA 1QVCA 2N78A 1TWFB 2VB2X 4DR4Q 4F88A 4RHRA 1HXYD 3HEJA 3MHBA 1QZGA 3ULPA 3Q24A 4IPDA 3ZYYX 1LTLA 2B2VC 4NDXA 3KLRA 1EY5A 1YHAA 2N88A 1V1QA 1TY2A 3S2DB 3TMEA 2CQAA 3PIOA 3VR3A 2MHVA 4PZ7A 3UE0A 3N52A 1GD7A 2AUKA 3MXNA 2Z8LA 4JOIA 4A3CH 1XX8A 4CKCA 4XTCS 2A6EC 3H3VI 4LF4Q 2UXCQ 1KLGD 4X3SA 5M5WB 2A5HA 4GKJQ 2H4OA 3PO3H 4DR5L 4K8IA 5IGCA 1VQBA 2V4DA 4MTKA 3VR4A 4AQYQ 1E24A 3HOXB 1EEFD 4CDDC 3URYA 1JE5A 4P73A 2JA7G 3JAMi 1STNA 3SXHA 1JCKB 2X6GA 4POFA 3NTKA 1TS5A 1N33Q 4WJ4A 5C4XB 1NMGA 2E2HH 1S5DD 4KD4A 3RN2A 3J7A5 1B2TA 1PH1A 2VXWA 4PZ8A 2LFNA 3BVGA 2ZXOA 5KYLA 3HKSA 5CV5A 1FNUA 1F2ZA 2JA9A 5C4JH 1WTOA 3HGBA 5M3MH 2KHIA 4A3IG 1XPRA 4DV3L 2ID0A 2E2DC 1KDBA 3SK6A 2Z9HA 3FKIG 5IP9G 2C9OA 1OO9B 4KY5A 1IBMQ 1EIGA 3K81C 4C56C 2I5MX 4DV3Q 2NN6G 3KYHC 3GTGH 4HR7B 1M90C 3EQLC 4KHZA 3PQIA 1AW7A 1K3RA 1B3QA 4P74A 5EBDA 3HOZH 1LT6D 2F4IA 1CKOA 4R4IA 3KF8B 4QUCA 4OIKA 1CHQD 1CTMA 3T1YL 1JWSD 2KCTA 1G6ZA 2BA1A 3DXJC 3EROA 1VQ9A 2K5DA 1L2FA 1SE4A 1PH5A 4KN7C 4C1NK 1SE8A 2WACA 4XT1B 1I4XA 3UE1A 1PTOD 3NQTA 3G6JB 3M3YB 1EWCA 5J3BA 3L3OC 3E9HA 4MTNA 1SNMA 4L6TB 5HGQA 1QOHA 1RDPD 1ML0D 5E3FA 3NK9A 2F0HA 4LF9Q 1Y1VB 1HQMC 4QIWB 1TY0A 1AN8A 2OXPA 5I6WA 2UXDQ 1GHKA 1A3VA 1DXMA 4RFBA 4A3EB 2AQ1B 4MHEA 4GN4B 2JEAI 4F8MA 1DGSA 1TR5A 3QJYA 2HIVA 5EPJA 3I8ZA 1I6HH 4DV0L 1W2BA 1HA5A 4ZK9B 4BY1G 5FOBB 4Z9CB 1VS0A 1EY0A 4RWSC 4LF5Q 2GA4B 5KRUA 1N36Q 2DUDA 3LGJA 2FXQA 5IT9E 3S2HB 5K5PA 1RTNA 1HZCA 2SEBD 1VF5C 4IOCA 1T5EA 3A8JE 1CZWA 4KKSA 4C3HG 4HIMA 4IFDG 2E2HB 2WB1B 3K8AA 3MEHA 4C3HH 2O5IC 3HOYB 3PGZA 1EWHA 1ZKOA 2B8GA 5ELFA 2IW3A 1WFQA 1PYWD 4FF3A 2G9DA 4DPGA 2EY6A 3RLFA 2CCZA 2KJXA 4K0KQ 4R8IA 1RCVD 1A63A 1PRTF 2O2LD 3TBIB 2XSCA 2KEDA 1X3EA 1C4QA 2L0CA 4OXPA 1JR0D 5JEAG 5IWAL 4YCVA 4OGQC 1S3OA 5CC4A 3UI2A 2GN5A 3QOJA 4LW1A 3U9SA 1EFID 5BN5A 4UP9A 4KK7A 4TSSA 1IL8A 1B3AA 1PRTD 1E2VA 2NBFA 4XQJA 1LTID 4FXGC 4DNRB 3GQBA 4HJAA 4H13C 1KDCA 4IPGA 3PIPA 4ABNA 4PMBA 4IPCA 1TXYA 4GS3A 1NBWA 4A3FH 3PUZA 2OWOA 3DUZA 1H9SA 3ERQA 1UE5A 1UEAB 4DGZA 4KHVA 2L55A 2Q2UA 4P2CB 4OONA 3D4DA 1HR0W 1IYUA 3PUXA 4C3JB 4CDEC 1DOKA 1TWCB 2F0DA 2NVQB 3NE5B 1BCPB 4DKAC 2EYPA 3C1EA 3OYYA 4EGVA 2RDFA 2AHOB 2Z4HA 3LX0A 2WKCA 5M5YH 2WV6D 1VMPA 2L12A 4I65A 3W3AA 2ZJRA 4YY3L 2OTLA 1U9RA 1CA5A 4DR7L 4ID6A 4YHHL 1O78A 3HOUG 4BXXH 2VQEL 5KNDA 1Y1WG 1HCZA 4OL7A 3BDLA 4QY7A 3VDYA 1HNWQ 3K7AH 3V05A 4JI5Q 2YV5A 4LFAL 4A3BB 2VW9A 4IUNA 5LMUQ 1SYBA 3O13A 1PTOF 1QZHA 5KIXA 1FNWA 1UE7A 2J0TD 3BVZA 1TS4A 2JA6B 5DAUA 2K05A 4QF4A 3S15H 3I56A 5C4HA 4ILWA 2JXMB 2OCEA 2A68D 5C3XA 3I7FA 3CCUA 2Q8TA 1N36L 1O7IA 4FYDA 5GQOA 2GVBA 4DNTB 1TS3A 1RHPA 1JJ2A 3PF5A 1QVGA 3W1BA 4RGOS 2F0QA 1XNRL 1SSOA 1VQLA 2SDFA 4X3TA 3L0OA 1B9MA 5GADC 1H9SB 1XMQL 3GTKH 4IFDJ 1L1OA 4PZ6A 2FINB 4A3EG 2QKIC 1EYGA 5I2YA 5BR8Q 4JI0Q 1GUNA 3Q23A 2WAQB 3HG9A 2IL8A 1XPOA 4C3IG 3TS2A 2DN8A 4L5SA 5E7NA 4ZCKA 4BA1I 4DV6L 4DR3L 2PQAB 1SNOA 3TQYA 1PDQA 3QG1A 3IFTA 2NZOA 3NBIA 1GHJA 3EBEA 4ZUJA 1DJRD 1I4HA 4H44C 4IURA 4LK1C 4DK3C 2UUBL 4RCNA 1SMYC 2XRQD 1QUQB 2RSOA 1QG7A 4DUZL 2WINB 5C0XI 2EOTA 1SEBD 4YWLA 1FJGL 1M1KC 5JVG3 3DWPA 1KLUD 4PQXA 3NTIA 2KVMA 3MFGA 2EQSA 3M4PA 5JOBA 1K73C 1D5XC 1IL2A 2K01A 2MPMA 1U4PA 2LKVA 1VQ8A 1CQVA 1QNUA 2O4XA 3GTQH 1K9MC 2AMCB 3ND8A 3K5NA 4A3JB 3STBD 5BN4A 2KOLA 4IUVA 4BWGB 1LT5D 4Y7NH 1K83B 2HQLA 2RDGA 1STAA 1NR2A 4EQNA 2EJFC 1EQQA 4IN3A 2A19A 3S1RH 4DR1L 2E2JB 3A74A 3V96A 1RKNA 2D0OA 4FO2A 3GTMH 4BY7B 3ER0A 4N9PA 1HPCA 1JE4A 4PV1C 1WTPA 5CR3A 4B3MQ 1Q3LA 4PMCA 2QGQA 3OSOA 2A6ED 2HDMA 4JI4L 3RD4A 4I7ZC 1PRTB 3J7ZC 3CKIB 3MXGA 1E2WA 3R2TA 1EFWA 1UE6A 4DV4L 4O0AA 4FVMA 3GTOH 4B3RL 2VUMG 4HJ8A 1HFGA 3DHQA 1EU3A 1RF2D 4X64Q 1J5EQ 1NNXA 1OXTA 3CCQA 1D5ZC 4DV2L 4A3KB 3RLNA 3E3XA 3F2CA 1A2TA 3H6MA 4B3TL 4JV5L 4XIGS 1HRJA 4JI8L 5KNCA 1SYEA 3WDNA 3C1FA 5G3LD 3TREA 1MD2D 2D5DA 2WB1E 4UP7A 2K52A 4CBVA 3J80i 2G9HD 3D6WA 2F4VQ 2LXJA 1O80A 5JPMC 5H1SE 2Q2TA 1HTLD 2OQKA 4LFBQ 1M4VA 2FJ2A 2O5JC 2VQFQ 3PCOB 3A8KE 4P75A 2BA0A 4JBJA 3T4AC 2ZTEA 3GTJH 1SBBB 4H02A 1OXUA 4JI8Q 5JJZA 3C46A 1Z9FA 3HOWG 1PHJA 2E75C 4DXGA 4A3GG 4WJ3M 3D8GA 4DA2A 1GUSA 4EQ5A 1K8OA 3T56B 1WVLA 3F2DA 4P71A 4J8QA 1F2LA 5JJLA 4QL5A 2R6GA 3J81j 1F77A 2MP1A 2DNCA 1UUPA 3H15A 4B9WA 2EIFA 1SNPA 4CDCC 4LF5L 4PMWA 3FEWX 1JQYD 1X6OA 4JYAQ 3FP9A 4KV6A 3CD6A 4G57A 2FFKB 2Q2HA 1K83H 3NTHA 1Q8KA 2Y0SB 4JI2L 1LO5D 4JK1C 3A5UA 1EIHA 4NXML 2JA8B 1V1OA 4BY1B 3BDCA 1L1OC 4EQOA 3LWUA 4A4IA 2EYJA 3W1GA 2MQHA 1Y1VG 3M85A 3UDGA 4A76A 2K32A 1MSGA 2B2WA 1NAPA 5ELBA 1Y14B 4K0KL 1Y8OB 3I91A 3QR8A 3NBHA 1EU4A 2B2YA 4RKBA 3CMEA 1I94L 1HTPA 3A7AB 5IT9c 2XVSA 5IGBA 4GNXC 1Y69U 2ALYB 5GAHC 4IUPA 3HOWH 2A73B 2R3ZA 5C4XH 4DUZQ 4FF1A 1A15A 1I94Q 3IKJA 4B3ML 1SDFA 1D1KA 1OXXK 4LF8Q 3J7AV 2K03A 3FKIH 1J8IA 3DWAA 5FLMH 2LY7A 5M3FG 3S17B 4DR4L 3H3VH 1BVSA 1VQIA 2CVRA 2XRSD 1G91A 5KGUA 3NELA 3AMUA 3VR6A 4XQQA 4N8X1 5JAVA 5LMNL 1N9WA 2R7ZG 3K80C 3J81i 3HOYH 3KDFA 1EOTA 1WTQA 1W6KA 1PH9A 1E1TA 3BYYB 1SYFA 3WOFA 1F2MA 2QDBA 4DR2Q 4LF7L 1PTOC 1ESFA 5M3MG 3J80E 1HZAA 4G7HC 3OW7A 1EY7A 3NUCA 5IGFA 2IX1A 2JA5B 3PO3B 4OIJA 1U4MA 5EKLA 4QGUA 1TWHB 2G5DA 4DK0A 1TIID 2V1CC 3EVQA 1XYIA 4HIOA 5IT9L 1KABA 1BCPC 3DWQA 1QB5D 1CSPA 1WI5A 1DOLA 1DZ1A 2DGYA 1Q1BA 1C0AA 1ENCA 4V0BA 1AZPA 4B3RQ 3PO2H 3IAYA 4K8JA 1I6VC 3LNNA 5C4ZA 1LLRD 2BE5D 2ZJQA 3CC7A 4G4KA 3VYTA 3K6OA 5IOCA 2M2LA 4X65Q 3K5OA 4DAYB 3NBHB 1IYVA 4RKLA 2K50A 3TRZA 1BNZA 2RQXA 1FD7D 2Z6KA 4OELB 3OHXC 1B70B 2UUCL 1Y1VH 4R4TA 2EYOA 1MIUA 2B2UA 1ZXTA 3JAML 1V1PB 1ASYA 3K57A 1TWCH 2QW7A 4RGTA 3HOVG 4YWMA 4LFBL 3M4OB 4KLKA 3CRKC 1SMYD 2QCPX 3R3OA 1H9JA 3S24A 2KECA 5IYCH 1B4OA 2AQ2B 1YJNA 2EY5A 3CAMA 4DXFA 1XPUA 3S2HH 4X64L 1KRSA 2N49A 2E2IB 1ZYRD 1B1ZA 3CCVA 4CDFC 3G6EA 1PVOA 1U5KA 5IP7G 3S1MH 3KLWA 2DNEA 1HUMA 4C1NI 2XWJB 4CKEA 4A3FG 2F0NA 1A3TA 1HZ9A 2NTTA 1LACA 3TEHB 1WD1A 4LF6L 2YYZA 5JEAJ 4IALA 4DR6L 1U4RA 3FRPB 1AEXA 2ZXPA 2J7ZA 3A8IE 5I9PA 1CKMA 2CQOA 1XWEA 3UDIA 3D6CA 3DLLA 1JOKA 1S72A 3D3RA 1DD2A 3SK5A 1XJVA 2R7ZH 4QQBX 3PIO3 2WB1G 3ONAB 4B3SQ 1TS2A 4ME5A 1PYSB 3RN5A 3GTPB 2NYZD 3LWEA 1TQOA 1BO0A 1KNAA 2B2YC 3PUVA 1TKWB 2F0FA 4BBRG 2MFIA 2VZAA 1STEA 4GN5A 1X9NA 3GTLH 4DR6Q 5ELNA 4CGYB 1NCVA 3NXWA 1MBYA 3TP6A 4GKJL 3N6RA 1LT3D 4CJ2C 2K5NA 4BBRB 1S5ED 1IYJB 1EIFA 2BOSA 1NJIC 1QE6A 2A1AA 5COYA 4OX9Q 2E5LQ 4XYQA 3S1QH 1E2ZA 4OO1G 2N8NA 1GXDC 3G71A 1H9RA 1FNVA 3TN2A 2ZJPA 1J5EL 4R4OA 4NMZA 1YEZA 4HN7A 4LMQD 1KC8C 2R7ZB 2LMCB 4YIJA 3VYSA 2PNHA 4U68A 3P75A 1ICWA 1RODA 2B63B 5IWAQ 1BXTA 1L1OB 1JC7A 1EYDA 4RCOA 1CUKA 3CMAA 1CA6A 2Q2IA 1BBXC 1EQRA 3HKZB 1WTVA 1VQOA 1ICFB 3CC4A 4P72A 5CV8A 1G291 1PH4A 2AUJD 3G4SA 4IPHA 4A3CG 1SE2A 5M3FB 3AU7A 4DV5Q 4BBRH 3HKZG 1IHZA 3HOUH 2ZTCA 1T5XD 2NVXB 3BVMA 3QWNA 1YVCA 3J81c 4Y7NB 4C2MH 2Y0SE 1PYBA 2PCFB 1J9OA 2VUMH 4XT3B 5CBAE 3Q0AA 2K6AA 3T16A 3VR2A 2A8VA 1U0LA 4CJ1B 2KCMA 4JW0A 1NUCA 5LMUL 2F3WA 1KD1C 5JVH3 2NVQH 2EXZA 1E0BA 3L7ZC 2ZM6Q 2FMCA 1XNQQ 1G2SA 3T1YQ 4K14A 3VYRA 5LHY1 1PZKD 3IRBA 5EPKA 3HZXA 2ICIA 3CCSA 2JA5G 3GTOB 3PO3G 2R92B 5C44H 5C3EG 4JI3Q 3I2ZA 1HNZQ 3X3MA 1VQNA 1G6PA 3E0JA 1TWGH 1KQSA 3WWVA 1S5CD 1PTOH 4A3KH 3J81L 5FJ8G 2NB0A 1WYDA 2AQ3B 1K0RA 1II3A 2BDOA 2PO4A 1JJCB 4YHHQ 1JWMD 3TP8A 2PQEA 1VQEA 1QUQA 1WTHA 1UEBA 2OTJA 3GV6A 1K28A 4C2MB 3T13A 4ZLTF 4LFCL 3KK7A 1CI3M 5HURA 1IBLL 2KHSA 4DUYL 1JT8A 4LNQA 4A3GH 2CH4A 1IBKQ 4B9XA 1TWAH 1K8MA 1FR3A 3X3NA 2B2UC 4NXNL 2UUCQ 2MJ8A 1SNCA 3OWFA 4MZ9A 1IBKL 1X3FA 3QIAA 1AZQA 2PW7A 4UY8C 4QJFA 5JJIA 1KRTA 3BJUA 1AP0A 3K7UC 2CWPA 1R9TB 5CV6A 3PUWA 2L15A 2XGTA 3AFQA 1GUOA 1EYCA 1EY6A 2WAQE 2Z1CA 5EGTA 4HCEA 4JI2Q 2GVAA 3J81E 2QA4A 4NB3A 3SDZA 3Q6SA 3U9OA 2R93B 1LM0A 2FHTA 1Y1WH 4UDUC 4F7XA 3FHWA 5CV4A 5ELOA 2EYLA 2JA7B 2E2JH 4L5RC 2KCNA 2B29A 2L5TA 4BY7H 4I7AA 2I46A 1F9PA 4A93H 5ELCA 3CPFA 5D3IB 4UPAA 4ZYSA 4BA2I 2IWHA 3RUZA 1BBWA 3EFXD 4UHVA 1HA6A 5CV7A 3VYUA 1VF7A 2IHFA 1Q86C 5LMNQ 4K5XA 3MXNB 4A3JG 1EY4A 2EE1A 1SJHD 3A54A 5IE8A 3K59A 4OWTB 5KEEA 3UDXA 4XDXA 2UXCL 3BU2A 4RG1A 1I3QH 2Q8RE 2CWAA 3SVMA 5LL6S 5JPNC 3I55A 4DV7L 1CM9A 1VCIA 2D9UA 4KHPL 1SXTA 3FPUB 3D4WA 3GTQB 2EJMA 4NP5A 2B63G 5J1ZA 3CU7A 4DR1Q 2RCFA 4S3SA 3RMHA 1SROA 3M4YA 2KBNA 2WFWA 3TZDA 4AIMA 3I4MH 1S4ZA 3E6ZX 3EA6A 1PZID 1HUNA 3IL8A 1CKNB 1FVIA 1EZ6A 1X54A 4DV2Q 1D7QA 1K8GA 4K5VA 1CZGA 1JWUD 1LTTD 1M8AA 3CCEA 3MVVA 1YZ6A 5M5XH 5A2QL 4Q0FA 2K04A 4JBKA 1OTCA 4GOPB 2E5LL 2H1EA 2PZTA 2Q8IB 2BH2A 4R1JA 4MIUA 4IFDI 2HD3A 4FXKC 1HHVA 2JQOA 3E0EA 1E22A 4JI0L 3UDFA 1KDAA 3KLSA 2E2IH 2JA5H 1KIXA 4KJOA 3PSIA 1QJOA 3BYTB 3PO2G 1H9MA 3M9BA 4OHJA 1TWFH 3R93A 3I4MB 2CW0D 3SK4A 3ZJYC 4DU9A 1SRUA 3S1MB 2IT1A 4L5QA 3T1HL 5GAGC 3RR5A 2PYKA 4HSPA 4XYOA 3D4RA 3I4MG 1MI2A 2P5ZX 4BY1H 1ZEQX 1VQKA 4KKTA 4DV5L 2JEBI 4C3HB 4JG2A 1PMRA 2X69A 4X66L 3DM1A 2HHHL 1XMQQ 1PLFA 3R2IA 3H0GG 4HCSA 5IODA 3A5ZB 1I4QA 4A3LH 3B6YA 5IYBH 1HZBA 2EJGC 3PMFA 3EN2A 1WTXA 1AE2A 2K7VA 1W6JA 1GVPA 2R92G 1HFNA 1UE1A 4L63B 2UXDL 1JB3A 3HOXH 3PF4A 4YCUA 4GOPA 3GD7A 3CCLA 2JA8G 3GTLB 5AJ3L 4B3SL 3DMUA 4X66Q 4K2KA 4R9WA 1N34Q 2K1BA 3SHLA 2M9VA 4LF9L 2PI2A 2PZWA 2MGSA 3T53B 1KTKA 1MKHA 4NXMQ 1FL0A 4N8FA 3RZDB 1L0YB 4A3MB 1Z7TA 1K8AC 4OEMB 5AFWA 4JI7L 2OT2A 5D3DA 4DV1L 5EPLA 3I90A 3TZUA 1EOVA 1LTBD 2JA8H 4LUOA 4A3MG 3ND9A 2NN6H 5CORA 4FP5D 2RHQB 2E8GA 4L5TA 2I0QA 4IOAA
chains in the Genus database with same CATH topology
1E1OA 4YCVA 3HOVG 4JI6L 1S3OA 1X56A 2UXBL 2GN5A 4YWKA 4YWMA 1X65A 4LFBL 4KLKA 1J6QA 4LW1A 4JOIC 4LFAQ 3KF6A 3U4VA 4EX5A 1PH2A 1TWHH 3S24A 1NY4A 1E7ZA 4UP9A 5IYCH 1A62A 1VQ5A 1YJNA 1IBLQ 1I5FA 3S1NH 3M7NA 1N36Q 1PH6A 3CAMA 3L2PA 2K14A 4OX9L 1XPUA 2I5LX 2XTIA 3S2HH 4X64L 3DM3A 1KRSA 2N49A 1Q81C 5JEAG 3CP0A 5IWAL 3KDFB 4BBSH 2D0PA 4TVAB 3CCVA 4HJAA 1SLJA 3G6EA 2NVXH 1AE3A 4IPGA 4A3DG 1PVOA 3PIPA 1U5KA 5IP7G 4HIDA 1WOCA 4IPCA 4BXXG 1EUJA 1TXYA 3S1MH 2LXKA 3KLWA 4GS3A 1NBWA 4A3FH 4JI6Q 3PUZA 1IZ6A 1VQMA 2OWOA 3S17H 1NTGA 3HOYG 4A3FG 4OWXB 1VQ4A 1UE5A 2PMZE 1HZ9A 2Q2UA 3ERSX 4OONA 1LUZA 1HR0W 3PUXA 4HJ7A 1XNQL 3TEHB 4ALPA 4DR2L 4B3TQ 4LF6L 2YYZA 5JEAJ 3KFUA 4DR6L 3U50C 1JMCA 4L5TA 4DKAC 4A3IH 3OYYA 4LF8L 1C9OA 2K4KA 1Q12A 1CKMA 4NPSA 2CQOA 2AHOB 2UUBQ 3BZKA 4AYBG 3UDIA 2R92H 3DLLA 1S72A 1XJVA 1EWIA 5M5YH 1B7YB 2R7ZH 2KHJA 5GROA 4QQBX 2YTXA 1H95A 2WB1G 3HOXG 4B3SQ 2ZJRA 2VS1A 4YY3L 2OTLA 4C3IH 4DV6Q 4AYBE 4DR3Q 4DR7L 4YHHL 1KAWA 4BXXH 3HOUG 4LF7Q 4JBMA 1PYSB 2VQEL 3RN5A 3CCRA 4JI4Q 4JI5L 5IYCG 4R4CA 1Y1WG 3PUVA 4QY7A 1WCMG 1KHIA 2MFIA 4BBRG 3VDYA 4DV0Q 5C4XG 2VZAA 1HNWQ 4X6AH 2RCNA 4GN5A 1X9NA 3GTLH 4DR6Q 3K7AH 1FJGQ 5ELNA 1Q7YC 4JI5Q 2YV5A 4LFAL 1JB7A 2VW9A 5IY0A 5LMUQ 4GNXB 4JI1L 2MNAA 2F52A 2ZM6L 1QZHA 3I4NH 1YNXA 4GKJL 1UE7A 1OXSC 1MJCA 2K5NA 4GN3B 3AEVA 1GO3E 1N8RC 1IYJB 1EIFA 1NJIC 2A1AA 4OX9Q 3D0FA 3RZDH 2E5LQ 3S15H 1CKNA 3I56A 4JYAL 2UUAQ 3S1QH 1CSQA 1X3GA 2OCEA 1XMOL 4OO1G 2N8NA 1T9HA 3G71A 3I7FA 2ZJPA 4IJHA 3CCUA 1PA6A 1O7IA 2AKWB 1N36L 1J5EL 5GQOA 4R4OA 2GVBA 3F2BA 1YEZA 3CQZH 1KC8C 3U4ZA 4GLVB 4A3KG 1JJ2A 1HJPA 4ME3A 5C44G 1Q1EA 3W1BA 3PF5A 1QVGA 1ASZA 2VQFL 2EXDA 1XNRL 2PNHA 4QIWE 4A75A 1VQLA 3CCJA 1HNXQ 1YHBA 2VY3A 5IWAQ 3GTPH 1BKBA 1VQDA 1L1OB 4GNXA 3L0OA 5GADC 3GTKH 4A93G 1XMQL 4IFDJ 1CUKA 3CMAA 2Q2IA 1EQRA 2NN6I 1L1OA 4PZ6A 1D8LA 1A8VA 1NMFA 4OO1I 2HIXA 4A3EG 1VQOA 1HNXL 1EYGA 3CC4A 5BR8Q 3OTOQ 4UP8A 4P72A 2HT1A 4A3BH 3ICEA 3KJOA 4JI0Q 1G291 2I5HA 3K0XA 1PH4A 3D31A 1YBYA 3KF6B 3G4SA 2JE6I 4IPHA 4A3CG 1XPOA 2WP8J 3TS2A 4DV5Q 1WCMH 3HKZG 4BBRH 4AQYL 3HOUH 2ZTCA 4DNIA 4L5SA 2JA6H 5E7NA 1YVCA 4BA1I 5C3EH 3J81c 4DV6L 2PQAB 3TQYA 4DR3L 4IJLA 5LMNW 1SN8A 2NZOA 2Y0SE 1NE3A 1GKHA 2N3SA 4J15A 1HH2P 4JCVE 4C2MH 4GLXA 1PH8A 2JJQA 1MJEA 3EBEA 1PYBA 3G48A 5IYDG 2VUMH 5AJ3Q 4DK3C 1RL2A 2UUBL 2CKZB 1N34L 2R7FA 3CXCA 3CCMA 1HR0L 1QUQB 4A3DH 4JV5Q 2A8VA 4DUZL 1U0LA 5C0XI 1FJGL 4YWLA 1A0IA 1I50H 4JBWA 4YCWA 4C3JH 1M1KC 2KCMA 3JC66 5BR8L 1WJJA 3OTOL 5LMUL 1KD1C 3RZOH 4A3BG 2NVQH 4JI3L 2Z6KC 1YHQA 3L7ZC 2ZM6Q 2EQSA 2H5XA 3M4PA 3A0JA 3KJPA 3T1YQ 1HR0Q 1XNQQ 2B63H 4DR7Q 3PV0A 2YTYA 3IRBA 1BBUA 2C35B 1K73C 1IL2A 4A3EH 2JA6G 4GKKQ 3CCSA 4TQUS 2JA5G 3PO3G 2F3IA 1Z47A 5C3EG 5C44H 4JI3Q 2VL6A 3I2ZA 1N33L 1HNZQ 1YI2A 1VQ8A 4LWCA 5FLXc 1VQNA 1R9TH 1G6PA 1XMOQ 1TWGH 1KQSA 2JK8A 3GDEA 1K9MC 3GTQH 3WWVA 2MO0A 5HY6A 4A3KH 5FJ8G 2AMCB 1IXRA 1WYDA 3CF5A 2NZHA 4YY3Q 1K0RA 3STBD 4DV4Q 1VQ6A 5M3FH 1N32Q 5GAEC 3AQQA 3CPWA 1JJCB 4YHHQ 3RLOA 1VQAA 2WAQG 1VQEA 1QUQA 1VQCA 4LF4L 1UEBA 3STBC 5IP9H 2OTJA 4Y7NH 2CFMA 2HQLA 2VNUD 4APVA 4LFCL 2UUAL 3F1ZA 2ZTDA 2A19A 3S1RH 4DR1L 4DUYL 1EQQA 1IBLL 4LUZA 3A74A 1QVFA 1G51A 2D0OA 3GTMH 3NENA 4NXNQ 1PV4A 3NEMA 4HJ9A 4LNQA 2ASBA 4A3GH 1JT8A 3ER0A 1RIPA 1IBKQ 3GO5A 3S2DH 4JI1Q 4B3MQ 4GOPC 3H0GH 1P16A 1TWAH 2QGQA 2YU9H 1XTDA 4DAMA 2VQEQ 3CC2A 4JI4L 3J7ZC 4NXNL 5FJ8H 1XNRQ 3ULJA 5IYBG 5K36G 4KHPQ 3AYHB 4X62L 1EFWA 4MZ9A 1IBKL 1UE6A 1X3FA 4DV4L 1N32L 1VQHA 4O0AA 3Q8DA 3I4OA 4UY8C 2KENA 4HIKA 2PQAA 4QJFA 3GTOH 3JAMc 1X55A 2VUMG 3MEFA 1KRTA 3BJUA 1V9PA 3PUYA 4HJ8A 5JJIA 3K7UC 5M5WH 1E3PA 1B8AA 2CWPA 4KI0A 1J5EQ 4X64Q 4OWWB 1OXTA 2L15A 3PUWA 1L0WA 3SGIA 3CCQA 1IBML 2XGTA 3AFQA 1Q46A 2RHSB 2WAQE 4DV2L 4LFCQ 3RLNA 3F2CA 2ES2A 2NVYH 4IO9A 3KOJA 1QVCA 4B3TL 2N78A 4XIGS 4JV5L 4JI2Q 4JI8L 2GVAA 2QA4A 3U58A 4LUVA 4NB3A 3T1HQ 4DR4Q 3TREA 1JJGA 2MO1A 2ATWA 1LM0A 2WB1E 1Y1WH 1UWVA 1PFSA 1QZGA 1W3SA 3FHWA 3ULPA 4UP7A 2K52A 4IPDA 5ELOA 1LTLA 2AWNA 4X62Q 5DLQE 3J80i 2E2JH 2RF4A 2LXJA 4L5RC 2F4VQ 5H1SE 2Q2TA 4GKKL 2B29A 1PH7A 1YHAA 4BY7H 1V1QA 3M3YH 4A93H 2OQKA 4LFBQ 3CPFA 2VQFQ 1HNZL 3PCOB 4UPAA 4DK6C 3PIOA 4PZ7A 3I4NG 4BA2I 3UE0A 1GD7A 1BBWA 4P75A 3J80c 2BA0A 4JBJA 2ZTEA 3GTJH 4JOIA 4H02A 4A3CH 1HNWL 1OXUA 3M4QA 4JI8Q 2IHFA 4JC0A 4XTCS 1Q86C 5LMNQ 3H3VI 4LF4Q 1Z9FA 3MXNB 4A3JG 3HOWG 2UXCQ 1PHJA 4A3GG 2HHHQ 4GKJQ 4WJ3M 2K5VA 3PO3H 4DR5L 5IE8A 4EQ5A 4OWTB 1VQBA 3HOZG 5IYDH 3UDXA 4AQYQ 3HFZB 1E24A 2UXCL 3BU2A 4RG1A 3F2DA 1I3QH 3OW2A 3E9IA 2CWAA 1EIYB 3RNUA 4P71A 5JJLA 1JE5A 4QL5A 3I55A 1LYLA 2R6GA 2R93H 4DV7L 4P73A 3S14H 1YJ9A 2JA7G 3J81j 3JAMi 1AH9A 1VCIA 5FLMG 4KHPL 4POFA 2B63G 4WJ4A 1N33Q 3H15A 4DR1Q 1NMGA 2EIFA 2E2HH 3RN2A 4A3JH 4LF5L 3J7A5 1SROA 4PMWA 4JI7Q 2KBNA 2WFWA 4AIMA 4A3MH 1PH1A 3I4MH 1X6OA 2OQ0A 4PZ8A 4JYAQ 3FP9A 5EAYA 3CD6A 1CKNB 1FVIA 1X54A 4DV2Q 2Q2HA 2K75A 3HKSA 2PI2E 1K83H 3ULLA 1K8GA 1D7QA 1Q8KA 2JA9A 5C4JH 1PH3A 4JI2L 3A5UA 3CCEA 4NXML 3W5OA 5M3MH 1FGUA 2KHIA 4A3IG 1XPRA 1YZ6A 2K5HA 4DV3L 5M5XH 1L1OC 1Q82C 4DUYQ 2ID0A 2UXBQ 4A4IA 4O2DA 3BZCA 1YITA 3W1GA 1VQ7A 4BY7G 4AH6A 3FKIG 1YJWA 1GM5A 5IP9G 2MQHA 1Y1VG 4B3RL 4JBKA 3M85A 1OTCA 2AWOA 4GOPB 4A76A 3UDGA 2E5LL 2R93G 1IBMQ 3K81C 2I5MX 2BH2A 4R1JA 4DV3Q 2NN6G 1Y14B 4BBSG 4K0KL 3KYHC 3GTGH 4IFDI 3CMEA 1VQPA 1M90C 2IY5B 4KHZA 1I94L 4Y52H 3F8TA 1K3RA 2JQOA 1C7YA 3E0EA 5IT9c 1E22A 4P74A 4GNXC 4JI0L 2ALYB 3UDFA 5GAHC 3HOZH 4FDBA 2E2IH 3HOWH 2JA5H 1KIXA 4LF6Q 5C4XH 4DUZQ 2R7DA 1CKOA 4R4IA 4DV1Q 3PSIA 1I94Q 2QEXA 4B3ML 3KF8B 1VQJA 3PO2G 3HKZE 3M9BA 1OXXK 1TWFH 4LF8Q 1P8LA 3ZJYC 4A3LG 3FKIH 3T1YL 1SRUA 2KCTA 5FLMH 2Y0SG 2IT1A 4L5QA 5M3FG 3T1HL 2BA1A 4DR4L 5GAGC 3H3VH 1BVSA 1VQIA 3RR5A 1VQ9A 1L2FA 1PH5A 2JA7H 3NELA 1SE8A 3UE1A 5C0XJ 3I4MG 4BY1H 5LMNL 1N9WA 1VQKA 4DV5L 2D62A 2R7ZG 3K80C 5J3BA 2JEBI 3J81i 3HOYH 3E9HA 4JG2A 4MTNA 3KDFA 4X66L 2HHHL 1XMQQ 5HGQA 2YTVA 4DR5Q 1SMXA 1PH9A 2BH8A 4LF9Q 1E1TA 3H0GG 1S40A 2UU9Q 3A5ZB 4A3LH 3B6YA 4POGA 2LSSA 1HZBA 5IYBH 4DR2Q 2UXDQ 3CW2C 3EN2A 4LF7L 5M3MG 1AE2A 1HZAA 2F4VL 2UU9L 4GN4B 5C0XG 2IX1A 2JEAI 1GVPA 1DGSA 2R92G 1UE1A 2HIVA 4QGUA 3M4OH 1I6HH 5IP7H 4DV0L 2UUCQ 1W2BA 2V1CC 2UXDL 4BY1G 4HIOA 4PG3A 3HOXH 1VS0A 1KL9A 4LF5Q 3PF4A 4YCUA 2B3GA 4GOPA 3GD7A 3CCLA 2JA8G 1CSPA 2DUDA 5AJ3L 3TS0A 2Z0SA 1WI5A 4RMFA 3LGJA 2FXQA 4X66Q 4B3SL 1KXLA 1N34Q 2DGYA 1Q1BA 1C0AA 1VQGA 1SFOH 2IX0A 1HZCA 1VQFA 4X65L 4IOCA 4LF9L 2PI2A 4B3RQ 4DV7Q 3PO2H 4MNOA 1MKHA 4NXMQ 4HIMA 4IFDG 3K8AA 2IHEA 1FL0A 3CC7A 2ZJQA 1OXVA 4C3HH 4X65Q 4DAYB 5JJKA 3NBHB 3PGZA 1K8AC 1SR3A 4JI7L 2K50A 1YIJA 1WFQA 3TRZA 2Z6KA 4DV1L 4DPGA 2NVTH 1B70B 2UUCL 3RLFA 1Y1VH 2CCZA 4K0KQ 4R4TA 3AFPA 4R4QA 1MIUA 1A63A 1EOVA 2JA8H 4LUOA 3EIVA 4A3MG 1V43A 4GLAC 1ASYA 3HOVH 3S16H 2RHQB 2E8GA 4HJ5A 1X3EA 4OXPA 1TWCH 2I0QA 4IOAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E1O A;  4YCV A;  3HOV G;  4JI6 L;  1S3O A;  1X56 A;  2UXB L;  2GN5 A;  4YWK A;  4YWM A;  1X65 A;  4LFB L;  4KLK A;  1J6Q A;  4LW1 A;  4JOI C;  4LFA Q;  3KF6 A;  3U4V A;  4EX5 A;  1PH2 A;  1TWH H;  3S24 A;  1NY4 A;  1E7Z A;  4UP9 A;  5IYC H;  1A62 A;  1VQ5 A;  1YJN A;  1IBL Q;  1I5F A;  3S1N H;  3M7N A;  1N36 Q;  1PH6 A;  3CAM A;  3L2P A;  2K14 A;  4OX9 L;  1XPU A;  2I5L X;  2XTI A;  3S2H H;  4X64 L;  3DM3 A;  1KRS A;  2N49 A;  1Q81 C;  5JEA G;  3CP0 A;  5IWA L;  3KDF B;  4BBS H;  2D0P A;  4TVA B;  3CCV A;  4HJA A;  1SLJ A;  3G6E A;  2NVX H;  1AE3 A;  4IPG A;  4A3D G;  1PVO A;  3PIP A;  1U5K A;  5IP7 G;  4HID A;  1WOC A;  4IPC A;  4BXX G;  1EUJ A;  1TXY A;  3S1M H;  2LXK A;  3KLW A;  4GS3 A;  1NBW A;  4A3F H;  4JI6 Q;  3PUZ A;  1IZ6 A;  1VQM A;  2OWO A;  3S17 H;  1NTG A;  3HOY G;  4A3F G;  4OWX B;  1VQ4 A;  1UE5 A;  2PMZ E;  1HZ9 A;  2Q2U A;  3ERS X;  4OON A;  1LUZ A;  1HR0 W;  3PUX A;  4HJ7 A;  1XNQ L;  3TEH B;  4ALP A;  4DR2 L;  4B3T Q;  4LF6 L;  2YYZ A;  5JEA J;  3KFU A;  4DR6 L;  3U50 C;  1JMC A;  4L5T A;  4DKA C;  4A3I H;  3OYY A;  4LF8 L;  1C9O A;  2K4K A;  1Q12 A;  1CKM A;  4NPS A;  2CQO A;  2AHO B;  2UUB Q;  3BZK A;  4AYB G;  3UDI A;  2R92 H;  3DLL A;  1S72 A;  1XJV A;  1EWI A;  5M5Y H;  1B7Y B;  2R7Z H;  2KHJ A;  5GRO A;  4QQB X;  2YTX A;  1H95 A;  2WB1 G;  3HOX G;  4B3S Q;  2ZJR A;  2VS1 A;  4YY3 L;  2OTL A;  4C3I H;  4DV6 Q;  4AYB E;  4DR3 Q;  4DR7 L;  4YHH L;  1KAW A;  4BXX H;  3HOU G;  4LF7 Q;  4JBM A;  1PYS B;  2VQE L;  3RN5 A;  3CCR A;  4JI4 Q;  4JI5 L;  5IYC G;  4R4C A;  1Y1W G;  3PUV A;  4QY7 A;  1WCM G;  1KHI A;  2MFI A;  4BBR G;  3VDY A;  4DV0 Q;  5C4X G;  2VZA A;  1HNW Q;  4X6A H;  2RCN A;  4GN5 A;  1X9N A;  3GTL H;  4DR6 Q;  3K7A H;  1FJG Q;  5ELN A;  1Q7Y C;  4JI5 Q;  2YV5 A;  4LFA L;  1JB7 A;  2VW9 A;  5IY0 A;  5LMU Q;  4GNX B;  4JI1 L;  2MNA A;  2F52 A;  2ZM6 L;  1QZH A;  3I4N H;  1YNX A;  4GKJ L;  1UE7 A;  1OXS C;  1MJC A;  2K5N A;  4GN3 B;  3AEV A;  1GO3 E;  1N8R C;  1IYJ B;  1EIF A;  1NJI C;  2A1A A;  4OX9 Q;  3D0F A;  3RZD H;  2E5L Q;  3S15 H;  1CKN A;  3I56 A;  4JYA L;  2UUA Q;  3S1Q H;  1CSQ A;  1X3G A;  2OCE A;  1XMO L;  4OO1 G;  2N8N A;  1T9H A;  3G71 A;  3I7F A;  2ZJP A;  4IJH A;  3CCU A;  1PA6 A;  1O7I A;  2AKW B;  1N36 L;  1J5E L;  5GQO A;  4R4O A;  2GVB A;  3F2B A;  1YEZ A;  3CQZ H;  1KC8 C;  3U4Z A;  4GLV B;  4A3K G;  1JJ2 A;  1HJP A;  4ME3 A;  5C44 G;  1Q1E A;  3W1B A;  3PF5 A;  1QVG A;  1ASZ A;  2VQF L;  2EXD A;  1XNR L;  2PNH A;  4QIW E;  4A75 A;  1VQL A;  3CCJ A;  1HNX Q;  1YHB A;  2VY3 A;  5IWA Q;  3GTP H;  1BKB A;  1VQD A;  1L1O B;  4GNX A;  3L0O A;  5GAD C;  3GTK H;  4A93 G;  1XMQ L;  4IFD J;  1CUK A;  3CMA A;  2Q2I A;  1EQR A;  2NN6 I;  1L1O A;  4PZ6 A;  1D8L A;  1A8V A;  1NMF A;  4OO1 I;  2HIX A;  4A3E G;  1VQO A;  1HNX L;  1EYG A;  3CC4 A;  5BR8 Q;  3OTO Q;  4UP8 A;  4P72 A;  2HT1 A;  4A3B H;  3ICE A;  3KJO A;  4JI0 Q;  1G29 1;  2I5H A;  3K0X A;  1PH4 A;  3D31 A;  1YBY A;  3KF6 B;  3G4S A;  2JE6 I;  4IPH A;  4A3C G;  1XPO A;  2WP8 J;  3TS2 A;  4DV5 Q;  1WCM H;  3HKZ G;  4BBR H;  4AQY L;  3HOU H;  2ZTC A;  4DNI A;  4L5S A;  2JA6 H;  5E7N A;  1YVC A;  4BA1 I;  5C3E H;  3J81 c;  4DV6 L;  2PQA B;  3TQY A;  4DR3 L;  4IJL A;  5LMN W;  1SN8 A;  2NZO A;  2Y0S E;  1NE3 A;  1GKH A;  2N3S A;  4J15 A;  1HH2 P;  4JCV E;  4C2M H;  4GLX A;  1PH8 A;  2JJQ A;  1MJE A;  3EBE A;  1PYB A;  3G48 A;  5IYD G;  2VUM H;  5AJ3 Q;  4DK3 C;  1RL2 A;  2UUB L;  2CKZ B;  1N34 L;  2R7F A;  3CXC A;  3CCM A;  1HR0 L;  1QUQ B;  4A3D H;  4JV5 Q;  2A8V A;  4DUZ L;  1U0L A;  5C0X I;  1FJG L;  4YWL A;  1A0I A;  1I50 H;  4JBW A;  4YCW A;  4C3J H;  1M1K C;  2KCM A;  3JC6 6;  5BR8 L;  1WJJ A;  3OTO L;  5LMU L;  1KD1 C;  3RZO H;  4A3B G;  2NVQ H;  4JI3 L;  2Z6K C;  1YHQ A;  3L7Z C;  2ZM6 Q;  2EQS A;  2H5X A;  3M4P A;  3A0J A;  3KJP A;  3T1Y Q;  1HR0 Q;  1XNQ Q;  2B63 H;  4DR7 Q;  3PV0 A;  2YTY A;  3IRB A;  1BBU A;  2C35 B;  1K73 C;  1IL2 A;  4A3E H;  2JA6 G;  4GKK Q;  3CCS A;  4TQU S;  2JA5 G;  3PO3 G;  2F3I A;  1Z47 A;  5C3E G;  5C44 H;  4JI3 Q;  2VL6 A;  3I2Z A;  1N33 L;  1HNZ Q;  1YI2 A;  1VQ8 A;  4LWC A;  5FLX c;  1VQN A;  1R9T H;  1G6P A;  1XMO Q;  1TWG H;  1KQS A;  2JK8 A;  3GDE A;  1K9M C;  3GTQ H;  3WWV A;  2MO0 A;  5HY6 A;  4A3K H;  5FJ8 G;  2AMC B;  1IXR A;  1WYD A;  3CF5 A;  2NZH A;  4YY3 Q;  1K0R A;  3STB D;  4DV4 Q;  1VQ6 A;  5M3F H;  1N32 Q;  5GAE C;  3AQQ A;  3CPW A;  1JJC B;  4YHH Q;  3RLO A;  1VQA A;  2WAQ G;  1VQE A;  1QUQ A;  1VQC A;  4LF4 L;  1UEB A;  3STB C;  5IP9 H;  2OTJ A;  4Y7N H;  2CFM A;  2HQL A;  2VNU D;  4APV A;  4LFC L;  2UUA L;  3F1Z A;  2ZTD A;  2A19 A;  3S1R H;  4DR1 L;  4DUY L;  1EQQ A;  1IBL L;  4LUZ A;  3A74 A;  1QVF A;  1G51 A;  2D0O A;  3GTM H;  3NEN A;  4NXN Q;  1PV4 A;  3NEM A;  4HJ9 A;  4LNQ A;  2ASB A;  4A3G H;  1JT8 A;  3ER0 A;  1RIP A;  1IBK Q;  3GO5 A;  3S2D H;  4JI1 Q;  4B3M Q;  4GOP C;  3H0G H;  1P16 A;  1TWA H;  2QGQ A;  2YU9 H;  1XTD A;  4DAM A;  2VQE Q;  3CC2 A;  4JI4 L;  3J7Z C;  4NXN L;  5FJ8 H;  1XNR Q;  3ULJ A;  5IYB G;  5K36 G;  4KHP Q;  3AYH B;  4X62 L;  1EFW A;  4MZ9 A;  1IBK L;  1UE6 A;  1X3F A;  4DV4 L;  1N32 L;  1VQH A;  4O0A A;  3Q8D A;  3I4O A;  4UY8 C;  2KEN A;  4HIK A;  2PQA A;  4QJF A;  3GTO H;  3JAM c;  1X55 A;  2VUM G;  3MEF A;  1KRT A;  3BJU A;  1V9P A;  3PUY A;  4HJ8 A;  5JJI A;  3K7U C;  5M5W H;  1E3P A;  1B8A A;  2CWP A;  4KI0 A;  1J5E Q;  4X64 Q;  4OWW B;  1OXT A;  2L15 A;  3PUW A;  1L0W A;  3SGI A;  3CCQ A;  1IBM L;  2XGT A;  3AFQ A;  1Q46 A;  2RHS B;  2WAQ E;  4DV2 L;  4LFC Q;  3RLN A;  3F2C A;  2ES2 A;  2NVY H;  4IO9 A;  3KOJ A;  1QVC A;  4B3T L;  2N78 A;  4XIG S;  4JV5 L;  4JI2 Q;  4JI8 L;  2GVA A;  2QA4 A;  3U58 A;  4LUV A;  4NB3 A;  3T1H Q;  4DR4 Q;  3TRE A;  1JJG A;  2MO1 A;  2ATW A;  1LM0 A;  2WB1 E;  1Y1W H;  1UWV A;  1PFS A;  1QZG A;  1W3S A;  3FHW A;  3ULP A;  4UP7 A;  2K52 A;  4IPD A;  5ELO A;  1LTL A;  2AWN A;  4X62 Q;  5DLQ E;  3J80 i;  2E2J H;  2RF4 A;  2LXJ A;  4L5R C;  2F4V Q;  5H1S E;  2Q2T A;  4GKK L;  2B29 A;  1PH7 A;  1YHA A;  4BY7 H;  1V1Q A;  3M3Y H;  4A93 H;  2OQK A;  4LFB Q;  3CPF A;  2VQF Q;  1HNZ L;  3PCO B;  4UPA A;  4DK6 C;  3PIO A;  4PZ7 A;  3I4N G;  4BA2 I;  3UE0 A;  1GD7 A;  1BBW A;  4P75 A;  3J80 c;  2BA0 A;  4JBJ A;  2ZTE A;  3GTJ H;  4JOI A;  4H02 A;  4A3C H;  1HNW L;  1OXU A;  3M4Q A;  4JI8 Q;  2IHF A;  4JC0 A;  4XTC S;  1Q86 C;  5LMN Q;  3H3V I;  4LF4 Q;  1Z9F A;  3MXN B;  4A3J G;  3HOW G;  2UXC Q;  1PHJ A;  4A3G G;  2HHH Q;  4GKJ Q;  4WJ3 M;  2K5V A;  3PO3 H;  4DR5 L;  5IE8 A;  4EQ5 A;  4OWT B;  1VQB A;  3HOZ G;  5IYD H;  3UDX A;  4AQY Q;  3HFZ B;  1E24 A;  2UXC L;  3BU2 A;  4RG1 A;  3F2D A;  1I3Q H;  3OW2 A;  3E9I A;  2CWA A;  1EIY B;  3RNU A;  4P71 A;  5JJL A;  1JE5 A;  4QL5 A;  3I55 A;  1LYL A;  2R6G A;  2R93 H;  4DV7 L;  4P73 A;  3S14 H;  1YJ9 A;  2JA7 G;  3J81 j;  3JAM i;  1AH9 A;  1VCI A;  5FLM G;  4KHP L;  4POF A;  2B63 G;  4WJ4 A;  1N33 Q;  3H15 A;  4DR1 Q;  1NMG A;  2EIF A;  2E2H H;  3RN2 A;  4A3J H;  4LF5 L;  3J7A 5;  1SRO A;  4PMW A;  4JI7 Q;  2KBN A;  2WFW A;  4AIM A;  4A3M H;  1PH1 A;  3I4M H;  1X6O A;  2OQ0 A;  4PZ8 A;  4JYA Q;  3FP9 A;  5EAY A;  3CD6 A;  1CKN B;  1FVI A;  1X54 A;  4DV2 Q;  2Q2H A;  2K75 A;  3HKS A;  2PI2 E;  1K83 H;  3ULL A;  1K8G A;  1D7Q A;  1Q8K A;  2JA9 A;  5C4J H;  1PH3 A;  4JI2 L;  3A5U A;  3CCE A;  4NXM L;  3W5O A;  5M3M H;  1FGU A;  2KHI A;  4A3I G;  1XPR A;  1YZ6 A;  2K5H A;  4DV3 L;  5M5X H;  1L1O C;  1Q82 C;  4DUY Q;  2ID0 A;  2UXB Q;  4A4I A;  4O2D A;  3BZC A;  1YIT A;  3W1G A;  1VQ7 A;  4BY7 G;  4AH6 A;  3FKI G;  1YJW A;  1GM5 A;  5IP9 G;  2MQH A;  1Y1V G;  4B3R L;  4JBK A;  3M85 A;  1OTC A;  2AWO A;  4GOP B;  4A76 A;  3UDG A;  2E5L L;  2R93 G;  1IBM Q;  3K81 C;  2I5M X;  2BH2 A;  4R1J A;  4DV3 Q;  2NN6 G;  1Y14 B;  4BBS G;  4K0K L;  3KYH C;  3GTG H;  4IFD I;  3CME A;  1VQP A;  1M90 C;  2IY5 B;  4KHZ A;  1I94 L;  4Y52 H;  3F8T A;  1K3R A;  2JQO A;  1C7Y A;  3E0E A;  5IT9 c;  1E22 A;  4P74 A;  4GNX C;  4JI0 L;  2ALY B;  3UDF A;  5GAH C;  3HOZ H;  4FDB A;  2E2I H;  3HOW H;  2JA5 H;  1KIX A;  4LF6 Q;  5C4X H;  4DUZ Q;  2R7D A;  1CKO A;  4R4I A;  4DV1 Q;  3PSI A;  1I94 Q;  2QEX A;  4B3M L;  3KF8 B;  1VQJ A;  3PO2 G;  3HKZ E;  3M9B A;  1OXX K;  1TWF H;  4LF8 Q;  1P8L A;  3ZJY C;  4A3L G;  3FKI H;  3T1Y L;  1SRU A;  2KCT A;  5FLM H;  2Y0S G;  2IT1 A;  4L5Q A;  5M3F G;  3T1H L;  2BA1 A;  4DR4 L;  5GAG C;  3H3V H;  1BVS A;  1VQI A;  3RR5 A;  1VQ9 A;  1L2F A;  1PH5 A;  2JA7 H;  3NEL A;  1SE8 A;  3UE1 A;  5C0X J;  3I4M G;  4BY1 H;  5LMN L;  1N9W A;  1VQK A;  4DV5 L;  2D62 A;  2R7Z G;  3K80 C;  5J3B A;  2JEB I;  3J81 i;  3HOY H;  3E9H A;  4JG2 A;  4MTN A;  3KDF A;  4X66 L;  2HHH L;  1XMQ Q;  5HGQ A;  2YTV A;  4DR5 Q;  1SMX A;  1PH9 A;  2BH8 A;  4LF9 Q;  1E1T A;  3H0G G;  1S40 A;  2UU9 Q;  3A5Z B;  4A3L H;  3B6Y A;  4POG A;  2LSS A;  1HZB A;  5IYB H;  4DR2 Q;  2UXD Q;  3CW2 C;  3EN2 A;  4LF7 L;  5M3M G;  1AE2 A;  1HZA A;  2F4V L;  2UU9 L;  4GN4 B;  5C0X G;  2IX1 A;  2JEA I;  1GVP A;  1DGS A;  2R92 G;  1UE1 A;  2HIV A;  4QGU A;  3M4O H;  1I6H H;  5IP7 H;  4DV0 L;  2UUC Q;  1W2B A;  2V1C C;  2UXD L;  4BY1 G;  4HIO A;  4PG3 A;  3HOX H;  1VS0 A;  1KL9 A;  4LF5 Q;  3PF4 A;  4YCU A;  2B3G A;  4GOP A;  3GD7 A;  3CCL A;  2JA8 G;  1CSP A;  2DUD A;  5AJ3 L;  3TS0 A;  2Z0S A;  1WI5 A;  4RMF A;  3LGJ A;  2FXQ A;  4X66 Q;  4B3S L;  1KXL A;  1N34 Q;  2DGY A;  1Q1B A;  1C0A A;  1VQG A;  1SFO H;  2IX0 A;  1HZC A;  1VQF A;  4X65 L;  4IOC A;  4LF9 L;  2PI2 A;  4B3R Q;  4DV7 Q;  3PO2 H;  4MNO A;  1MKH A;  4NXM Q;  4HIM A;  4IFD G;  3K8A A;  2IHE A;  1FL0 A;  3CC7 A;  2ZJQ A;  1OXV A;  4C3H H;  4X65 Q;  4DAY B;  5JJK A;  3NBH B;  3PGZ A;  1K8A C;  1SR3 A;  4JI7 L;  2K50 A;  1YIJ A;  1WFQ A;  3TRZ A;  2Z6K A;  4DV1 L;  4DPG A;  2NVT H;  1B70 B;  2UUC L;  3RLF A;  1Y1V H;  2CCZ A;  4K0K Q;  4R4T A;  3AFP A;  4R4Q A;  1MIU A;  1A63 A;  1EOV A;  2JA8 H;  4LUO A;  3EIV A;  4A3M G;  1V43 A;  4GLA C;  1ASY A;  3HOV H;  3S16 H;  2RHQ B;  2E8G A;  4HJ5 A;  1X3E A;  4OXP A;  1TWC H;  2I0Q A;  4IOA A; 
#chains in the Genus database with same CATH topology
 1E1O A;  2UXB L;  1X56 A;  4YWK A;  1F9Q A;  1J6Q A;  4JOI C;  1IKL A;  1B50 A;  1PH2 A;  1TWH H;  1LTA D;  4HED A;  1A62 A;  4JVZ A;  1STG A;  1VQ5 A;  2CH4 W;  1C48 A;  1I5F A;  4XXE A;  3S1N H;  3M7N A;  1EIY B;  1PH6 A;  4WRD A;  2NTS A;  3L2P A;  4OX9 L;  3QO2 A;  2XTI A;  4C3I B;  1SYC A;  1SFO B;  3DM3 A;  1Q81 C;  3CP0 A;  2F0L A;  3KDF B;  1L0X B;  4TVA B;  5ELD A;  1I4R A;  5C6A A;  1SLJ A;  2NVX H;  1AE3 A;  4IUT A;  5I9O A;  2KUM A;  1Z6H A;  4E6I A;  4BXX G;  1STB A;  2IPK D;  3H94 A;  4KN4 C;  3NWS A;  4OWX B;  1VQ4 A;  4JPB W;  2N55 A;  1MGS A;  3ERS X;  1LT4 D;  1LUZ A;  1QCB D;  3H3V C;  1XNQ L;  4DAP A;  2KA7 A;  3RZO B;  4ALP A;  4DR2 L;  4B3T Q;  2X6L A;  1ET9 A;  3KFU A;  4KMU C;  5FO9 B;  3U50 C;  2HCI A;  4F87 A;  1LV9 A;  1Q12 A;  4NPS A;  2CHB D;  3J7A F;  2F0P A;  2DY8 A;  1FYC A;  1EWI A;  1A6X A;  5FK9 C;  2KHJ A;  5GRO A;  3S1N B;  2YTX A;  2XN9 C;  2RKS A;  2VS1 A;  4C3I H;  1KAW A;  1SND A;  3KBX A;  3VA5 A;  4JBM A;  4JI4 Q;  4LF7 Q;  4JI5 L;  4TKO B;  4R4C A;  5IYC G;  3KLS X;  4K6L A;  1D5M C;  1IW7 D;  1BDO A;  5BN3 A;  1KHI A;  2L11 A;  2RCN A;  1Q7Y C;  3SEB A;  5I6Y A;  3CHB D;  1V1P A;  2EDG A;  2EVB A;  5IY0 A;  5K36 H;  5EQ0 A;  2ZM6 L;  3I4N H;  3PO2 B;  5ELE A;  1BCP D;  3AEV A;  3EJI A;  1GO3 E;  1N8R C;  4IZ8 A;  2YU9 B;  3D0F A;  1GJX A;  3RZD H;  1X3G A;  2KQ3 A;  2VUM B;  1T9H A;  3NPP A;  3F2B A;  4WJW A;  4A3K G;  1HJP A;  1RTO A;  2F0I A;  1KAA A;  1ASZ A;  4GZY C;  1YNJ D;  2VQF L;  4X3U A;  3JAM E;  1NR4 A;  4ZAI A;  3CCJ A;  1HNX Q;  3GTP H;  1SYG A;  4A93 G;  4IUU A;  2NN6 I;  1D8L A;  5CBE E;  1NMF A;  1HNX L;  2B8F A;  4UP8 A;  2HT1 A;  4A3B H;  3ICE A;  3H91 A;  1F9S A;  3KF6 B;  2F0O A;  4CHT B;  2JE6 I;  1D1I A;  1WD0 A;  4A93 B;  4K6D A;  2WP8 J;  3SK8 A;  4DNI A;  2JA6 H;  2A74 C;  2QIL A;  2JSO A;  1SN8 A;  1NE3 A;  1GKH A;  4J15 A;  1QNK A;  3TP7 A;  2JJQ A;  1LAB A;  5AJ3 Q;  1RL2 A;  2CKZ B;  1N34 L;  3CXC A;  1HR0 L;  4FXD A;  3MZ5 A;  3CQZ B;  1A0I A;  2F3V A;  1SE3 A;  1D2B A;  1EZ8 A;  1WJJ A;  2EY1 A;  5BR8 L;  1A3U A;  4KY7 A;  1EY8 A;  4C3J G;  2H5X A;  3I73 A;  4ZRZ A;  1XTC D;  2EY2 A;  2K5W A;  1HR0 Q;  1CFM A;  3PV0 A;  1I3Q B;  2C35 B;  2BE5 C;  4TQU S;  5A2Q E;  5EKK A;  3I70 A;  1Z47 A;  3SE0 A;  1N33 L;  5DM7 3;  1YI2 A;  4LWC A;  1CK1 A;  5FLX c;  1R9T H;  1XMO Q;  3Q22 A;  2JK8 A;  1STH A;  2Z6B A;  4LAA A;  3VR5 A;  2MO0 A;  3CF5 A;  5EBC A;  1VQ6 A;  4DV4 Q;  5F2D A;  4RAU C;  3F2U A;  5GAE C;  3AQQ A;  5M3F H;  3CPW A;  3HOU B;  1R4P B;  4LF4 L;  1VQC A;  5CGK A;  3STB C;  4DAY A;  5TSS A;  4X3K A;  3P1H A;  3FPP A;  1Y8P B;  3G7L A;  2UUA L;  2ZTD A;  3F1Z A;  2OF1 A;  5E4W C;  1G51 A;  2JP1 A;  1O7Y A;  1PV4 A;  3NEM A;  2ASB A;  1DCZ A;  1ET6 A;  1RIP A;  3S2D H;  4O1N A;  4JI1 Q;  1P16 A;  2HQE A;  2YU9 H;  1XTD A;  2F1M A;  2ZXR A;  2VQE Q;  2NUC A;  5DEH A;  5FJ8 H;  5EKI A;  4WOR A;  3ULJ A;  5K36 G;  1UNS A;  3I4L A;  4KHP Q;  4X62 L;  3GTJ B;  3I4O A;  2KEN A;  3JAM c;  1X55 A;  2RA4 A;  3PUY A;  3OIP A;  3A7L A;  1EY9 A;  4KI0 A;  2ENB A;  1B44 D;  3HOW B;  1IBM L;  1Q46 A;  2B2T A;  2RHS B;  2EYF A;  2WKD A;  4IQZ A;  4IO9 A;  2L9H A;  4G7Z C;  3U58 A;  3P20 A;  3BG3 A;  4LUV A;  3T1H Q;  1F9R A;  2BCO A;  1JJG A;  2MO1 A;  2ATW A;  1GUW A;  5M9O A;  1UWV A;  1PFS A;  1HQR D;  1W3S A;  2F0M A;  4R8N A;  2AWN A;  4X62 Q;  5DLQ E;  1U4L A;  2RF4 A;  4PNY A;  4GKK L;  3GTM B;  1PH7 A;  4KY6 A;  4RH6 A;  5A35 A;  2RBM A;  3A55 A;  3M3Y H;  4ULL A;  4NW2 A;  4U67 3;  4ZQ3 A;  3MFY A;  1HNZ L;  1DON A;  4DK6 C;  4MN3 A;  5D65 A;  4RA8 A;  2C5C A;  5DNF A;  4KJN A;  4HTH A;  3TSS A;  3I4N G;  5C3E B;  2F0U A;  3J80 c;  1O7L A;  2SNS A;  4QMG A;  5JEA H;  1HNW L;  3IFD A;  3M4Q A;  2FMM A;  5M3M B;  4JC0 A;  3C2P A;  1WTW A;  5M5X B;  4QUF A;  2HHH Q;  1ILP A;  2K5V A;  4O42 A;  1H9K A;  3HOZ G;  5IYD H;  2ZT9 C;  1PXU A;  1LTR D;  3HFZ B;  5IGD A;  4DK1 A;  1YNN C;  2E76 C;  3E9I A;  4B08 A;  3DEO A;  2F0K A;  3K5L A;  3OW2 A;  3RNU A;  2QDL A;  5C5M A;  2R93 H;  1LYL A;  3S14 H;  1YJ9 A;  1X3P A;  1PZJ D;  1AH9 A;  5FLM G;  3HOZ B;  1GOZ A;  2HDL A;  1I4G A;  4FNF A;  4A3J H;  1DYQ A;  4JI7 Q;  1BOS A;  4A3M H;  4HAE A;  5FLX E;  4G7O C;  2OQ0 A;  3MAQ A;  1R4Q B;  4CJ0 B;  5EAY A;  1BQQ T;  2PI2 E;  2K75 A;  3HRZ C;  3ULL A;  3VA7 A;  4FF4 A;  2F0W A;  1PH3 A;  2PPB C;  3W5O A;  1FGU A;  2K5H A;  5CYU A;  5DM6 3;  3HOV B;  3S16 B;  1Q82 C;  1C8C A;  4DUY Q;  4A3G B;  2UXB Q;  1YIT A;  3P7J A;  3BZC A;  4O2D A;  1VQ7 A;  4BY7 G;  2RSN A;  1ILQ A;  4AH6 A;  1YJW A;  1GM5 A;  3FVQ A;  3H0G B;  1TWA B;  2AWO A;  2KEE A;  4LJZ C;  2R93 G;  2XIW A;  2K28 A;  3CRL C;  2ICE C;  2WII B;  4BBS G;  1ONL A;  1VQP A;  2IY5 B;  4Y52 H;  3F8T A;  1EQV A;  1RJT A;  1C7Y A;  3S14 B;  4FDB A;  4IFD H;  4LF6 Q;  4DN4 M;  4BBS B;  2R7D A;  1I6H B;  2E74 C;  4DV1 Q;  3MC0 B;  2QEX A;  1VQJ A;  3HKZ E;  1P8L A;  3SR1 A;  2PW5 A;  4A3L G;  1EYA A;  5KNB A;  5E1F A;  3J7Y W;  5C5L A;  2Y0S G;  1Q8I A;  2MUY A;  3C3L A;  1LTS D;  5C4J B;  3MWY W;  2JA7 H;  4TRD A;  5C0X J;  3NP8 A;  1EL0 A;  2D62 A;  3WOE A;  4K5W A;  4RGM A;  3I3C A;  3K58 A;  4DAV A;  4V19 0;  2YTV A;  4DR5 Q;  1SMX A;  3R8B A;  2BH8 A;  2NVT B;  1S40 A;  2L1B A;  2UU9 Q;  1K0S A;  4K2L A;  4POG A;  2LSS A;  4ZUI A;  1A2U A;  3CW2 C;  5C0X H;  3HS0 C;  2F4V L;  4NKL A;  5CV9 A;  2UU9 L;  5C0X G;  2JN4 A;  1B9N A;  3M4O H;  5IP7 H;  1JIC A;  4PG3 A;  2F0T A;  4H0L C;  1KL9 A;  2CW0 C;  2B3G A;  3FKI B;  1EQT A;  2Z0S A;  4RMF A;  5C3W A;  3TS0 A;  3FDT A;  4DFA A;  5J22 A;  1KXL A;  2L4N A;  1VQG A;  1SFO H;  1BF4 A;  1G8Z D;  1I4P A;  1Y8N B;  2IX0 A;  1VQF A;  5IGG A;  4X65 L;  4DV7 Q;  1STY A;  1ENF A;  4MNO A;  5T1G A;  2F0E A;  5IIF A;  2IHE A;  1OXV A;  3K5M A;  5G3L F;  1MSH A;  1G2T A;  2OEO A;  2PZU A;  5JJK A;  1SR3 A;  1YIJ A;  2PNR C;  2NVT H;  3OWE B;  3V2T A;  3KBG A;  3AFP A;  4R4Q A;  3BDO A;  1NSN S;  3EIV A;  3BS1 A;  1V43 A;  4GLA C;  3HOV H;  3A56 A;  3S16 H;  4HJ5 A;  2JYO A;  4A3E H;  1BCP F;  1Q90 A;  5D14 A;  3BZD B;  4JI6 L;  2DY7 A;  4ZKC B;  1X65 A;  1JOQ A;  4LFA Q;  3U4V A;  2HCC A;  3KF6 A;  4EX5 A;  2TMP A;  3GTK B;  1NY4 A;  1DOM A;  1E7Z A;  2NZ1 D;  1IBL Q;  5M5Y B;  5FO7 B;  3ITP A;  4CKB A;  2K14 A;  2I5L X;  4ZKB B;  3OMG A;  1X3Q A;  5EJW A;  1EEI D;  4BBS H;  3MXU A;  2D0P A;  4L8J A;  1CHP D;  1GUT A;  4IUQ A;  4A3D G;  4HID A;  1WOC A;  1EUJ A;  2LXK A;  4JI6 Q;  3NWT A;  1IZ6 A;  1VQM A;  3S17 H;  2PMZ B;  1NTG A;  2IX3 A;  3HOY G;  3TDQ A;  1YNN D;  3I4N B;  4N9T A;  2PMZ E;  5J39 A;  4A3D B;  1QIL A;  2B2W C;  3GP7 A;  1IKM A;  3E5S A;  4HJ7 A;  4H7B A;  4WFN 3;  1I50 B;  1X32 A;  1JMC A;  2K33 A;  4A3I H;  3S1Q B;  3MTS A;  4LF8 L;  1C9O A;  2K4K A;  1RD9 D;  2F0G A;  2UUB Q;  3BZK A;  5T1I A;  4AYB G;  3AB9 A;  2R92 H;  1B53 A;  1S5B D;  1B7Y B;  1H95 A;  4DF7 A;  5E4X A;  3HOX G;  5KYI A;  3GV3 A;  1F2Y A;  4DV6 Q;  4DR3 Q;  4AYB E;  2RVL A;  1BUV T;  4J1M A;  3CCR A;  4AYB B;  2A6H D;  3I72 A;  3T51 B;  4XQN A;  3S9W A;  3H09 A;  4FF2 A;  1FGB D;  1WCM G;  1VDZ A;  4DV0 Q;  5C4X G;  4X6A H;  1UAP A;  1FJG Q;  1CQF A;  4A3F B;  3S1R B;  4KD3 A;  1JB7 A;  1ZYR C;  3KUP A;  4HMJ A;  4KTA A;  4GNX B;  4HSV A;  4JI1 L;  2F52 A;  2MNA A;  1YNX A;  2DJG C;  1OXS C;  1MJC A;  4GN3 B;  1WCM B;  1YNJ C;  2EZV A;  2F0V A;  2M00 A;  2B2V A;  1CKN A;  4JYA L;  2D2C C;  3FMC A;  4A3I B;  2UUA Q;  1CSQ A;  1XMO L;  5L37 A;  4IJH A;  1PA6 A;  4BS9 A;  2AKW B;  2EPB A;  3J80 L;  3MA2 B;  3CQZ H;  3U4Z A;  2NWG A;  4GLV B;  4ME3 A;  1SNQ A;  1DM0 B;  5C44 G;  1Q1E A;  3L9A X;  1AFP A;  2LS0 1;  4QCL A;  4Q5V A;  2EXD A;  1K3B C;  4QIW E;  4A75 A;  5FO8 B;  2NVY B;  1YHB A;  2VY3 A;  2R61 A;  1BKB A;  1VQD A;  1CT1 D;  4GNX A;  3W2D A;  1PFN A;  2SOB A;  5HGT A;  5C44 B;  1Y1W B;  1SAP A;  1A8V A;  4OO1 I;  2HIX A;  3MXP A;  1MHW C;  3OTO Q;  2IJ0 A;  3KJO A;  2I5H A;  3K0X A;  1S5F D;  1KNE A;  1YBY A;  3D31 A;  4QB4 A;  1PRT C;  4OO1 H;  1TT2 A;  3PIP 3;  5ISR A;  1TVX A;  1WCM H;  4KKU A;  4AQY L;  5FKA C;  3TP5 A;  2A6H C;  5LL6 X;  5C3E H;  4IJL A;  1XXG A;  2B2T C;  5LMN W;  4GLX A;  4EVO A;  2N3S A;  2QEJ C;  4JCV E;  1HH2 P;  1PH8 A;  1MJE A;  2SNM A;  3G48 A;  5IYD G;  1GUG A;  2EYH A;  1PFB A;  5CMD A;  2KCC A;  2R7F A;  3CCM A;  1ESR A;  4JV5 Q;  4A3D H;  4J6H A;  2A69 D;  3QOL A;  1O7Z A;  1I50 H;  4JBW A;  4YCW A;  4C3J H;  3JC6 6;  3RZO H;  3OTO L;  4A3B G;  4JI3 L;  2Z6K C;  1YHQ A;  3A0J A;  3KJP A;  2B63 H;  5NUC A;  4DR7 Q;  1SYD A;  2YTY A;  3OIQ A;  4EQP A;  1BBU A;  1BR9 A;  4GKK Q;  2JA6 G;  2F3I A;  1WTR A;  4UAI A;  3OMC A;  2VL6 A;  1JOR A;  1QWY A;  2XWB B;  3GDE A;  1D6E C;  5HY6 A;  3OOC A;  3NHH A;  1IXR A;  1JOO A;  2NZH A;  4YY3 Q;  1N32 Q;  2QF7 A;  3HP3 A;  1PFM A;  3RLO A;  5FLX L;  1VQA A;  2WAQ G;  4HMI A;  2J4X A;  2BDN A;  2EYM A;  5IP9 H;  1ENA A;  2CFM A;  1TU2 B;  2VNU D;  4APV A;  3K7A B;  1IW7 C;  1V8Q A;  3K0Y A;  1QVF A;  4LUZ A;  3NEN A;  4NXN Q;  4HJ9 A;  2DJF C;  2F0J A;  2RDH A;  1LTG D;  1VMC A;  3GO5 A;  4RGN A;  2TSS A;  3QB3 A;  3H0G H;  4GOP C;  2I07 B;  5IGE A;  4DAM A;  3CC2 A;  5I2X A;  2VB3 X;  3S15 B;  3NQI A;  1XNR Q;  2A68 C;  3NSW A;  5IYB G;  3AYH B;  3GTG B;  1N32 L;  1VQH A;  1SJE D;  3Q8D A;  3KF8 A;  4HIK A;  2A69 C;  2PQA A;  3MEF A;  5I4D A;  1V9P A;  4RHS A;  5M5W H;  1E3P A;  2XNA C;  1B8A A;  2F0S A;  2B39 A;  3OPO A;  2F03 A;  4OWW B;  3M7G A;  1TWG B;  2Z4I A;  1L0W A;  3SGI A;  4LFC Q;  2HUG A;  4ODG A;  4M8A A;  1PTO B;  2K5Q A;  4M1U B;  3DEP A;  2ES2 A;  2NVY H;  3KOJ A;  1QVC A;  2N78 A;  1TWF B;  2VB2 X;  4DR4 Q;  4F88 A;  4RHR A;  1HXY D;  3HEJ A;  3MHB A;  1QZG A;  3ULP A;  3Q24 A;  4IPD A;  3ZYY X;  1LTL A;  2B2V C;  4NDX A;  3KLR A;  1EY5 A;  1YHA A;  2N88 A;  1V1Q A;  1TY2 A;  3S2D B;  3TME A;  2CQA A;  3PIO A;  3VR3 A;  2MHV A;  4PZ7 A;  3UE0 A;  3N52 A;  1GD7 A;  2AUK A;  3MXN A;  2Z8L A;  4JOI A;  4A3C H;  1XX8 A;  4CKC A;  4XTC S;  2A6E C;  3H3V I;  4LF4 Q;  2UXC Q;  1KLG D;  4X3S A;  5M5W B;  2A5H A;  4GKJ Q;  2H4O A;  3PO3 H;  4DR5 L;  4K8I A;  5IGC A;  1VQB A;  2V4D A;  4MTK A;  3VR4 A;  4AQY Q;  1E24 A;  3HOX B;  1EEF D;  4CDD C;  3URY A;  1JE5 A;  4P73 A;  2JA7 G;  3JAM i;  1STN A;  3SXH A;  1JCK B;  2X6G A;  4POF A;  3NTK A;  1TS5 A;  1N33 Q;  4WJ4 A;  5C4X B;  1NMG A;  2E2H H;  1S5D D;  4KD4 A;  3RN2 A;  3J7A 5;  1B2T A;  1PH1 A;  2VXW A;  4PZ8 A;  2LFN A;  3BVG A;  2ZXO A;  5KYL A;  3HKS A;  5CV5 A;  1FNU A;  1F2Z A;  2JA9 A;  5C4J H;  1WTO A;  3HGB A;  5M3M H;  2KHI A;  4A3I G;  1XPR A;  4DV3 L;  2ID0 A;  2E2D C;  1KDB A;  3SK6 A;  2Z9H A;  3FKI G;  5IP9 G;  2C9O A;  1OO9 B;  4KY5 A;  1IBM Q;  1EIG A;  3K81 C;  4C56 C;  2I5M X;  4DV3 Q;  2NN6 G;  3KYH C;  3GTG H;  4HR7 B;  1M90 C;  3EQL C;  4KHZ A;  3PQI A;  1AW7 A;  1K3R A;  1B3Q A;  4P74 A;  5EBD A;  3HOZ H;  1LT6 D;  2F4I A;  1CKO A;  4R4I A;  3KF8 B;  4QUC A;  4OIK A;  1CHQ D;  1CTM A;  3T1Y L;  1JWS D;  2KCT A;  1G6Z A;  2BA1 A;  3DXJ C;  3ERO A;  1VQ9 A;  2K5D A;  1L2F A;  1SE4 A;  1PH5 A;  4KN7 C;  4C1N K;  1SE8 A;  2WAC A;  4XT1 B;  1I4X A;  3UE1 A;  1PTO D;  3NQT A;  3G6J B;  3M3Y B;  1EWC A;  5J3B A;  3L3O C;  3E9H A;  4MTN A;  1SNM A;  4L6T B;  5HGQ A;  1QOH A;  1RDP D;  1ML0 D;  5E3F A;  3NK9 A;  2F0H A;  4LF9 Q;  1Y1V B;  1HQM C;  4QIW B;  1TY0 A;  1AN8 A;  2OXP A;  5I6W A;  2UXD Q;  1GHK A;  1A3V A;  1DXM A;  4RFB A;  4A3E B;  2AQ1 B;  4MHE A;  4GN4 B;  2JEA I;  4F8M A;  1DGS A;  1TR5 A;  3QJY A;  2HIV A;  5EPJ A;  3I8Z A;  1I6H H;  4DV0 L;  1W2B A;  1HA5 A;  4ZK9 B;  4BY1 G;  5FOB B;  4Z9C B;  1VS0 A;  1EY0 A;  4RWS C;  4LF5 Q;  2GA4 B;  5KRU A;  1N36 Q;  2DUD A;  3LGJ A;  2FXQ A;  5IT9 E;  3S2H B;  5K5P A;  1RTN A;  1HZC A;  2SEB D;  1VF5 C;  4IOC A;  1T5E A;  3A8J E;  1CZW A;  4KKS A;  4C3H G;  4HIM A;  4IFD G;  2E2H B;  2WB1 B;  3K8A A;  3MEH A;  4C3H H;  2O5I C;  3HOY B;  3PGZ A;  1EWH A;  1ZKO A;  2B8G A;  5ELF A;  2IW3 A;  1WFQ A;  1PYW D;  4FF3 A;  2G9D A;  4DPG A;  2EY6 A;  3RLF A;  2CCZ A;  2KJX A;  4K0K Q;  4R8I A;  1RCV D;  1A63 A;  1PRT F;  2O2L D;  3TBI B;  2XSC A;  2KED A;  1X3E A;  1C4Q A;  2L0C A;  4OXP A;  1JR0 D;  5JEA G;  5IWA L;  4YCV A;  4OGQ C;  1S3O A;  5CC4 A;  3UI2 A;  2GN5 A;  3QOJ A;  4LW1 A;  3U9S A;  1EFI D;  5BN5 A;  4UP9 A;  4KK7 A;  4TSS A;  1IL8 A;  1B3A A;  1PRT D;  1E2V A;  2NBF A;  4XQJ A;  1LTI D;  4FXG C;  4DNR B;  3GQB A;  4HJA A;  4H13 C;  1KDC A;  4IPG A;  3PIP A;  4ABN A;  4PMB A;  4IPC A;  1TXY A;  4GS3 A;  1NBW A;  4A3F H;  3PUZ A;  2OWO A;  3DUZ A;  1H9S A;  3ERQ A;  1UE5 A;  1UEA B;  4DGZ A;  4KHV A;  2L55 A;  2Q2U A;  4P2C B;  4OON A;  3D4D A;  1HR0 W;  1IYU A;  3PUX A;  4C3J B;  4CDE C;  1DOK A;  1TWC B;  2F0D A;  2NVQ B;  3NE5 B;  1BCP B;  4DKA C;  2EYP A;  3C1E A;  3OYY A;  4EGV A;  2RDF A;  2AHO B;  2Z4H A;  3LX0 A;  2WKC A;  5M5Y H;  2WV6 D;  1VMP A;  2L12 A;  4I65 A;  3W3A A;  2ZJR A;  4YY3 L;  2OTL A;  1U9R A;  1CA5 A;  4DR7 L;  4ID6 A;  4YHH L;  1O78 A;  3HOU G;  4BXX H;  2VQE L;  5KND A;  1Y1W G;  1HCZ A;  4OL7 A;  3BDL A;  4QY7 A;  3VDY A;  1HNW Q;  3K7A H;  3V05 A;  4JI5 Q;  2YV5 A;  4LFA L;  4A3B B;  2VW9 A;  4IUN A;  5LMU Q;  1SYB A;  3O13 A;  1PTO F;  1QZH A;  5KIX A;  1FNW A;  1UE7 A;  2J0T D;  3BVZ A;  1TS4 A;  2JA6 B;  5DAU A;  2K05 A;  4QF4 A;  3S15 H;  3I56 A;  5C4H A;  4ILW A;  2JXM B;  2OCE A;  2A68 D;  5C3X A;  3I7F A;  3CCU A;  2Q8T A;  1N36 L;  1O7I A;  4FYD A;  5GQO A;  2GVB A;  4DNT B;  1TS3 A;  1RHP A;  1JJ2 A;  3PF5 A;  1QVG A;  3W1B A;  4RGO S;  2F0Q A;  1XNR L;  1SSO A;  1VQL A;  2SDF A;  4X3T A;  3L0O A;  1B9M A;  5GAD C;  1H9S B;  1XMQ L;  3GTK H;  4IFD J;  1L1O A;  4PZ6 A;  2FIN B;  4A3E G;  2QKI C;  1EYG A;  5I2Y A;  5BR8 Q;  4JI0 Q;  1GUN A;  3Q23 A;  2WAQ B;  3HG9 A;  2IL8 A;  1XPO A;  4C3I G;  3TS2 A;  2DN8 A;  4L5S A;  5E7N A;  4ZCK A;  4BA1 I;  4DV6 L;  4DR3 L;  2PQA B;  1SNO A;  3TQY A;  1PDQ A;  3QG1 A;  3IFT A;  2NZO A;  3NBI A;  1GHJ A;  3EBE A;  4ZUJ A;  1DJR D;  1I4H A;  4H44 C;  4IUR A;  4LK1 C;  4DK3 C;  2UUB L;  4RCN A;  1SMY C;  2XRQ D;  1QUQ B;  2RSO A;  1QG7 A;  4DUZ L;  2WIN B;  5C0X I;  2EOT A;  1SEB D;  4YWL A;  1FJG L;  1M1K C;  5JVG 3;  3DWP A;  1KLU D;  4PQX A;  3NTI A;  2KVM A;  3MFG A;  2EQS A;  3M4P A;  5JOB A;  1K73 C;  1D5X C;  1IL2 A;  2K01 A;  2MPM A;  1U4P A;  2LKV A;  1VQ8 A;  1CQV A;  1QNU A;  2O4X A;  3GTQ H;  1K9M C;  2AMC B;  3ND8 A;  3K5N A;  4A3J B;  3STB D;  5BN4 A;  2KOL A;  4IUV A;  4BWG B;  1LT5 D;  4Y7N H;  1K83 B;  2HQL A;  2RDG A;  1STA A;  1NR2 A;  4EQN A;  2EJF C;  1EQQ A;  4IN3 A;  2A19 A;  3S1R H;  4DR1 L;  2E2J B;  3A74 A;  3V96 A;  1RKN A;  2D0O A;  4FO2 A;  3GTM H;  4BY7 B;  3ER0 A;  4N9P A;  1HPC A;  1JE4 A;  4PV1 C;  1WTP A;  5CR3 A;  4B3M Q;  1Q3L A;  4PMC A;  2QGQ A;  3OSO A;  2A6E D;  2HDM A;  4JI4 L;  3RD4 A;  4I7Z C;  1PRT B;  3J7Z C;  3CKI B;  3MXG A;  1E2W A;  3R2T A;  1EFW A;  1UE6 A;  4DV4 L;  4O0A A;  4FVM A;  3GTO H;  4B3R L;  2VUM G;  4HJ8 A;  1HFG A;  3DHQ A;  1EU3 A;  1RF2 D;  4X64 Q;  1J5E Q;  1NNX A;  1OXT A;  3CCQ A;  1D5Z C;  4DV2 L;  4A3K B;  3RLN A;  3E3X A;  3F2C A;  1A2T A;  3H6M A;  4B3T L;  4JV5 L;  4XIG S;  1HRJ A;  4JI8 L;  5KNC A;  1SYE A;  3WDN A;  3C1F A;  5G3L D;  3TRE A;  1MD2 D;  2D5D A;  2WB1 E;  4UP7 A;  2K52 A;  4CBV A;  3J80 i;  2G9H D;  3D6W A;  2F4V Q;  2LXJ A;  1O80 A;  5JPM C;  5H1S E;  2Q2T A;  1HTL D;  2OQK A;  4LFB Q;  1M4V A;  2FJ2 A;  2O5J C;  2VQF Q;  3PCO B;  3A8K E;  4P75 A;  2BA0 A;  4JBJ A;  3T4A C;  2ZTE A;  3GTJ H;  1SBB B;  4H02 A;  1OXU A;  4JI8 Q;  5JJZ A;  3C46 A;  1Z9F A;  3HOW G;  1PHJ A;  2E75 C;  4DXG A;  4A3G G;  4WJ3 M;  3D8G A;  4DA2 A;  1GUS A;  4EQ5 A;  1K8O A;  3T56 B;  1WVL A;  3F2D A;  4P71 A;  4J8Q A;  1F2L A;  5JJL A;  4QL5 A;  2R6G A;  3J81 j;  1F77 A;  2MP1 A;  2DNC A;  1UUP A;  3H15 A;  4B9W A;  2EIF A;  1SNP A;  4CDC C;  4LF5 L;  4PMW A;  3FEW X;  1JQY D;  1X6O A;  4JYA Q;  3FP9 A;  4KV6 A;  3CD6 A;  4G57 A;  2FFK B;  2Q2H A;  1K83 H;  3NTH A;  1Q8K A;  2Y0S B;  4JI2 L;  1LO5 D;  4JK1 C;  3A5U A;  1EIH A;  4NXM L;  2JA8 B;  1V1O A;  4BY1 B;  3BDC A;  1L1O C;  4EQO A;  3LWU A;  4A4I A;  2EYJ A;  3W1G A;  2MQH A;  1Y1V G;  3M85 A;  3UDG A;  4A76 A;  2K32 A;  1MSG A;  2B2W A;  1NAP A;  5ELB A;  1Y14 B;  4K0K L;  1Y8O B;  3I91 A;  3QR8 A;  3NBH A;  1EU4 A;  2B2Y A;  4RKB A;  3CME A;  1I94 L;  1HTP A;  3A7A B;  5IT9 c;  2XVS A;  5IGB A;  4GNX C;  1Y69 U;  2ALY B;  5GAH C;  4IUP A;  3HOW H;  2A73 B;  2R3Z A;  5C4X H;  4DUZ Q;  4FF1 A;  1A15 A;  1I94 Q;  3IKJ A;  4B3M L;  1SDF A;  1D1K A;  1OXX K;  4LF8 Q;  3J7A V;  2K03 A;  3FKI H;  1J8I A;  3DWA A;  5FLM H;  2LY7 A;  5M3F G;  3S17 B;  4DR4 L;  3H3V H;  1BVS A;  1VQI A;  2CVR A;  2XRS D;  1G91 A;  5KGU A;  3NEL A;  3AMU A;  3VR6 A;  4XQQ A;  4N8X 1;  5JAV A;  5LMN L;  1N9W A;  2R7Z G;  3K80 C;  3J81 i;  3HOY H;  3KDF A;  1EOT A;  1WTQ A;  1W6K A;  1PH9 A;  1E1T A;  3BYY B;  1SYF A;  3WOF A;  1F2M A;  2QDB A;  4DR2 Q;  4LF7 L;  1PTO C;  1ESF A;  5M3M G;  3J80 E;  1HZA A;  4G7H C;  3OW7 A;  1EY7 A;  3NUC A;  5IGF A;  2IX1 A;  2JA5 B;  3PO3 B;  4OIJ A;  1U4M A;  5EKL A;  4QGU A;  1TWH B;  2G5D A;  4DK0 A;  1TII D;  2V1C C;  3EVQ A;  1XYI A;  4HIO A;  5IT9 L;  1KAB A;  1BCP C;  3DWQ A;  1QB5 D;  1CSP A;  1WI5 A;  1DOL A;  1DZ1 A;  2DGY A;  1Q1B A;  1C0A A;  1ENC A;  4V0B A;  1AZP A;  4B3R Q;  3PO2 H;  3IAY A;  4K8J A;  1I6V C;  3LNN A;  5C4Z A;  1LLR D;  2BE5 D;  2ZJQ A;  3CC7 A;  4G4K A;  3VYT A;  3K6O A;  5IOC A;  2M2L A;  4X65 Q;  3K5O A;  4DAY B;  3NBH B;  1IYV A;  4RKL A;  2K50 A;  3TRZ A;  1BNZ A;  2RQX A;  1FD7 D;  2Z6K A;  4OEL B;  3OHX C;  1B70 B;  2UUC L;  1Y1V H;  4R4T A;  2EYO A;  1MIU A;  2B2U A;  1ZXT A;  3JAM L;  1V1P B;  1ASY A;  3K57 A;  1TWC H;  2QW7 A;  4RGT A;  3HOV G;  4YWM A;  4LFB L;  3M4O B;  4KLK A;  3CRK C;  1SMY D;  2QCP X;  3R3O A;  1H9J A;  3S24 A;  2KEC A;  5IYC H;  1B4O A;  2AQ2 B;  1YJN A;  2EY5 A;  3CAM A;  4DXF A;  1XPU A;  3S2H H;  4X64 L;  1KRS A;  2N49 A;  2E2I B;  1ZYR D;  1B1Z A;  3CCV A;  4CDF C;  3G6E A;  1PVO A;  1U5K A;  5IP7 G;  3S1M H;  3KLW A;  2DNE A;  1HUM A;  4C1N I;  2XWJ B;  4CKE A;  4A3F G;  2F0N A;  1A3T A;  1HZ9 A;  2NTT A;  1LAC A;  3TEH B;  1WD1 A;  4LF6 L;  2YYZ A;  5JEA J;  4IAL A;  4DR6 L;  1U4R A;  3FRP B;  1AEX A;  2ZXP A;  2J7Z A;  3A8I E;  5I9P A;  1CKM A;  2CQO A;  1XWE A;  3UDI A;  3D6C A;  3DLL A;  1JOK A;  1S72 A;  3D3R A;  1DD2 A;  3SK5 A;  1XJV A;  2R7Z H;  4QQB X;  3PIO 3;  2WB1 G;  3ONA B;  4B3S Q;  1TS2 A;  4ME5 A;  1PYS B;  3RN5 A;  3GTP B;  2NYZ D;  3LWE A;  1TQO A;  1BO0 A;  1KNA A;  2B2Y C;  3PUV A;  1TKW B;  2F0F A;  4BBR G;  2MFI A;  2VZA A;  1STE A;  4GN5 A;  1X9N A;  3GTL H;  4DR6 Q;  5ELN A;  4CGY B;  1NCV A;  3NXW A;  1MBY A;  3TP6 A;  4GKJ L;  3N6R A;  1LT3 D;  4CJ2 C;  2K5N A;  4BBR B;  1S5E D;  1IYJ B;  1EIF A;  2BOS A;  1NJI C;  1QE6 A;  2A1A A;  5COY A;  4OX9 Q;  2E5L Q;  4XYQ A;  3S1Q H;  1E2Z A;  4OO1 G;  2N8N A;  1GXD C;  3G71 A;  1H9R A;  1FNV A;  3TN2 A;  2ZJP A;  1J5E L;  4R4O A;  4NMZ A;  1YEZ A;  4HN7 A;  4LMQ D;  1KC8 C;  2R7Z B;  2LMC B;  4YIJ A;  3VYS A;  2PNH A;  4U68 A;  3P75 A;  1ICW A;  1ROD A;  2B63 B;  5IWA Q;  1BXT A;  1L1O B;  1JC7 A;  1EYD A;  4RCO A;  1CUK A;  3CMA A;  1CA6 A;  2Q2I A;  1BBX C;  1EQR A;  3HKZ B;  1WTV A;  1VQO A;  1ICF B;  3CC4 A;  4P72 A;  5CV8 A;  1G29 1;  1PH4 A;  2AUJ D;  3G4S A;  4IPH A;  4A3C G;  1SE2 A;  5M3F B;  3AU7 A;  4DV5 Q;  4BBR H;  3HKZ G;  1IHZ A;  3HOU H;  2ZTC A;  1T5X D;  2NVX B;  3BVM A;  3QWN A;  1YVC A;  3J81 c;  4Y7N B;  4C2M H;  2Y0S E;  1PYB A;  2PCF B;  1J9O A;  2VUM H;  4XT3 B;  5CBA E;  3Q0A A;  2K6A A;  3T16 A;  3VR2 A;  2A8V A;  1U0L A;  4CJ1 B;  2KCM A;  4JW0 A;  1NUC A;  5LMU L;  2F3W A;  1KD1 C;  5JVH 3;  2NVQ H;  2EXZ A;  1E0B A;  3L7Z C;  2ZM6 Q;  2FMC A;  1XNQ Q;  1G2S A;  3T1Y Q;  4K14 A;  3VYR A;  5LHY 1;  1PZK D;  3IRB A;  5EPK A;  3HZX A;  2ICI A;  3CCS A;  2JA5 G;  3GTO B;  3PO3 G;  2R92 B;  5C44 H;  5C3E G;  4JI3 Q;  3I2Z A;  1HNZ Q;  3X3M A;  1VQN A;  1G6P A;  3E0J A;  1TWG H;  1KQS A;  3WWV A;  1S5C D;  1PTO H;  4A3K H;  3J81 L;  5FJ8 G;  2NB0 A;  1WYD A;  2AQ3 B;  1K0R A;  1II3 A;  2BDO A;  2PO4 A;  1JJC B;  4YHH Q;  1JWM D;  3TP8 A;  2PQE A;  1VQE A;  1QUQ A;  1WTH A;  1UEB A;  2OTJ A;  3GV6 A;  1K28 A;  4C2M B;  3T13 A;  4ZLT F;  4LFC L;  3KK7 A;  1CI3 M;  5HUR A;  1IBL L;  2KHS A;  4DUY L;  1JT8 A;  4LNQ A;  4A3G H;  2CH4 A;  1IBK Q;  4B9X A;  1TWA H;  1K8M A;  1FR3 A;  3X3N A;  2B2U C;  4NXN L;  2UUC Q;  2MJ8 A;  1SNC A;  3OWF A;  4MZ9 A;  1IBK L;  1X3F A;  3QIA A;  1AZQ A;  2PW7 A;  4UY8 C;  4QJF A;  5JJI A;  1KRT A;  3BJU A;  1AP0 A;  3K7U C;  2CWP A;  1R9T B;  5CV6 A;  3PUW A;  2L15 A;  2XGT A;  3AFQ A;  1GUO A;  1EYC A;  1EY6 A;  2WAQ E;  2Z1C A;  5EGT A;  4HCE A;  4JI2 Q;  2GVA A;  3J81 E;  2QA4 A;  4NB3 A;  3SDZ A;  3Q6S A;  3U9O A;  2R93 B;  1LM0 A;  2FHT A;  1Y1W H;  4UDU C;  4F7X A;  3FHW A;  5CV4 A;  5ELO A;  2EYL A;  2JA7 B;  2E2J H;  4L5R C;  2KCN A;  2B29 A;  2L5T A;  4BY7 H;  4I7A A;  2I46 A;  1F9P A;  4A93 H;  5ELC A;  3CPF A;  5D3I B;  4UPA A;  4ZYS A;  4BA2 I;  2IWH A;  3RUZ A;  1BBW A;  3EFX D;  4UHV A;  1HA6 A;  5CV7 A;  3VYU A;  1VF7 A;  2IHF A;  1Q86 C;  5LMN Q;  4K5X A;  3MXN B;  4A3J G;  1EY4 A;  2EE1 A;  1SJH D;  3A54 A;  5IE8 A;  3K59 A;  4OWT B;  5KEE A;  3UDX A;  4XDX A;  2UXC L;  3BU2 A;  4RG1 A;  1I3Q H;  2Q8R E;  2CWA A;  3SVM A;  5LL6 S;  5JPN C;  3I55 A;  4DV7 L;  1CM9 A;  1VCI A;  2D9U A;  4KHP L;  1SXT A;  3FPU B;  3D4W A;  3GTQ B;  2EJM A;  4NP5 A;  2B63 G;  5J1Z A;  3CU7 A;  4DR1 Q;  2RCF A;  4S3S A;  3RMH A;  1SRO A;  3M4Y A;  2KBN A;  2WFW A;  3TZD A;  4AIM A;  3I4M H;  1S4Z A;  3E6Z X;  3EA6 A;  1PZI D;  1HUN A;  3IL8 A;  1CKN B;  1FVI A;  1EZ6 A;  1X54 A;  4DV2 Q;  1D7Q A;  1K8G A;  4K5V A;  1CZG A;  1JWU D;  1LTT D;  1M8A A;  3CCE A;  3MVV A;  1YZ6 A;  5M5X H;  5A2Q L;  4Q0F A;  2K04 A;  4JBK A;  1OTC A;  4GOP B;  2E5L L;  2H1E A;  2PZT A;  2Q8I B;  2BH2 A;  4R1J A;  4MIU A;  4IFD I;  2HD3 A;  4FXK C;  1HHV A;  2JQO A;  3E0E A;  1E22 A;  4JI0 L;  3UDF A;  1KDA A;  3KLS A;  2E2I H;  2JA5 H;  1KIX A;  4KJO A;  3PSI A;  1QJO A;  3BYT B;  3PO2 G;  1H9M A;  3M9B A;  4OHJ A;  1TWF H;  3R93 A;  3I4M B;  2CW0 D;  3SK4 A;  3ZJY C;  4DU9 A;  1SRU A;  3S1M B;  2IT1 A;  4L5Q A;  3T1H L;  5GAG C;  3RR5 A;  2PYK A;  4HSP A;  4XYO A;  3D4R A;  3I4M G;  1MI2 A;  2P5Z X;  4BY1 H;  1ZEQ X;  1VQK A;  4KKT A;  4DV5 L;  2JEB I;  4C3H B;  4JG2 A;  1PMR A;  2X69 A;  4X66 L;  3DM1 A;  2HHH L;  1XMQ Q;  1PLF A;  3R2I A;  3H0G G;  4HCS A;  5IOD A;  3A5Z B;  1I4Q A;  4A3L H;  3B6Y A;  5IYB H;  1HZB A;  2EJG C;  3PMF A;  3EN2 A;  1WTX A;  1AE2 A;  2K7V A;  1W6J A;  1GVP A;  2R92 G;  1HFN A;  1UE1 A;  4L63 B;  2UXD L;  1JB3 A;  3HOX H;  3PF4 A;  4YCU A;  4GOP A;  3GD7 A;  3CCL A;  2JA8 G;  3GTL B;  5AJ3 L;  4B3S L;  3DMU A;  4X66 Q;  4K2K A;  4R9W A;  1N34 Q;  2K1B A;  3SHL A;  2M9V A;  4LF9 L;  2PI2 A;  2PZW A;  2MGS A;  3T53 B;  1KTK A;  1MKH A;  4NXM Q;  1FL0 A;  4N8F A;  3RZD B;  1L0Y B;  4A3M B;  1Z7T A;  1K8A C;  4OEM B;  5AFW A;  4JI7 L;  2OT2 A;  5D3D A;  4DV1 L;  5EPL A;  3I90 A;  3TZU A;  1EOV A;  1LTB D;  2JA8 H;  4LUO A;  4A3M G;  3ND9 A;  2NN6 H;  5COR A;  4FP5 D;  2RHQ B;  2E8G A;  4L5T A;  2I0Q A;  4IOA A; 
#chains in the Genus database with same CATH homology
 1E1O A;  4YCV A;  3HOV G;  4JI6 L;  1S3O A;  1X56 A;  2UXB L;  2GN5 A;  4YWK A;  4YWM A;  1X65 A;  4LFB L;  4KLK A;  1J6Q A;  4LW1 A;  4JOI C;  4LFA Q;  3KF6 A;  3U4V A;  4EX5 A;  1PH2 A;  1TWH H;  3S24 A;  1NY4 A;  1E7Z A;  4UP9 A;  5IYC H;  1A62 A;  1VQ5 A;  1YJN A;  1IBL Q;  1I5F A;  3S1N H;  3M7N A;  1N36 Q;  1PH6 A;  3CAM A;  3L2P A;  2K14 A;  4OX9 L;  1XPU A;  2I5L X;  2XTI A;  3S2H H;  4X64 L;  3DM3 A;  1KRS A;  2N49 A;  1Q81 C;  5JEA G;  3CP0 A;  5IWA L;  3KDF B;  4BBS H;  2D0P A;  4TVA B;  3CCV A;  4HJA A;  1SLJ A;  3G6E A;  2NVX H;  1AE3 A;  4IPG A;  4A3D G;  1PVO A;  3PIP A;  1U5K A;  5IP7 G;  4HID A;  1WOC A;  4IPC A;  4BXX G;  1EUJ A;  1TXY A;  3S1M H;  2LXK A;  3KLW A;  4GS3 A;  1NBW A;  4A3F H;  4JI6 Q;  3PUZ A;  1IZ6 A;  1VQM A;  2OWO A;  3S17 H;  1NTG A;  3HOY G;  4A3F G;  4OWX B;  1VQ4 A;  1UE5 A;  2PMZ E;  1HZ9 A;  2Q2U A;  3ERS X;  4OON A;  1LUZ A;  1HR0 W;  3PUX A;  4HJ7 A;  1XNQ L;  3TEH B;  4ALP A;  4DR2 L;  4B3T Q;  4LF6 L;  2YYZ A;  5JEA J;  3KFU A;  4DR6 L;  3U50 C;  1JMC A;  4L5T A;  4DKA C;  4A3I H;  3OYY A;  4LF8 L;  1C9O A;  2K4K A;  1Q12 A;  1CKM A;  4NPS A;  2CQO A;  2AHO B;  2UUB Q;  3BZK A;  4AYB G;  3UDI A;  2R92 H;  3DLL A;  1S72 A;  1XJV A;  1EWI A;  5M5Y H;  1B7Y B;  2R7Z H;  2KHJ A;  5GRO A;  4QQB X;  2YTX A;  1H95 A;  2WB1 G;  3HOX G;  4B3S Q;  2ZJR A;  2VS1 A;  4YY3 L;  2OTL A;  4C3I H;  4DV6 Q;  4AYB E;  4DR3 Q;  4DR7 L;  4YHH L;  1KAW A;  4BXX H;  3HOU G;  4LF7 Q;  4JBM A;  1PYS B;  2VQE L;  3RN5 A;  3CCR A;  4JI4 Q;  4JI5 L;  5IYC G;  4R4C A;  1Y1W G;  3PUV A;  4QY7 A;  1WCM G;  1KHI A;  2MFI A;  4BBR G;  3VDY A;  4DV0 Q;  5C4X G;  2VZA A;  1HNW Q;  4X6A H;  2RCN A;  4GN5 A;  1X9N A;  3GTL H;  4DR6 Q;  3K7A H;  1FJG Q;  5ELN A;  1Q7Y C;  4JI5 Q;  2YV5 A;  4LFA L;  1JB7 A;  2VW9 A;  5IY0 A;  5LMU Q;  4GNX B;  4JI1 L;  2MNA A;  2F52 A;  2ZM6 L;  1QZH A;  3I4N H;  1YNX A;  4GKJ L;  1UE7 A;  1OXS C;  1MJC A;  2K5N A;  4GN3 B;  3AEV A;  1GO3 E;  1N8R C;  1IYJ B;  1EIF A;  1NJI C;  2A1A A;  4OX9 Q;  3D0F A;  3RZD H;  2E5L Q;  3S15 H;  1CKN A;  3I56 A;  4JYA L;  2UUA Q;  3S1Q H;  1CSQ A;  1X3G A;  2OCE A;  1XMO L;  4OO1 G;  2N8N A;  1T9H A;  3G71 A;  3I7F A;  2ZJP A;  4IJH A;  3CCU A;  1PA6 A;  1O7I A;  2AKW B;  1N36 L;  1J5E L;  5GQO A;  4R4O A;  2GVB A;  3F2B A;  1YEZ A;  3CQZ H;  1KC8 C;  3U4Z A;  4GLV B;  4A3K G;  1JJ2 A;  1HJP A;  4ME3 A;  5C44 G;  1Q1E A;  3W1B A;  3PF5 A;  1QVG A;  1ASZ A;  2VQF L;  2EXD A;  1XNR L;  2PNH A;  4QIW E;  4A75 A;  1VQL A;  3CCJ A;  1HNX Q;  1YHB A;  2VY3 A;  5IWA Q;  3GTP H;  1BKB A;  1VQD A;  1L1O B;  4GNX A;  3L0O A;  5GAD C;  3GTK H;  4A93 G;  1XMQ L;  4IFD J;  1CUK A;  3CMA A;  2Q2I A;  1EQR A;  2NN6 I;  1L1O A;  4PZ6 A;  1D8L A;  1A8V A;  1NMF A;  4OO1 I;  2HIX A;  4A3E G;  1VQO A;  1HNX L;  1EYG A;  3CC4 A;  5BR8 Q;  3OTO Q;  4UP8 A;  4P72 A;  2HT1 A;  4A3B H;  3ICE A;  3KJO A;  4JI0 Q;  1G29 1;  2I5H A;  3K0X A;  1PH4 A;  3D31 A;  1YBY A;  3KF6 B;  3G4S A;  2JE6 I;  4IPH A;  4A3C G;  1XPO A;  2WP8 J;  3TS2 A;  4DV5 Q;  1WCM H;  3HKZ G;  4BBR H;  4AQY L;  3HOU H;  2ZTC A;  4DNI A;  4L5S A;  2JA6 H;  5E7N A;  1YVC A;  4BA1 I;  5C3E H;  3J81 c;  4DV6 L;  2PQA B;  3TQY A;  4DR3 L;  4IJL A;  5LMN W;  1SN8 A;  2NZO A;  2Y0S E;  1NE3 A;  1GKH A;  2N3S A;  4J15 A;  1HH2 P;  4JCV E;  4C2M H;  4GLX A;  1PH8 A;  2JJQ A;  1MJE A;  3EBE A;  1PYB A;  3G48 A;  5IYD G;  2VUM H;  5AJ3 Q;  4DK3 C;  1RL2 A;  2UUB L;  2CKZ B;  1N34 L;  2R7F A;  3CXC A;  3CCM A;  1HR0 L;  1QUQ B;  4A3D H;  4JV5 Q;  2A8V A;  4DUZ L;  1U0L A;  5C0X I;  1FJG L;  4YWL A;  1A0I A;  1I50 H;  4JBW A;  4YCW A;  4C3J H;  1M1K C;  2KCM A;  3JC6 6;  5BR8 L;  1WJJ A;  3OTO L;  5LMU L;  1KD1 C;  3RZO H;  4A3B G;  2NVQ H;  4JI3 L;  2Z6K C;  1YHQ A;  3L7Z C;  2ZM6 Q;  2EQS A;  2H5X A;  3M4P A;  3A0J A;  3KJP A;  3T1Y Q;  1HR0 Q;  1XNQ Q;  2B63 H;  4DR7 Q;  3PV0 A;  2YTY A;  3IRB A;  1BBU A;  2C35 B;  1K73 C;  1IL2 A;  4A3E H;  2JA6 G;  4GKK Q;  3CCS A;  4TQU S;  2JA5 G;  3PO3 G;  2F3I A;  1Z47 A;  5C3E G;  5C44 H;  4JI3 Q;  2VL6 A;  3I2Z A;  1N33 L;  1HNZ Q;  1YI2 A;  1VQ8 A;  4LWC A;  5FLX c;  1VQN A;  1R9T H;  1G6P A;  1XMO Q;  1TWG H;  1KQS A;  2JK8 A;  3GDE A;  1K9M C;  3GTQ H;  3WWV A;  2MO0 A;  5HY6 A;  4A3K H;  5FJ8 G;  2AMC B;  1IXR A;  1WYD A;  3CF5 A;  2NZH A;  4YY3 Q;  1K0R A;  3STB D;  4DV4 Q;  1VQ6 A;  5M3F H;  1N32 Q;  5GAE C;  3AQQ A;  3CPW A;  1JJC B;  4YHH Q;  3RLO A;  1VQA A;  2WAQ G;  1VQE A;  1QUQ A;  1VQC A;  4LF4 L;  1UEB A;  3STB C;  5IP9 H;  2OTJ A;  4Y7N H;  2CFM A;  2HQL A;  2VNU D;  4APV A;  4LFC L;  2UUA L;  3F1Z A;  2ZTD A;  2A19 A;  3S1R H;  4DR1 L;  4DUY L;  1EQQ A;  1IBL L;  4LUZ A;  3A74 A;  1QVF A;  1G51 A;  2D0O A;  3GTM H;  3NEN A;  4NXN Q;  1PV4 A;  3NEM A;  4HJ9 A;  4LNQ A;  2ASB A;  4A3G H;  1JT8 A;  3ER0 A;  1RIP A;  1IBK Q;  3GO5 A;  3S2D H;  4JI1 Q;  4B3M Q;  4GOP C;  3H0G H;  1P16 A;  1TWA H;  2QGQ A;  2YU9 H;  1XTD A;  4DAM A;  2VQE Q;  3CC2 A;  4JI4 L;  3J7Z C;  4NXN L;  5FJ8 H;  1XNR Q;  3ULJ A;  5IYB G;  5K36 G;  4KHP Q;  3AYH B;  4X62 L;  1EFW A;  4MZ9 A;  1IBK L;  1UE6 A;  1X3F A;  4DV4 L;  1N32 L;  1VQH A;  4O0A A;  3Q8D A;  3I4O A;  4UY8 C;  2KEN A;  4HIK A;  2PQA A;  4QJF A;  3GTO H;  3JAM c;  1X55 A;  2VUM G;  3MEF A;  1KRT A;  3BJU A;  1V9P A;  3PUY A;  4HJ8 A;  5JJI A;  3K7U C;  5M5W H;  1E3P A;  1B8A A;  2CWP A;  4KI0 A;  1J5E Q;  4X64 Q;  4OWW B;  1OXT A;  2L15 A;  3PUW A;  1L0W A;  3SGI A;  3CCQ A;  1IBM L;  2XGT A;  3AFQ A;  1Q46 A;  2RHS B;  2WAQ E;  4DV2 L;  4LFC Q;  3RLN A;  3F2C A;  2ES2 A;  2NVY H;  4IO9 A;  3KOJ A;  1QVC A;  4B3T L;  2N78 A;  4XIG S;  4JV5 L;  4JI2 Q;  4JI8 L;  2GVA A;  2QA4 A;  3U58 A;  4LUV A;  4NB3 A;  3T1H Q;  4DR4 Q;  3TRE A;  1JJG A;  2MO1 A;  2ATW A;  1LM0 A;  2WB1 E;  1Y1W H;  1UWV A;  1PFS A;  1QZG A;  1W3S A;  3FHW A;  3ULP A;  4UP7 A;  2K52 A;  4IPD A;  5ELO A;  1LTL A;  2AWN A;  4X62 Q;  5DLQ E;  3J80 i;  2E2J H;  2RF4 A;  2LXJ A;  4L5R C;  2F4V Q;  5H1S E;  2Q2T A;  4GKK L;  2B29 A;  1PH7 A;  1YHA A;  4BY7 H;  1V1Q A;  3M3Y H;  4A93 H;  2OQK A;  4LFB Q;  3CPF A;  2VQF Q;  1HNZ L;  3PCO B;  4UPA A;  4DK6 C;  3PIO A;  4PZ7 A;  3I4N G;  4BA2 I;  3UE0 A;  1GD7 A;  1BBW A;  4P75 A;  3J80 c;  2BA0 A;  4JBJ A;  2ZTE A;  3GTJ H;  4JOI A;  4H02 A;  4A3C H;  1HNW L;  1OXU A;  3M4Q A;  4JI8 Q;  2IHF A;  4JC0 A;  4XTC S;  1Q86 C;  5LMN Q;  3H3V I;  4LF4 Q;  1Z9F A;  3MXN B;  4A3J G;  3HOW G;  2UXC Q;  1PHJ A;  4A3G G;  2HHH Q;  4GKJ Q;  4WJ3 M;  2K5V A;  3PO3 H;  4DR5 L;  5IE8 A;  4EQ5 A;  4OWT B;  1VQB A;  3HOZ G;  5IYD H;  3UDX A;  4AQY Q;  3HFZ B;  1E24 A;  2UXC L;  3BU2 A;  4RG1 A;  3F2D A;  1I3Q H;  3OW2 A;  3E9I A;  2CWA A;  1EIY B;  3RNU A;  4P71 A;  5JJL A;  1JE5 A;  4QL5 A;  3I55 A;  1LYL A;  2R6G A;  2R93 H;  4DV7 L;  4P73 A;  3S14 H;  1YJ9 A;  2JA7 G;  3J81 j;  3JAM i;  1AH9 A;  1VCI A;  5FLM G;  4KHP L;  4POF A;  2B63 G;  4WJ4 A;  1N33 Q;  3H15 A;  4DR1 Q;  1NMG A;  2EIF A;  2E2H H;  3RN2 A;  4A3J H;  4LF5 L;  3J7A 5;  1SRO A;  4PMW A;  4JI7 Q;  2KBN A;  2WFW A;  4AIM A;  4A3M H;  1PH1 A;  3I4M H;  1X6O A;  2OQ0 A;  4PZ8 A;  4JYA Q;  3FP9 A;  5EAY A;  3CD6 A;  1CKN B;  1FVI A;  1X54 A;  4DV2 Q;  2Q2H A;  2K75 A;  3HKS A;  2PI2 E;  1K83 H;  3ULL A;  1K8G A;  1D7Q A;  1Q8K A;  2JA9 A;  5C4J H;  1PH3 A;  4JI2 L;  3A5U A;  3CCE A;  4NXM L;  3W5O A;  5M3M H;  1FGU A;  2KHI A;  4A3I G;  1XPR A;  1YZ6 A;  2K5H A;  4DV3 L;  5M5X H;  1L1O C;  1Q82 C;  4DUY Q;  2ID0 A;  2UXB Q;  4A4I A;  4O2D A;  3BZC A;  1YIT A;  3W1G A;  1VQ7 A;  4BY7 G;  4AH6 A;  3FKI G;  1YJW A;  1GM5 A;  5IP9 G;  2MQH A;  1Y1V G;  4B3R L;  4JBK A;  3M85 A;  1OTC A;  2AWO A;  4GOP B;  4A76 A;  3UDG A;  2E5L L;  2R93 G;  1IBM Q;  3K81 C;  2I5M X;  2BH2 A;  4R1J A;  4DV3 Q;  2NN6 G;  1Y14 B;  4BBS G;  4K0K L;  3KYH C;  3GTG H;  4IFD I;  3CME A;  1VQP A;  1M90 C;  2IY5 B;  4KHZ A;  1I94 L;  4Y52 H;  3F8T A;  1K3R A;  2JQO A;  1C7Y A;  3E0E A;  5IT9 c;  1E22 A;  4P74 A;  4GNX C;  4JI0 L;  2ALY B;  3UDF A;  5GAH C;  3HOZ H;  4FDB A;  2E2I H;  3HOW H;  2JA5 H;  1KIX A;  4LF6 Q;  5C4X H;  4DUZ Q;  2R7D A;  1CKO A;  4R4I A;  4DV1 Q;  3PSI A;  1I94 Q;  2QEX A;  4B3M L;  3KF8 B;  1VQJ A;  3PO2 G;  3HKZ E;  3M9B A;  1OXX K;  1TWF H;  4LF8 Q;  1P8L A;  3ZJY C;  4A3L G;  3FKI H;  3T1Y L;  1SRU A;  2KCT A;  5FLM H;  2Y0S G;  2IT1 A;  4L5Q A;  5M3F G;  3T1H L;  2BA1 A;  4DR4 L;  5GAG C;  3H3V H;  1BVS A;  1VQI A;  3RR5 A;  1VQ9 A;  1L2F A;  1PH5 A;  2JA7 H;  3NEL A;  1SE8 A;  3UE1 A;  5C0X J;  3I4M G;  4BY1 H;  5LMN L;  1N9W A;  1VQK A;  4DV5 L;  2D62 A;  2R7Z G;  3K80 C;  5J3B A;  2JEB I;  3J81 i;  3HOY H;  3E9H A;  4JG2 A;  4MTN A;  3KDF A;  4X66 L;  2HHH L;  1XMQ Q;  5HGQ A;  2YTV A;  4DR5 Q;  1SMX A;  1PH9 A;  2BH8 A;  4LF9 Q;  1E1T A;  3H0G G;  1S40 A;  2UU9 Q;  3A5Z B;  4A3L H;  3B6Y A;  4POG A;  2LSS A;  1HZB A;  5IYB H;  4DR2 Q;  2UXD Q;  3CW2 C;  3EN2 A;  4LF7 L;  5M3M G;  1AE2 A;  1HZA A;  2F4V L;  2UU9 L;  4GN4 B;  5C0X G;  2IX1 A;  2JEA I;  1GVP A;  1DGS A;  2R92 G;  1UE1 A;  2HIV A;  4QGU A;  3M4O H;  1I6H H;  5IP7 H;  4DV0 L;  2UUC Q;  1W2B A;  2V1C C;  2UXD L;  4BY1 G;  4HIO A;  4PG3 A;  3HOX H;  1VS0 A;  1KL9 A;  4LF5 Q;  3PF4 A;  4YCU A;  2B3G A;  4GOP A;  3GD7 A;  3CCL A;  2JA8 G;  1CSP A;  2DUD A;  5AJ3 L;  3TS0 A;  2Z0S A;  1WI5 A;  4RMF A;  3LGJ A;  2FXQ A;  4X66 Q;  4B3S L;  1KXL A;  1N34 Q;  2DGY A;  1Q1B A;  1C0A A;  1VQG A;  1SFO H;  2IX0 A;  1HZC A;  1VQF A;  4X65 L;  4IOC A;  4LF9 L;  2PI2 A;  4B3R Q;  4DV7 Q;  3PO2 H;  4MNO A;  1MKH A;  4NXM Q;  4HIM A;  4IFD G;  3K8A A;  2IHE A;  1FL0 A;  3CC7 A;  2ZJQ A;  1OXV A;  4C3H H;  4X65 Q;  4DAY B;  5JJK A;  3NBH B;  3PGZ A;  1K8A C;  1SR3 A;  4JI7 L;  2K50 A;  1YIJ A;  1WFQ A;  3TRZ A;  2Z6K A;  4DV1 L;  4DPG A;  2NVT H;  1B70 B;  2UUC L;  3RLF A;  1Y1V H;  2CCZ A;  4K0K Q;  4R4T A;  3AFP A;  4R4Q A;  1MIU A;  1A63 A;  1EOV A;  2JA8 H;  4LUO A;  3EIV A;  4A3M G;  1V43 A;  4GLA C;  1ASY A;  3HOV H;  3S16 H;  2RHQ B;  2E8G A;  4HJ5 A;  1X3E A;  4OXP A;  1TWC H;  2I0Q A;  4IOA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...