1SLJA

Solution structure of the s1 domain of rnase e from e. coli
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
96
structure length
96
Chain Sequence
GSHMLEQKKANIYKGKITRIEPSLEAAFVDYGAERHGFLPLKEIAREYFPANYSAHGRPNIKDVLREGQEVIVQIDKEERGNKGAALTTFISLAGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease E
publication title Structural characterization of the RNase E S1 domain and identification of its oligonucleotide-binding and dimerization interfaces.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 15
structure length 96
sequence length 96
ec nomenclature ec 3.1.26.12: Ribonuclease E.
pdb deposition date 2004-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1sljA00
4LF6L 4LFAL 1Q1EA 4LF8L 4BY1H 2R92G 4UPAA 5FJ8H 1AE3A 1PYBA 4LWCA 2I0QA 1VQHA 1PVOA 4UP7A 1JJCB 1HR0L 5LMUQ 1O7IA 1CSQA 1XMOQ 4RMFA 1VQEA 4DNIA 1YBYA 3CAMA 3TREA 4P71A 1HZBA 5IP7H 4JI5Q 4LF5Q 3HOZH 4TVAB 1I94Q 1HNWL 1TWHH 3FP9A 4GN3B 4P72A 5IT9c 4HIDA 4LNQA 4UY8C 2WB1G 2F52A 3JAMi 2Q2IA 1Z47A 2PI2E 4OONA 2UUBQ 4C3HH 4GN5A 4DV4Q 4XTCS 2Y0SE 4BY1G 4JI6Q 5FJ8G 4DUYL 4Y7NH 3FHWA 5C44G 1NBWA 1DGSA 3M4QA 2ZJPA 4BY7H 3UDXA 4DV6L 4JI0Q 3D0FA 4KHPL 4DV5Q 1YJWA 1QVGA 1OXXK 1PA6A 2UUCQ 2I5LX 1HNXL 3M9BA 5IP9G 5FLMH 4A3JG 1M90C 2ZJQA 4DPGA 1K9MC 1L1OC 3UDGA 5IP7G 4JI7Q 3CQZH 1IL2A 1FGUA 1XPOA 1ASZA 4DR1L 2NZOA 1N34Q 3TRZA 1L1OA 4DUZL 4L5QA 4JV5Q 3MXNB 3H3VI 1BBUA 3ULJA 4IJHA 2OTJA 1TWGH 5IYDH 2R7FA 1BBWA 2HHHQ 1ASYA 3ERSX 4R4TA 4BY7G 2N78A 4DR5Q 3F8TA 4B3SL 4MZ9A 5C3EH 3KFUA 1PH2A 5K36G 1H95A 4B3RQ 4P74A 5AJ3Q 5FLMG 1K8AC 1D8LA 1I5FA 4NXMQ 4L5SA 5BR8Q 1LUZA 1NE3A 4OO1G 5LMNQ 2E5LQ 1JJGA 4KI0A 1IBLQ 5IYCG 4DV1Q 2GVAA 1PFSA 4GOPC 2YTXA 1U5KA 4A3CH 2NVYH 2ZTCA 5IYDG 4JI1L 3E9IA 3JC66 3J7ZC 4JI4Q 1VQPA 3RZDH 1JJ2A 4GOPA 4JCVE 1N36L 4IFDJ 3F1ZA 4B3ML 3T1YL 4QIWE 4DR7Q 3KYHC 1G51A 2OQKA 3RNUA 5M3MH 2RHQB 2FXQA 1HZ9A 3K0XA 1OXVA 2IX0A 1IBKQ 2N8NA 2NN6G 2UXCQ 4EX5A 1SRUA 2Q2TA 1JE5A 4KHZA 4A3GH 4OO1I 3NEMA 2F4VQ 1SROA 1X6OA 1TWCH 3G6EA 4R4QA 1E1TA 4J15A 4IPDA 3EBEA 2HT1A 3CMAA 4JI5L 4LF5L 4DR6Q 4YY3L 1I3QH 4JYAL 2BH8A 1I94L 1PH1A 2UU9Q 4YCVA 1VQ4A 2DGYA 3HKZG 4OWTB 3STBC 3HOUH 1WYDA 4QL5A 4DV4L 3K8AA 3CPWA 2XGTA 4A3GG 5EAYA 2GN5A 1OXSC 2EXDA 2NN6I 3HFZB 2OWOA 4JI0L 1B70B 2D62A 4X64Q 3H15A 1PH8A 3J7A5 1S3OA 4DV5L 1MKHA 2E2JH 4B3TQ 2VQFQ 1TWFH 4BA1I 3PUYA 2ZM6Q 1SLJA 3HOWH 4JI7L 2GVBA 4A3MG 2YYZA 3CD6A 3KDFA 3U4ZA 2KHIA 1W3SA 2MNAA 4YCWA 2R6GA 1N34L 1A8VA 3ZJYC 1NMGA 4P75A 4AIMA 1KD1C 1HNZQ 3HOUG 4JV5L 1GD7A 1YIJA 4A3FG 1CKNB 1QZGA 2XTIA 1Y1WH 2HHHL 1QVFA 2Q2HA 3J80i 4DR5L 1HR0W 1VS0A 1VQIA 1PH6A 2ATWA 4A93G 4B3RL 1U0LA 3JAMc 1PH5A 3KF6A 5AJ3L 3M3YH 4NXML 5C4XH 5BR8L 2JA6H 3HOWG 2KCMA 1KL9A 2E5LL 3SGIA 4DKAC 4X6AH 3AYHB 3F2DA 1IBLL 2VY3A 4DV1L 4HJ7A 2VW9A 1E1OA 3W5OA 2VL6A 1VQ7A 4HJAA 2Z0SA 3FKIH 3M85A 5JJLA 3RLOA 3J81i 2KBNA 5C4JH 3GDEA 4DV7Q 4DR7L 1X9NA 2RF4A 3EN2A 2IY5B 1GM5A 1CUKA 2V1CC 3TS0A 4A3KH 3I4NG 4OWXB 1K83H 4A75A 1QVCA 3A5ZB 4POFA 2JA6G 2K14A 1IBKL 1UE1A 2HIVA 3CXCA 3CMEA 5ELNA 4A3DH 1JT8A 2Y0SG 1A62A 4X65Q 3HOXH 3HOVG 4LW1A 2UXDQ 4C3JH 3GO5A 2IX1A 1VQFA 2CKZB 4LUVA 2CFMA 3STBD 1EIYB 4GN4B 2UUAQ 2A8VA 4YWLA 2F4VL 1L1OB 1OXUA 1UEBA 3WWVA 1VQNA 3S1QH 4JBWA 5GROA 2JQOA 4GNXC 1AH9A 1SR3A 3CCVA 4DR6L 2YTYA 4A3LH 4A76A 2VQEQ 1IBMQ 3RLNA 4DR4Q 2UU9L 2NVXH 2DUDA 1WCMH 3EIVA 4C2MH 4GNXA 4GLXA 4A3BH 3HOZG 5HY6A 3M4OH 4JI6L 2BH2A 4A3DG 3IRBA 1VQJA 3HOXG 1G6PA 4JBKA 4YCUA 4DAYB 5C0XI 1BVSA 4X64L 4O0AA 3GTPH 5GQOA 4JI2L 1XMQQ 1K3RA 1NY4A 4APVA 1VQ6A 1Q1BA 2WB1E 4YHHQ 2ZM6L 1W2BA 1SE8A 4GOPB 2AWOA 2JA9A 4DR3Q 1J6QA 4POGA 4EQ5A 2VNUD 1WCMG 1MJEA 5ELOA 1HNZL 5FLXc 4A3BG 2JEBI 2AMCB 1EYGA 3W1BA 1PV4A 1FJGQ 1YHAA 2KHJA 5IYBH 3OTOQ 1Q82C 1QUQA 1AE2A 3PUVA 4DV0L 2PMZE 1XNRL 1GKHA 4ME3A 1UE5A 1MJCA 4GS3A 3U4VA 1XPRA 1J5EQ 4OX9Q 3TS2A 1LTLA 4R4OA 1FVIA 2UXBQ 5C3EG 2K52A 3TEHB 3I55A 1P8LA 1X3FA 3A74A 2VS1A 2A1AA 3UE1A 1PYSB 1N9WA 3CCSA 1CKOA 4NB3A 4QQBX 3CCMA 4PZ7A 3CCLA 3KF8B 1X3EA 4PZ6A 3T1HQ 4WJ4A 1A63A 4A3IH 1CSPA 1VQ5A 1G291 4A3CG 1VQCA 2HQLA 3I4MH 5LMUL 4LF6Q 1VQAA 2QA4A 3S2DH 1FL0A 1WFQA 3H0GH 4AH6A 1XMOL 1Z9FA 1PHJA 3ICEA 3K7AH 3A5UA 3L2PA 4HJ5A 1EQQA 1KC8C 4WJ3M 5M3MG 3J80c 4X65L 4LF9Q 3G71A 4AQYQ 1SMXA 2UXDL 2K5HA 2CWAA 1LM0A 2IT1A 2B29A 3KDFB 3NELA 2YTVA 4PZ8A 2UUAL 2WAQE 2UUBL 2R93G 2EQSA 1YHBA 4A3IG 1HNWQ 3PUXA 1V1QA 4L5RC 3I4MG 5GADC 1X3GA 3DLLA 1KQSA 4X66Q 2UUCL 4K0KQ 2VQEL 1IBML 3GTGH 3I2ZA 1EIFA 2ID0A 3E9HA 1YEZA 1A0IA 5JEAG 4JBMA 4HJ8A 2MO0A 5GAHC 5E7NA 3CCUA 3J81c 3PGZA 2VUMH 1N32L 1WOCA 1T9HA 2JE6I 4IOAA 1PH7A 2NVTH 4GLVB 4DV2Q 1HNXQ 1E3PA 3I4OA 4LFCQ 2YU9H 2JEAI 3GD7A 3CCEA 3PO3H 2QGQA 1GO3E 1XMQL 4QY7A 4FDBA 3NENA 4YHHL 2RCNA 3S24A 3PV0A 1L0WA 1KAWA 3PIOA 3GTQH 3KLWA 2LSSA 4AYBE 4DR3L 2N3SA 1N32Q 2H5XA 3I56A 1KHIA 1Q12A 1KIXA 3K7UC 5LMNL 3S1RH 1VQLA 4LUZA 5M5WH 2CWPA 3F2BA 2B63H 1IZ6A 2B3GA 5IWAQ 1N8RC 4LFBQ 2PNHA 2K75A 1FJGL 3OTOL 3BJUA 1YJ9A 2A19A 3PO3G 4JI4L 4C3IH 1J5EL 1Y1WG 3G4SA 3ULPA 2PQAA 3MEFA 2UXBL 4LF4Q 4PG3A 2E8GA 4QJFA 1IYJB 1K8GA 2IHFA 4MTNA 3PF4A 3VDYA 1YVCA 5C4XG 1UE7A 3PF5A 1OXTA 4B3MQ 5C0XG 3AFQA 3W1GA 1VQKA 2B63G 3T1HL 3UDIA 4HJ9A 2UXCL 1X65A 4DV3Q 4GNXB 1VQMA 2E2HH 4LF7Q 3S17H 3S1MH 3PUWA 3CW2C 1CKNA 1S72A 1KRTA 1CKMA 3Q8DA 3UDFA 3PCOB 1B8AA 4QGUA 1PH4A 3FKIG 3S2HH 4DK6C 3CPFA 1UWVA 4H02A 5C0XJ 1S40A 5C44H 2PI2A 1XNQQ 3S14H 4BBSH 4PMWA 4R4CA 1X56A 4OXPA 4RG1A 2C35B 1HZAA 5IE8A 4A3KG 3A0JA 4AQYL 4LF9L 1E24A 5GAGC 2KCTA 3CCJA 3F2CA 5IP9H 4XIGS 4A3JH 3GTJH 1VQ8A 1VQ9A 3RN5A 5J3BA 3DM3A 1SFOH 4JYAQ 4YY3Q 1YI2A 1EWIA 3B6YA 4JI8Q 1C7YA 1EFWA 3KOJA 2ALYB 5H1SE 3HOYH 3AEVA 3GTOH 2R7ZH 4A4IA 4DR2Q 1NJIC 2I5MX 2ZTEA 1C9OA 2AHOB 4K0KL 4X66L 4B3TL 3TQYA 2VQFL 1QUQB 4BXXH 1Y1VH 1NMFA 4IPHA 4A3EH 4BBSG 1I6HH 1YNXA 4A3LG 1SN8A 3ER0A 1VQOA 4TQUS 4BBRH 4DV2L 1Q86C 4LFCL 5IY0A 3CP0A 3RN2A 4YWKA 2Z6KC 4JC0A 3S15H 3HKSA 3HOYG 4R4IA 1TXYA 2R7ZG 2AKWB 3K80C 3M4PA 5IYCH 1M1KC 4KLKA 1N33Q 2JA8H 4BXXG 4GKKQ 4JI3Q 1L2FA 2Z6KA 3OYYA 1Q7YC 2RHSB 4UP8A 2K50A 1OTCA 1YITA 3BZKA 3UE0A 3BU2A 4O2DA 3U58A 4UP9A 1XJVA 1VQDA 1Y1VG 2AWNA 2WP8J 3LGJA 4X62Q 3CCQA 4A3EG 3CC2A 3KJOA 4GKJQ 1RIPA 3AFPA 4NXNQ 1QZHA 5IWAL 1JMCA 1LYLA 4LFBL 2N49A 4BBRG 1K73C 1GVPA 1YHQA 4IFDG 4JOIC 3PO2H 3NBHB 1C0AA 1EQRA 1EUJA 4R1JA 5IYBG 4DV7L 2F3IA 2OTLA 4LF4L 2CCZA 3RR5A 2HIXA 5DLQE 2JA8G 4JOIA 4LFAQ 2I5HA 4LF8Q 1EOVA 1V43A 3GTMH 2LXJA 2Q2UA 4IJLA 2L15A 2LXKA 4IPCA 1HR0Q 2WAQG 3J81j 1PH9A 4L5TA 1XTDA 2MFIA 4DV3L 4LF7L 4HIOA 3OW2A 4GLAC 4JBJA 2OCEA 3PIPA 3PO2G 4DAMA 4HIMA 1Q81C 1X55A 2JJQA 4IFDI 2R93H 3PUZA 1XNQL 1E22A 3RZOH 1VQGA 4Y52H 1HJPA 3H0GG 4DR4L 1UE6A 4DUYQ 3K81C 2ES2A 1VCIA 5LMNW 1PH3A 1VQBA 1HH2P 2K4KA 3KF6B 4DV6Q 3CCRA 4KHPQ 3S16H 1KXLA 2MO1A 4JG2A 4P73A 4JI8L 4A3MH 5JJKA 4DK3C 4NPSA 4HIKA 2JA5H 4DR2L 1Y14B 5JEAJ 4OWWB 3GTKH 2KENA 2BA1A 1YZ6A 1P16A 2ZTDA 1MIUA 2D0PA 4AYBG 4A3FH 1IXRA 2NZHA 1Q8KA 1RL2A 5M5YH 3HKZE 2JK8A 4DUZQ 4DR1Q 3CC4A 4BA2I 4A93H 1D7QA 2PQAB 3AQQA 2IHEA 3BZCA 4IOCA 3CF5A 1XPUA 3M7NA 4JI2Q 1HZCA 2VZAA 2NVQH 4B3SQ 2D0OA 3GTLH 1Q46A 1K0RA 2VUMG 3ULLA 5M3FH 2JA7H 1I50H 4IPGA 2MQHA 2OQ0A 5GAEC 2JA5G 5JJIA 2WFWA 1WI5A 1JB7A 3E0EA 1N33L 4GKKL 1R9TH 4JI3L 2ASBA 4OX9L 2K5NA 3S1NH 2EIFA 1YJNA 1X54A 5HGQA 2R92H 2ZJRA 3KJPA 1V9PA 3L0OA 4X62L 3CC7A 4LUOA 2QEXA 4GKJL 4JI1Q 4DV0Q 3I7FA 4MNOA 4IO9A 1XNRQ 1BKBA 4NXNL 3L7ZC 3D31A 1N36Q 4ALPA 2CQOA 3T1YQ 3I4NH 2BA0A 1TWAH 1B7YB 1NTGA 3G48A 4YWMA 5M3FG 2JA7G 1WJJA 1KRSA 1E7ZA 2K5VA 3U50C 5M5XH 2E2IH 3H3VH 2R7DA 3HOVH 3PSIA 3RLFA 2YV5A
chains in the Genus database with same CATH superfamily
5C4JB 4LFAL 1HQMC 5CV5A 4IALA 2R92G 1PYBA 1A6XA 1PVOA 4ILWA 1TU2B 2R3ZA 4EVOA 1O7IA 2QKIC 3HOZB 1O7YA 1KLUD 3OWEB 3OW7A 1YBYA 3CAMA 2OEOA 5DM63 1HZBA 3C3LA 3HOZH 1HNWL 3FP9A 3OOCA 2Q2IA 3S1QB 1B50A 2DJFC 4OONA 5JVG3 4GN5A 2RVLA 2Y0SE 4PQXA 5C44G 1NBWA 1DGSA 3M4QA 2V4DA 2WIIB 5COYA 4KHPL 1QVGA 5FKAC 5IP9G 5T1GA 4RGNA 4DPGA 1F2YA 4OHJA 5KNCA 1FGUA 1ASZA 2O5IC 1BOSA 4JV5Q 5IYDH 1BBUA 3ULJA 5C3EB 2Q8RE 2HHHQ 1ASYA 1QNKA 2A74C 2X69A 3F8TA 4MZ9A 5C3EH 3KFUA 5K36G 1H9JA 3O13A 4B9WA 3A8JE 2IX3A 1F9SA 1D8LA 5BR8Q 2CH4W 4M1UB 1NE3A 1D2BA 5CGKA 1KTKA 4DV1Q 2GVAA 4GOPC 2F0UA 1ESFA 2ZTCA 5IYDG 3J7ZC 1JJ2A 5M3MB 4GOPA 4IFDJ 3T1YL 1PFBA 1G2SA 3RNUA 4XYQA 5EGTA 5M3MH 1I4PA 2IX0A 4B9XA 4IUUA 2UXCQ 4EX5A 2Q2TA 4KHZA 3R3OA 3HG9A 5EPJA 4XQJA 4F87A 2L1BA 3OSOA 5JOBA 1BCPC 1WTQA 3G6EA 2VB2X 2F0EA 4G7ZC 1E1TA 2K33A 4ZYSA 1MSGA 2CH4A 2UU9Q 1VQ4A 1EL0A 1NCVA 3NBHA 1GUGA 3KLSX 1WYDA 4QL5A 1VMPA 1SNMA 3K8AA 5EAYA 2NN6I 3HFZB 3FEWX 1B70B 4X64Q 4QCLA 1Q8IA 2VQFQ 4HCEA 3PUYA 5KRUA 5LHY1 4CDDC 5A35A 3CD6A 4A3MG 4IUNA 3PO3B 1DOMA 1W3SA 2LS01 2R6GA 2QEJC 4AIMA 1NMGA 1DD2A 1JR0D 4U673 3J80i 4A93G 4ID6A 2ATWA 1X32A 1PH6A 1U0LA 3KF6A 2QILA 3V05A 4CDCC 2NZ1D 1KL9A 3SGIA 2K7VA 3FKIB 4DKAC 1IBLL 1QNUA 4HJ7A 4C1NI 3A8IE 5IT9L 2K5DA 2K04A 2Z0SA 3FKIH 3FDTA 1U4LA 3SR1A 1GM5A 2V1CC 1K83H 3K57A 1J8IA 2E2HB 2XSCA 2NTTA 4POFA 1IBKL 1YNJC 4A3DH 2SNSA 3HOXH 3HOVG 4C3JH 1JE4A 2IX1A 2CKZB 2UUAQ 1EIYB 3BG3A 3S14B 5BN3A 3DWQA 4ZUIA 4YWLA 2F4VL 1L1OB 1SMYD 1TIID 1O7ZA 5ELDA 4G7OC 2NBFA 2XVSA 1SR3A 3CCVA 2VQEQ 2PMZB 3RLNA 1WCMH 4C2MH 4A3BH 4A3DG 3IRBA 3HOXG 1G6PA 4JBKA 1SNQA 4C3JG 1G2TA 4LK1C 1KDAA 4C3HG 5EKIA 1EY5A 5GQOA 1XMQQ 1GUNA 4APVA 4BBRB 1W2BA 2AWOA 2JA9A 2PQEA 1J6QA 1LT3D 1HHVA 4EQ5A 1D5MC 1WCMG 4A3BG 1XXGA 2EYMA 3R93A 3F2UA 3OTOQ 3PUVA 1AE2A 2PMZE 5CBAE 4ME3A 1PRTD 1MJCA 3TS2A 4OX9Q 3I3CA 1FVIA 1RTNA 1TY0A 2UXBQ 2ZXOA 1P8LA 4ZLTF 3UE1A 3PO2B 3CCSA 2G5DA 4NB3A 5CV9A 3CCLA 1X3EA 2I46A 3BYTB 3MXUA 4PZ6A 4WJ4A 3GTMB 1B3QA 1DYQA 5LMUL 2QA4A 4AH6A 3ICEA 4CBVA 3A5UA 3LNNA 1BBXC 1STHA 1SYBA 3DEOA 2J7ZA 4LAAA 4X65L 3U9SA 4DAVA 5ELCA 3OMGA 2UXDL 1LM0A 2IT1A 2YTVA 1PTOF 1YHBA 1HNWQ 3R2TA 3DEPA 4NMZA 1A15A 1IBML 3I2ZA 3SK8A 1CM9A 4K2KA 2VUMB 3AB9A 3H6MA 4WRDA 1SYCA 3JAML 4ZKBB 2EYOA 5GAHC 1A3UA 2VUMH 1T9HA 1JOQA 4GLVB 3GTKB 1K3BC 4DV2Q 1E3PA 4LFCQ 4E6IA 3GD7A 2DNEA 4CDFC 4QY7A 5A2QE 2CQAA 1S5BD 3PV0A 3GTQH 2L5TA 3KLWA 3I70A 3FRPB 3NE5B 5C0XH 3S1RH 5EBCA 5CYUA 4LUZA 5C3XA 2RKSA 2B63H 4LFBQ 5IWAQ 1RDPD 4N9TA 1YJ9A 4FO2A 4C3IH 3OIQA 2PQAA 3WDNA 4PG3A 4LF4Q 1B2TA 2KVMA 2NTSA 1K8GA 1O78A 2IHFA 1F9RA 4FVMA 4MTNA 5IGDA 3PF4A 4R8NA 5C4XG 5M5XB 5C0XG 1EOTA 3ERQA 2B63G 1WD1A 1U9RA 3S17H 1TT2A 4DK1A 1B8AA 4C3IG 3PIO3 1IHZA 4JW0A 3CPFA 4H02A 1D5ZC 4BBSH 2CW0D 4OXPA 2M2LA 1EIHA 5J3BA 1Q90A 1YI2A 1EWIA 4JI8Q 1FGBD 5H1SE 4A4IA 4BY7B 2I5MX 1C9OA 4K0KL 1LT4D 4B3TL 1U4PA 2VB3X 5E3FA 2LY7A 1Y1VH 1PFMA 4IPHA 4BBSG 2A5HA 1BXTA 2Q8IB 1SN8A 4FF2A 1VQOA 3CQZB 3BVMA 1LT5D 1CT1D 5CR3A 1LABA 4YWKA 3K5LA 1SAPA 1MHWC 3HKSA 4I7ZC 1H9RA 4KY5A 1MGSA 2AKWB 5IYCH 5JVH3 3BZDB 3CRKC 1N32L 3TZUA 4O2DA 3U58A 1VQDA 1Y1VG 3CCQA 3CC2A 2BDOA 1HUMA 1QZHA 1GVPA 2F0SA 1WVLA 2M00A 4JOIC 4DFAA 2NVYB 1IW7C 3NBHB 3V2TA 4TRDA 1EUJA 4R1JA 2A69D 2F3IA 3LX0A 3MWYW 3MA2B 4JOIA 1FD7D 3BDLA 2E75C 1GUTA 2PW5A 4IPCA 1PTOD 2WAQG 1XTDA 1S5ED 3N6RA 1U4RA 1HTLD 3J81L 3OW2A 5ELEA 1MSHA 2D5DA 2JJQA 1QWYA 2I07B 1QCBD 1VQGA 1J9OA 2B2VC 3D3RA 3E6ZX 2PZUA 2HQEA 4DR4L 1UE6A 4K8IA 3K81C 5L37A 2F0TA 1PH3A 4DV6Q 1HH2P 3KF6B 3CCRA 5NUCA 5KEEA 3HP3A 3A7LA 4B08A 1IYVA 1MD2D 4PMCA 1AEXA 2BA1A 1PH1A 2NZHA 3P75A 2JK8A 3A55A 2H1EA 2RDHA 1D7QA 1IL8A 2IHEA 1XPUA 1YNND 2EYJA 2VZAA 1Z7TA 4WORA 3PIP3 5M3FH 2QW7A 3S1NB 5GAEC 4WFN3 5JJIA 1Y1WB 2WFWA 2RSOA 3NTHA 3S1NH 1YJNA 3TMEA 4X62L 4LUOA 3I4NB 4JI1Q 3DUZA 4MNOA 2JA6B 3L7ZC 1N36Q 1ILPA 1EU4A 3KLRA 3I4NH 2BA0A 1TWAH 5I6YA 4YWMA 5M3FG 1Y8NB 1WJJA 1KRSA 2RA4A 4L63B 1U4MA 2E2IH 4UPAA 3RLFA 1PRTC 1Q1EA 5J39A 4BY1H 1KNEA 5FJ8H 2F0JA 4RGOS 4UP7A 5LMUQ 2AQ2B 1CSQA 5IT9E 4DNIA 4ZUJA 3TREA 2F0DA 4P71A 4JI5Q 2K05A 1SYGA 3BVZA 4LNQA 2WB1G 1PMRA 1Z47A 4DN4M 2RDGA 1I4HA 4BY1G 4R9WA 2MP1A 5I9PA 5FJ8G 4Y7NH 4DUYL 3T13A 2NVXB 1XX8A 1PA6A 2QCPX 1HNXL 3PMFA 3M9BA 1IKLA 3K6OA 1L1OC 1VF7A 3CU7A 5JAVA 3UDGA 4OO1H 1HRJA 1XPOA 3MTSA 3GTPB 1M4VA 4FP5D 2B8GA 4DR1L 2NZOA 3I4LA 1N34Q 1L1OA 4DUZL 4L5QA 3W2DA 3VA7A 1D1IA 3ERSX 4R4TA 4CKBA 3TZDA 4B3SL 1GUSA 1L0XB 2HUGA 2JP1A 5D65A 1K8AC 1R4PB 1I5FA 3VR4A 1LUZA 4K8JA 4OO1G 1HQRD 1SNPA 1TQOA 1PFSA 2YTXA 1U5KA 3GV6A 5ISRA 4A3CH 3E9IA 3JC66 4ZK9B 1BUVT 3WOEA 3RZDH 1H9SB 2RQXA 3F1ZA 2K01A 1RKNA 3SDZA 3RMHA 4KD3A 2FXQA 4OEMB 4A3IB 1RHPA 1OXVA 4I65A 3I4MB 1SRUA 1JE5A 1ET9A 2E2DC 4A3GH 2HD3A 3I91A 4K5VA 4H13C 5K5PA 3EBEA 1S4ZA 5A2QL 4LF5L 4DR6Q 4YY3L 4JYAL 1I94L 1I4GA 2EVBA 1RTOA 2DGYA 2DY7A 3FPPA 3STBC 3HOUH 5CV8A 4DV4L 4ODGA 1LLRD 4KKSA 4A3GG 2GN5A 2JXMB 3FPUB 3QJYA 4JI0L 2D62A 3J7A5 4DV5L 2L12A 4B3TQ 3IAYA 1JCKB 3K5OA 2Z9HA 2NVTB 1DJRD 2ZM6Q 2YU9B 4JI7L 2PPBC 2YYZA 3U4ZA 2KHIA 2MNAA 4YCWA 1CI3M 3HOUG 1KD1C 1HNZQ 3DWAA 1GD7A 3JAME 1STEA 4A3FG 1ZYRD 1RJTA 1QVFA 2Q2HA 4DR5L 3MVVA 3A56A 1WTOA 3SXHA 1SNOA 4B3RL 1F9QA 4H44C 5AJ3L 2PCFB 4NXML 1C4QA 5FO8B 2KCMA 5CMDA 4F8MA 2E5LL 3AYHB 3F2DA 3OWFA 2VY3A 2N55A 2VW9A 1O7LA 2KA7A 2J4XA 4J8QA 1H9MA 4N8X1 5JJLA 1CZWA 4DR7L 2KBNA 5C4JH 1WTPA 3EN2A 1JB3A 1OO9B 2RBMA 3D4DA 1ZXTA 1CUKA 2A6EC 3TS0A 4A75A 1TS4A 1EFID 3K58A 2K14A 3TP8A 2HIVA 3NP8A 3CMEA 2Y0SG 4KN7C 4RWSC 3S2HB 4LW1A 1VQFA 1LO5D 2A8VA 1E0BA 3M4YA 1OXUA 3WWVA 3S1QH 1HFGA 4DR4Q 4K2LA 2O5JC 3EIVA 2BE5C 3HOYB 3HOZG 4RGTA 4MN3A 2BH2A 1VQJA 4YCUA 5C0XI 1BVSA 1NNXA 1II3A 3OMCA 4DNTB 2KECA 5KIXA 1VQ6A 1E2ZA 3BS1A 4ZQ3A 3A8KE 4POGA 2VNUD 4G57A 2B2YC 5ELBA 1WTWA 2JA8B 2KCNA 2JEBI 2KQ3A 1EY4A 2B2YA 1Q82C 1NUCA 2F0MA 4DV0L 5EKLA 1XNRL 1GKHA 1UE5A 1J5EQ 4GS3A 1YNNC 1EYAA 5C3EG 2K52A 4H0LC 3TEHB 3I55A 4OGQC 4O42A 1X3FA 5HGTA 1PYSB 4ZCKA 1LT6D 1NAPA 5FO9B 1G291 2HQLA 1B4OA 3LWEA 2XN9C 3DM1A 5KYIA 1FL0A 1PHJA 2LFNA 1XMOL 1Z9FA 3C1FA 3L2PA 5M3MG 3QB3A 4AQYQ 5I4DA 3OPOA 1SMXA 1FNVA 2IPKD 3KDFB 2B29A 3NELA 2R93B 2UUBL 2DNCA 4IN3A 2EQSA 2X6LA 1V1QA 1KAAA 4KN4C 4L5RC 1DZ1A 4KY7A 3J81E 1CFMA 1X3GA 2XWJB 1CA5A 2UUCL 3E9HA 1YEZA 1NR4A 3E3XA 5LL6S 4HJ8A 2JA5B 5E4XA 1Q3LA 3T16A 2VXWA 1DOLA 1HNXQ 3I4OA 2AUKA 3CCEA 3PO3H 1GO3E 3S9WA 1WD0A 3NUCA 1LTTD 4IQZA 4YHHL 2RCNA 2NVQB 1L0WA 4NKLA 3PIOA 1PRTB 2LSSA 4DR3L 2N3SA 1KHIA 1I50B 3HGBA 3ZYYX 4DAPA 1VQLA 2B3GA 1AP0A 3T51B 1FJGL 3K5MA 1HUNA 3C2PA 3PO3G 3G4SA 2EYLA 1SXTA 5CV4A 1BF4A 3DXJC 3A7AB 4ABNA 1LTBD 1YVCA 1OXTA 4ZKCB 1VDZA 3HOVB 1VMCA 3T1HL 1X65A 4GNXB 2E2HH 2B39A 4CKEA 3PUWA 3CW2C 1S72A 1CKMA 2IL8A 5T1IA 3PCOB 3J7YW 3FKIG 1SYDA 5IGBA 4V190 1UWVA 2JYOA 5KNDA 1XNQQ 3S14H 1SJED 1JWSD 4J1MA 3QR8A 4RKLA 4A3JB 4R4CA 1D6EC 2XIWA 4RG1A 5IE8A 4LF9L 1S5CD 2K5QA 5GAGC 3CCJA 1TWHB 4A3JH 1VQ8A 5FOBB 3DM3A 4JYAQ 4YY3Q 3B6YA 4HSPA 2PO4A 5EQ0A 3KOJA 5FLXL 2ALYB 1C7YA 2WKDA 4X3KA 1IYUA 2ZTEA 4DGZA 4X66L 1I6HB 1QUQB 4L6TB 1R4QB 1NMFA 1I6HH 4K14A 1EIGA 3ER0A 4BBRH 5IY0A 1EWCA 3MXGA 2Z6KC 2ENBA 1JWMD 1TXYA 3N52A 3M4PA 1M1KC 2IJ0A 2MGSA 2Z6KA 2RHSB 3BZKA 4UP9A 3NWSA 3IL8A 4GKJQ 3P20A 2QDLA 3AFPA 4K6LA 4NXNQ 1F2LA 4BBRG 4U68A 3J80L 4RCNA 2EYPA 1GUWA 1EY7A 4DAYA 3PO2H 2EYFA 4F7XA 1EQRA 1ZYRC 1CA6A 2IWHA 1DONA 4DV7L 2CCZA 2HIXA 1AN8A 4LFAQ 1AZPA 2I5HA 1EOVA 3GTMH 2LXJA 2Q2UA 4CGYB 2K1BA 3WOFA 3J81j 3HKZB 4M8AA 2MFIA 4DV3L 4LF7L 4HIOA 2ICIA 4OIJA 4GLAC 5C3WA 4JBJA 3PIPA 3PO2G 4FXDA 4HIMA 1Q81C 1TWCB 3I90A 4IFDI 3D4WA 4Y52H 1H9SA 1ICWA 3KLSA 1AFPA 1I3QB 2ES2A 2AQ1B 1ICFB 4KHPQ 2PYKA 2B2WC 3EA6A 4JG2A 4KTAA 4HIKA 2PZWA 4DR2L 1RCVD 1Y14B 1B9MA 2B2WA 1SBBB 4OWWB 3GTKH 2KENA 4QQBX 1YZ6A 1P16A 2ZTDA 1EZ8A 1IXRA 3HKZE 2EJGC 2F1MA 2BCOA 3URYA 3HOWB 3CF5A 1I4RA 2D0OA 1K0RA 2VUMG 3K0YA 2MQHA 2OQ0A 1EZ6A 1WI5A 1N33L 4GKKL 4JI3L 3IKJA 2EIFA 1V1PA 4LJZC 5F2DA 1V9PA 3CC7A 3M3YB 2QEXA 4DV0Q 3I7FA 1XNRQ 5C4XB 1BKBA 3TP6A 3T1YQ 2B2TC 3MZ5A 1PTOB 4QMGA 4RHSA 2K5VA 1CTMA 1CZGA 5M5XH 3T53B 4QB4A 3J7AF 2PZTA 3MC0B 2B2TA 2YV5A 2RCFA 4LF8L 4N8FA 1AE3A 2BOSA 1JJCB 4XT3B 5EPLA 1SDFA 1SEBD 1B53A 1HR0L 4G7HC 1XMOQ 1VQEA 1WTVA 1ET6A 1Z6HA 5IP7H 4TVAB 4P72A 1BCPF 4GN3B 3FMCA 5IT9c 2F0WA 2F52A 4HMJA 5G3LF 2UUBQ 1ILQA 4OELB 3G6JB 1DCZA 2F0FA 3FHWA 5CORA 4BY7H 2ZJPA 2WV6D 1YJWA 4XDXA 1SNDA 3KK7A 1OXXK 2UUCQ 3M4OB 1EY0A 2EXZA 2I5LX 4KY6A 5FLMH 2ZJQA 1K9MC 4HCSA 5IP7G 4QIWB 3CQZH 3R8BA 1IL2A 1ONLA 3TRZA 3H3VI 2OTJA 2EYHA 5DAUA 2R7FA 1AW7A 1G91A 3EFXD 4BY7G 2N78A 1PYWD 1PH2A 1H95A 5I9OA 4P74A 5HURA 3R2IA 5DEHA 5FLMG 1A3TA 4L5SA 1GHKA 3X3NA 4K5XA 2NN6H 1IBLQ 5IYCG 2D2CC 2NVYH 3HS0C 2F0GA 1VQPA 2R61A 2LKVA 4B3ML 4QIWE 3GP7A 3KYHC 1G51A 2OT2A 3TBIB 3Q23A 2TMPA 2RHQB 5KGUA 1HZ9A 3VYTA 4LMQD 1IBKQ 1VF5C 2N8NA 2NN6G 3EROA 4Q0FA 5CV7A 4XXEA 1FNWA 4FNFA 3NEMA 2F4VQ 1X6OA 1SSOA 4RHRA 3SEBA 4IPDA 1F2ZA 2CHBD 2BH8A 4YCVA 4OL7A 2MPMA 3GV3A 4OWTB 4L8JA 1QJOA 1JICA 3D8GA 3CRLC 3BDOA 5E4WC 3RUZA 1SMYC 2F4IA 3CPWA 3GTGB 1TWFB 2QDBA 2OWOA 3H15A 5J1ZA 1MKHA 2A6HD 1TR5A 1TWFH 4BA1I 3MFYA 1SLJA 4CDEC 3TP5A 3KDFA 2XRSD 1C8CA 1K8MA 1A8VA 3ZJYC 4JV5L 1RF2D 1YIJA 1F77A 1Y1WH 2HHHL 1C48A 3ND9A 1BR9A 3JAMc 1PH5A 5M5WB 1I6VC 5IODA 3L3OC 3K59A 5BR8L 2JA6H 2LMCB 3KBXA 1LACA 4X6AH 4DV1L 1E1OA 2VL6A 1VQ7A 1M8AA 2NWGA 1EWHA 1V8QA 3IFDA 1MBYA 3NTKA 3VR3A 4DV7Q 4A3KB 4HMIA 1V1OA 4HSVA 1BCPD 1QG7A 1DOKA 4A3KH 3I4NG 2EJFC 2G9DA 2JA6G 3S1MB 5G3LD 1UE1A 2WB1B 1PZJD 1JT8A 1A62A 4X65Q 1JWUD 2UXDQ 5I2YA 3MFGA 2CFMA 5E1FA 4EQNA 4BWGB 3A54A 3ITPA 2RSNA 3GQBA 4JBWA 2JQOA 1L0YB 2F0HA 4GNXC 3T4AC 4A3LH 1IBMQ 1SFOB 2UU9L 2NVXH 1RD9D 2DUDA 4GNXA 3GTOB 2R7ZB 5HY6A 3VA5A 1Y8OB 4QUCA 4DAYB 4X64L 3I72A 4O0AA 4A3EB 3GTPH 1K3RA 5FLXE 2WB1E 1CK1A 3S15B 5IGFA 3ND8A 3G7LA 5ELOA 4ME5A 3BYYB 3VYUA 3E0JA 1F9PA 2F0OA 1EYGA 5IYBH 1QUQA 1AZQA 1XPRA 4Q5VA 4RCOA 1HA5A 1KLGD 2VS1A 2FFKB 1KABA 1UEAB 1XWEA 4PZ7A 3KF8B 3RD4A 2X6GA 1BO0A 1A63A 3H0GB 4A3IH 1VQ5A 3K7AB 4A3CG 4EGVA 3I4MH 4NW2A 1VQAA 3J80E 1QILA 2ICEC 3H0GH 3QWNA 2EY5A 3K7AH 4TKOB 4HJ5A 2EPBA 2OF1A 2TSSA 2NYZD 3G71A 4AYBB 1TY2A 2UUAL 3RZOB 1CQFA 3KUPA 4A3IG 3PUXA 1V1PB 2KOLA 2DN8A 2C5CA 3I4MG 2CW0C 2F0NA 5GADC 4K0KQ 1KQSA 2VQEL 1O80A 2ID0A 3S16B 1A0IA 4JBMA 2MO0A 3NSWA 2AQ3B 3L9AX 3J81c 3PGZA 1WOCA 1PZKD 2JE6I 3D4RA 1PH7A 2NVTH 4IOAA 4A3FB 3EJIA 2YU9H 1ML0D 2QGQA 5I6WA 1JOKA 3NWTA 1XMQL 4FDBA 3NENA 4FF1A 2HDMA 3GTLB 4AYBE 1N32Q 2H5XA 3I56A 2JA7B 1EEID 1KIXA 2K03A 5LMNL 1R9TB 2CWPA 2PNHA 2K75A 2R92B 3OTOL 3BJUA 5IGCA 1T5XD 1EYDA 4JI4L 1S5DD 4IUTA 3MAQA 3ULPA 2UXBL 2E8GA 4QJFA 1IYJB 4N9PA 2C9OA 2KCCA 1UE7A 4B3MQ 5EJWA 3AFQA 1VQKA 3UDIA 2A69C 1CKNA 3UDFA 3Q8DA 4QGUA 5C44B 3S2HH 4DK6C 1EQVA 2GA4B 4KKUA 1S40A 1LTAD 5C44H 1PTOC 4PMWA 2A68D 2C35B 1HZAA 2KCTA 3V96A 3F2CA 5IP9H 4XIGS 1VQ9A 2Z4HA 4I7AA 3VR2A 4HR7B 1SE3A 3U9OA 5EKKA 1EFWA 3HOYH 1PDQA 4PNYA 4BXXH 3X3MA 4X3TA 4HTHA 2MUYA 5K36H 1PLFA 2B8FA 1Q86C 4DV2L 4LFCL 1EQTA 3CP0A 3RN2A 3NQIA 1HA6A 1CHPD 3HOYG 4R4IA 3K80C 2JA8H 2L4NA 1L2FA 2KUMA 1Q7YC 2WINB 2A6HC 2K50A 3NPPA 5TSSA 1OTCA 1YITA 3UE0A 3BU2A 4BXXG 4X62Q 2AWNA 2KEDA 3KJOA 2XNAC 4LFBL 5IWAL 3LWUA 3BVGA 3Q24A 1YHQA 1WTHA 3NTIA 1C0AA 1SE4A 2OTLA 4LF4L 2JA8G 4WJWA 1STBA 1UNSA 2L55A 2Z6BA 1V43A 1KNAA 2FMCA 4X3SA 1DXMA 2L15A 2LXKA 4ZRZA 1PH9A 4L5TA 1PRTF 4FXKC 3AMUA 3MXPA 2EY1A 3P1HA 1STAA 3SK6A 3I73A 4MTKA 2F03A 4RGMA 4IUVA 1STGA 1SYEA 1K0SA 1FNUA 2EOTA 2R93H 3PUZA 3SVMA 1E22A 3C46A 5JPMC 4A3MB 4DUYQ 1VCIA 4KMUC 1KXLA 4A3MH 4JI8L 5JJKA 4DK3C 2JA5H 1BDOA 1WTRA 4A93B 2EDGA 2NUCA 4KD4A 1Q8KA 4DR1Q 3CC4A 5D3IB 2R93G 4DUZQ 4A93H 1I4XA 5C4ZA 3BZCA 2PW7A 2HCCA 1HZCA 2NVQH 5JPNC 4B3SQ 4HAEA 1I50H 2JA5G 1JB7A 2DY8A 4KV6A 2NB0A 2E74C 5CC4A 2ASBA 2K5NA 2K32A 1IW7D 3KBGA 2ZJRA 3KJPA 3SHLA 5BN4A 2L11A 2BDNA 3QOLA 1STYA 1BQQT 2CQOA 3TN2A 4JPBW 3EQLC 3BDCA 1NTGA 3G48A 3U50C 1E7ZA 1Y8PB 5C4HA 3HOVH 2F0QA 4KJOA 4LF6L 4UAIA 4RKBA 4EQOA 5IGEA 3K5NA 1ESRA 2MHVA 4LWCA 3QG1A 2I0QA 1VQHA 1K83B 2WACA 3SK4A 2QF7A 4RMFA 4A3DB 3HOXB 4RH6A 1EU3A 4C3JB 2L0CA 4NDXA 4LF5Q 4C3HB 1I94Q 1TWHH 4HIDA 2HDLA 4ULLA 4UY8C 3JAMi 2PI2E 4CJ1B 3I8ZA 4C3HH 4DV4Q 4XTCS 2Z4IA 3NXWA 3UDXA 4DV6L 4JI0Q 1WCMB 4C2MB 1I4QA 2H4OA 3D0FA 4DV5Q 4A3BB 1JOOA 4A3JG 1M90C 4JI7Q 1TWGB 2AUJD 5C5LA 4PMBA 4UDUC 2ZT9C 3MXNB 3VYRA 4IJHA 1TWGH 5D14A 1BBWA 4BS9A 2JN4A 1NSNS 4DR5Q 1B1ZA 3AU7A 4B3RQ 3W3AA 4CHTB 5EBDA 5AJ3Q 2CVRA 3Q6SA 4NXMQ 5LMNQ 4J6HA 2E5LQ 4FF4A 1JJGA 1IKMA 4KI0A 4QF4A 4JI1L 4IZ8A 4JI4Q 4JCVE 1N36L 1XTCD 5DNFA 4DR7Q 2OQKA 4UHVA 3QO2A 5C6AA 3K0XA 2K6AA 3OHXC 1MI2A 4OO1I 1SROA 1TWCH 3NBIA 4R4QA 4J15A 2HT1A 3CMAA 3T56B 4JI5L 1I3QH 4JVZA 1SJHD 3KF8A 2SDFA 3HKZG 1JORA 2F0PA 2E2JB 2XGTA 1ENAA 1OXSC 2EXDA 1NR2A 1PH8A 5C5MA 2A68C 5I2XA 1S3OA 2E2JH 4FXGC 2Z8LA 3HOWH 2GVBA 1HFNA 4XQNA 1N34L 4P75A 4IURA 3H09A 1CKNB 1QZGA 2XTIA 4MHEA 3GTQB 1D5XC 1HR0W 3H91A 1VS0A 1VQIA 1SYFA 3S1RB 2B63B 3M3YH 3ONAB 5C4XH 3HOWG 1G8ZD 4C3IB 3W5OA 1PTOH 3VYSA 1LTID 4HJAA 2E76C 2F0VA 3HEJA 3M85A 3RLOA 3J81i 3GDEA 1X9NA 2RF4A 4DF7A 5IIFA 2IY5B 2K28A 5KNBA 3MEHA 4OWXB 3S17B 1QVCA 1TS2A 3A5ZB 3NQTA 3IFTA 3CXCA 5ELNA 4O1NA 3D6WA 1RODA 1X3QA 3GO5A 1X3PA 3STBD 4LUVA 4C56C 4GN4B 1EY6A 1LTGD 4BBSB 3H3VC 2O4XA 1UEBA 1VQNA 3DWPA 2ZXRA 5GROA 2F3VA 1AH9A 2ZXPA 1UAPA 1ENFA 4DR6L 2YTYA 4A76A 1CQVA 4CJ0B 4ZAIA 4FF3A 4GLXA 4G4KA 3M4OH 4JI6L 3VR6A 4JK1C 2EZVA 2K5WA 1Y1VB 3QIAA 1EEFD 4KHVA 2XWBB 2F3WA 4JI2L 1NY4A 1Q1BA 4YHHQ 2ZM6L 2SNMA 1SE8A 4GOPB 4DA2A 4DR3Q 3TP7A 1Y69U 1MJEA 3UI2A 1HNZL 5FLXc 1CHQD 2XRQD 4MIUA 2AMCB 1ENCA 2M9VA 4HN7A 3W1BA 1PV4A 1FJGQ 1YHAA 2KHJA 3NK9A 4S3SA 2FHTA 3U4VA 4RA8A 2WAQB 1LTLA 4R4OA 3DMUA 3A74A 2A1AA 1HTPA 2G9HD 1STNA 1N9WA 4DNRB 2A6ED 1BCPB 1CKOA 2HCIA 1QB5D 3CCMA 3T1HQ 3S2DB 1CSPA 4PV1C 1VQCA 4LF6Q 3S2DH 1WFQA 5JEAH 4V0BA 1EYCA 3HRZC 1EQQA 1KC8C 4WJ3M 4GZYC 2A73B 2Z1CA 2IW3A 3J80c 4LF9Q 2EY2A 2K5HA 2CWAA 4PZ8A 2BE5D 5DM73 2WAQE 4CKCA 3Q22A 3QOJA 1K28A 3TDQA 1TS5A 3DLLA 4X66Q 4DK0A 3GTGH 2D9UA 1EIFA 2L9HA 2N88A 5JEAG 3C1EA 1HPCA 1GUOA 5LL6X 3VR5A 2B2VA 5E7NA 5KYLA 3CCUA 2JEAI 1TS3A 4K5WA 3S24A 1KAWA 1DM0B 5ELFA 3DHQA 5M3FB 1UUPA 3J7AV 1Q12A 3K7UC 5M5WH 2OXPA 3F2BA 1IZ6A 2KEEA 1N8RC 4KK7A 2DJGC 4HEDA 5EPKA 2A19A 1J5EL 4DU9A 1Y1WG 4DXGA 4CJ2C 4Z9CB 2O2LD 3MEFA 4TSSA 1A2TA 1W6JA 1TWAB 1T5EA 1WTXA 3VDYA 4IUQA 5AFWA 3PF5A 2E2IB 2SOBA 1W6KA 3W1GA 2EJMA 2UXCL 4HJ9A 1VQMA 4DV3Q 4LF7Q 1H9KA 3S1MH 4BY1B 2Q8TA 3TSSA 1PH4A 1KRTA 1A2UA 4P2CB 5C0XJ 2PNRC 2PI2A 1E2WA 2B2UC 3P7JA 3GTJB 1X56A 1B3AA 1GJXA 3D6CA 4A3KG 3A0JA 4AQYL 1E24A 3OIPA 2B2UA 2FMMA 3GTJH 3RN5A 1LTSD 1SFOH 1JC7A 1K8OA 3AEVA 3GTOH 2R7ZH 4DR2Q 1NJIC 4Y7NB 3SE0A 1HCZA 1E2VA 2AHOB 3TQYA 2VQFL 4XYOA 4DXFA 5JJZA 1D1KA 4A3EH 1GOZA 1F2MA 1YNXA 4R8IA 4A3LG 4KJNA 3M7GA 2KHSA 3Q0AA 4TQUS 1ZEQX 5D3DA 1QE6A 4IFDH 4JC0A 3S15H 1KDCA 2R7ZG 4GKKQ 1N33Q 4KLKA 1PXUA 1ZKOA 4IUPA 4JI3Q 3OYYA 4UP8A 4RAUC 2EE1A 3M7NA 1KDBA 1XJVA 1EY9A 1TVXA 3LGJA 2WP8J 4A3EG 1TKWB 1HXYD 1XYIA 1RIPA 1JMCA 5IOCA 1LYLA 2N49A 1K73C 1B9NA 1PFNA 4IFDG 3E5SA 1SE2A 1GHJA 1YNJD 3MXNA 5BN5A 5IYBG 3RZDB 1JQYD 2FINB 2EY6A 4RFBA 5DLQE 3RR5A 2J0TD 2F0KA 2KJXA 4LF8Q 1EY8A 4IJLA 1HR0Q 4X3UA 3CHBD 2SEBD 1BNZA 4A3GB 1GXDC 2F0LA 2OCEA 2JSOA 4DAMA 3PQIA 1X55A 4NP5A 4K6DA 1XNQL 1S5FD 3RZOH 1HJPA 3H0GG 3SK5A 5CV6A 1B44D 5IGGA 3CKIB 2MJ8A 5LMNW 1VQBA 2K4KA 3HOUB 1LTRD 3EVQA 3S16H 2MO1A 4P73A 4NPSA 5M5YB 3H94A 5JEAJ 1PZID 4JI6Q 4A3FH 2D0PA 4AYBG 1MIUA 1FR3A 1RL2A 5M5YH 4BA2I 1LV9A 2WKCA 5FK9C 5J22A 2PQAB 3AQQA 2P5ZX 3MHBA 4H7BA 4IOCA 1FYCA 1G6ZA 4JI2Q 4FYDA 3FVQA 2RDFA 1A3VA 3GTLH 1Q46A 4QUFA 3ULLA 2JA7H 3HZXA 3NHHA 4IPGA 5M9OA 3E0EA 1R9TH 4XT1B 2FJ2A 4OX9L 1X54A 5HGQA 2R92H 3L0OA 4EQPA 4OIKA 4GKJL 4IO9A 4NXNL 5CBEE 4F88A 1QOHA 3D31A 5FO7B 2Y0SB 4YIJA 4ALPA 1B7YB 1SNCA 4C1NK 2F0IA 2JA7G 4XQQA 3H3VH 4KKTA 2R7DA 3PSIA
chains in the Genus database with same CATH topology
4LF6L 4LFAL 1Q1EA 4LF8L 4BY1H 2R92G 4UPAA 5FJ8H 1AE3A 1PYBA 4LWCA 2I0QA 1VQHA 1PVOA 4UP7A 1JJCB 1HR0L 5LMUQ 1O7IA 1CSQA 1XMOQ 4RMFA 1VQEA 4DNIA 1YBYA 3CAMA 3TREA 4P71A 1HZBA 5IP7H 4JI5Q 4LF5Q 3HOZH 4TVAB 1I94Q 1HNWL 1TWHH 3FP9A 4GN3B 4P72A 5IT9c 4HIDA 4LNQA 4UY8C 2WB1G 2F52A 3JAMi 2Q2IA 1Z47A 2PI2E 4OONA 2UUBQ 4C3HH 4GN5A 4DV4Q 4XTCS 2Y0SE 4BY1G 4JI6Q 5FJ8G 4DUYL 4Y7NH 3FHWA 5C44G 1NBWA 1DGSA 3M4QA 2ZJPA 4BY7H 3UDXA 4DV6L 4JI0Q 3D0FA 4KHPL 4DV5Q 1YJWA 1QVGA 1OXXK 1PA6A 2UUCQ 2I5LX 1HNXL 3M9BA 5IP9G 5FLMH 4A3JG 1M90C 2ZJQA 4DPGA 1K9MC 1L1OC 3UDGA 5IP7G 4JI7Q 3CQZH 1IL2A 1FGUA 1XPOA 1ASZA 4DR1L 2NZOA 1N34Q 3TRZA 1L1OA 4DUZL 4L5QA 4JV5Q 3MXNB 3H3VI 1BBUA 3ULJA 4IJHA 2OTJA 1TWGH 5IYDH 2R7FA 1BBWA 2HHHQ 1ASYA 3ERSX 4R4TA 4BY7G 2N78A 4DR5Q 3F8TA 4B3SL 4MZ9A 5C3EH 3KFUA 1PH2A 5K36G 1H95A 4B3RQ 4P74A 5AJ3Q 5FLMG 1K8AC 1D8LA 1I5FA 4NXMQ 4L5SA 5BR8Q 1LUZA 1NE3A 4OO1G 5LMNQ 2E5LQ 1JJGA 4KI0A 1IBLQ 5IYCG 4DV1Q 2GVAA 1PFSA 4GOPC 2YTXA 1U5KA 4A3CH 2NVYH 2ZTCA 5IYDG 4JI1L 3E9IA 3JC66 3J7ZC 4JI4Q 1VQPA 3RZDH 1JJ2A 4GOPA 4JCVE 1N36L 4IFDJ 3F1ZA 4B3ML 3T1YL 4QIWE 4DR7Q 3KYHC 1G51A 2OQKA 3RNUA 5M3MH 2RHQB 2FXQA 1HZ9A 3K0XA 1OXVA 2IX0A 1IBKQ 2N8NA 2NN6G 2UXCQ 4EX5A 1SRUA 2Q2TA 1JE5A 4KHZA 4A3GH 4OO1I 3NEMA 2F4VQ 1SROA 1X6OA 1TWCH 3G6EA 4R4QA 1E1TA 4J15A 4IPDA 3EBEA 2HT1A 3CMAA 4JI5L 4LF5L 4DR6Q 4YY3L 1I3QH 4JYAL 2BH8A 1I94L 1PH1A 2UU9Q 4YCVA 1VQ4A 2DGYA 3HKZG 4OWTB 3STBC 3HOUH 1WYDA 4QL5A 4DV4L 3K8AA 3CPWA 2XGTA 4A3GG 5EAYA 2GN5A 1OXSC 2EXDA 2NN6I 3HFZB 2OWOA 4JI0L 1B70B 2D62A 4X64Q 3H15A 1PH8A 3J7A5 1S3OA 4DV5L 1MKHA 2E2JH 4B3TQ 2VQFQ 1TWFH 4BA1I 3PUYA 2ZM6Q 1SLJA 3HOWH 4JI7L 2GVBA 4A3MG 2YYZA 3CD6A 3KDFA 3U4ZA 2KHIA 1W3SA 2MNAA 4YCWA 2R6GA 1N34L 1A8VA 3ZJYC 1NMGA 4P75A 4AIMA 1KD1C 1HNZQ 3HOUG 4JV5L 1GD7A 1YIJA 4A3FG 1CKNB 1QZGA 2XTIA 1Y1WH 2HHHL 1QVFA 2Q2HA 3J80i 4DR5L 1HR0W 1VS0A 1VQIA 1PH6A 2ATWA 4A93G 4B3RL 1U0LA 3JAMc 1PH5A 3KF6A 5AJ3L 3M3YH 4NXML 5C4XH 5BR8L 2JA6H 3HOWG 2KCMA 1KL9A 2E5LL 3SGIA 4DKAC 4X6AH 3AYHB 3F2DA 1IBLL 2VY3A 4DV1L 4HJ7A 2VW9A 1E1OA 3W5OA 2VL6A 1VQ7A 4HJAA 2Z0SA 3FKIH 3M85A 5JJLA 3RLOA 3J81i 2KBNA 5C4JH 3GDEA 4DV7Q 4DR7L 1X9NA 2RF4A 3EN2A 2IY5B 1GM5A 1CUKA 2V1CC 3TS0A 4A3KH 3I4NG 4OWXB 1K83H 4A75A 1QVCA 3A5ZB 4POFA 2JA6G 2K14A 1IBKL 1UE1A 2HIVA 3CXCA 3CMEA 5ELNA 4A3DH 1JT8A 2Y0SG 1A62A 4X65Q 3HOXH 3HOVG 4LW1A 2UXDQ 4C3JH 3GO5A 2IX1A 1VQFA 2CKZB 4LUVA 2CFMA 3STBD 1EIYB 4GN4B 2UUAQ 2A8VA 4YWLA 2F4VL 1L1OB 1OXUA 1UEBA 3WWVA 1VQNA 3S1QH 4JBWA 5GROA 2JQOA 4GNXC 1AH9A 1SR3A 3CCVA 4DR6L 2YTYA 4A3LH 4A76A 2VQEQ 1IBMQ 3RLNA 4DR4Q 2UU9L 2NVXH 2DUDA 1WCMH 3EIVA 4C2MH 4GNXA 4GLXA 4A3BH 3HOZG 5HY6A 3M4OH 4JI6L 2BH2A 4A3DG 3IRBA 1VQJA 3HOXG 1G6PA 4JBKA 4YCUA 4DAYB 5C0XI 1BVSA 4X64L 4O0AA 3GTPH 5GQOA 4JI2L 1XMQQ 1K3RA 1NY4A 4APVA 1VQ6A 1Q1BA 2WB1E 4YHHQ 2ZM6L 1W2BA 1SE8A 4GOPB 2AWOA 2JA9A 4DR3Q 1J6QA 4POGA 4EQ5A 2VNUD 1WCMG 1MJEA 5ELOA 1HNZL 5FLXc 4A3BG 2JEBI 2AMCB 1EYGA 3W1BA 1PV4A 1FJGQ 1YHAA 2KHJA 5IYBH 3OTOQ 1Q82C 1QUQA 1AE2A 3PUVA 4DV0L 2PMZE 1XNRL 1GKHA 4ME3A 1UE5A 1MJCA 4GS3A 3U4VA 1XPRA 1J5EQ 4OX9Q 3TS2A 1LTLA 4R4OA 1FVIA 2UXBQ 5C3EG 2K52A 3TEHB 3I55A 1P8LA 1X3FA 3A74A 2VS1A 2A1AA 3UE1A 1PYSB 1N9WA 3CCSA 1CKOA 4NB3A 4QQBX 3CCMA 4PZ7A 3CCLA 3KF8B 1X3EA 4PZ6A 3T1HQ 4WJ4A 1A63A 4A3IH 1CSPA 1VQ5A 1G291 4A3CG 1VQCA 2HQLA 3I4MH 5LMUL 4LF6Q 1VQAA 2QA4A 3S2DH 1FL0A 1WFQA 3H0GH 4AH6A 1XMOL 1Z9FA 1PHJA 3ICEA 3K7AH 3A5UA 3L2PA 4HJ5A 1EQQA 1KC8C 4WJ3M 5M3MG 3J80c 4X65L 4LF9Q 3G71A 4AQYQ 1SMXA 2UXDL 2K5HA 2CWAA 1LM0A 2IT1A 2B29A 3KDFB 3NELA 2YTVA 4PZ8A 2UUAL 2WAQE 2UUBL 2R93G 2EQSA 1YHBA 4A3IG 1HNWQ 3PUXA 1V1QA 4L5RC 3I4MG 5GADC 1X3GA 3DLLA 1KQSA 4X66Q 2UUCL 4K0KQ 2VQEL 1IBML 3GTGH 3I2ZA 1EIFA 2ID0A 3E9HA 1YEZA 1A0IA 5JEAG 4JBMA 4HJ8A 2MO0A 5GAHC 5E7NA 3CCUA 3J81c 3PGZA 2VUMH 1N32L 1WOCA 1T9HA 2JE6I 4IOAA 1PH7A 2NVTH 4GLVB 4DV2Q 1HNXQ 1E3PA 3I4OA 4LFCQ 2YU9H 2JEAI 3GD7A 3CCEA 3PO3H 2QGQA 1GO3E 1XMQL 4QY7A 4FDBA 3NENA 4YHHL 2RCNA 3S24A 3PV0A 1L0WA 1KAWA 3PIOA 3GTQH 3KLWA 2LSSA 4AYBE 4DR3L 2N3SA 1N32Q 2H5XA 3I56A 1KHIA 1Q12A 1KIXA 3K7UC 5LMNL 3S1RH 1VQLA 4LUZA 5M5WH 2CWPA 3F2BA 2B63H 1IZ6A 2B3GA 5IWAQ 1N8RC 4LFBQ 2PNHA 2K75A 1FJGL 3OTOL 3BJUA 1YJ9A 2A19A 3PO3G 4JI4L 4C3IH 1J5EL 1Y1WG 3G4SA 3ULPA 2PQAA 3MEFA 2UXBL 4LF4Q 4PG3A 2E8GA 4QJFA 1IYJB 1K8GA 2IHFA 4MTNA 3PF4A 3VDYA 1YVCA 5C4XG 1UE7A 3PF5A 1OXTA 4B3MQ 5C0XG 3AFQA 3W1GA 1VQKA 2B63G 3T1HL 3UDIA 4HJ9A 2UXCL 1X65A 4DV3Q 4GNXB 1VQMA 2E2HH 4LF7Q 3S17H 3S1MH 3PUWA 3CW2C 1CKNA 1S72A 1KRTA 1CKMA 3Q8DA 3UDFA 3PCOB 1B8AA 4QGUA 1PH4A 3FKIG 3S2HH 4DK6C 3CPFA 1UWVA 4H02A 5C0XJ 1S40A 5C44H 2PI2A 1XNQQ 3S14H 4BBSH 4PMWA 4R4CA 1X56A 4OXPA 4RG1A 2C35B 1HZAA 5IE8A 4A3KG 3A0JA 4AQYL 4LF9L 1E24A 5GAGC 2KCTA 3CCJA 3F2CA 5IP9H 4XIGS 4A3JH 3GTJH 1VQ8A 1VQ9A 3RN5A 5J3BA 3DM3A 1SFOH 4JYAQ 4YY3Q 1YI2A 1EWIA 3B6YA 4JI8Q 1C7YA 1EFWA 3KOJA 2ALYB 5H1SE 3HOYH 3AEVA 3GTOH 2R7ZH 4A4IA 4DR2Q 1NJIC 2I5MX 2ZTEA 1C9OA 2AHOB 4K0KL 4X66L 4B3TL 3TQYA 2VQFL 1QUQB 4BXXH 1Y1VH 1NMFA 4IPHA 4A3EH 4BBSG 1I6HH 1YNXA 4A3LG 1SN8A 3ER0A 1VQOA 4TQUS 4BBRH 4DV2L 1Q86C 4LFCL 5IY0A 3CP0A 3RN2A 4YWKA 2Z6KC 4JC0A 3S15H 3HKSA 3HOYG 4R4IA 1TXYA 2R7ZG 2AKWB 3K80C 3M4PA 5IYCH 1M1KC 4KLKA 1N33Q 2JA8H 4BXXG 4GKKQ 4JI3Q 1L2FA 2Z6KA 3OYYA 1Q7YC 2RHSB 4UP8A 2K50A 1OTCA 1YITA 3BZKA 3UE0A 3BU2A 4O2DA 3U58A 4UP9A 1XJVA 1VQDA 1Y1VG 2AWNA 2WP8J 3LGJA 4X62Q 3CCQA 4A3EG 3CC2A 3KJOA 4GKJQ 1RIPA 3AFPA 4NXNQ 1QZHA 5IWAL 1JMCA 1LYLA 4LFBL 2N49A 4BBRG 1K73C 1GVPA 1YHQA 4IFDG 4JOIC 3PO2H 3NBHB 1C0AA 1EQRA 1EUJA 4R1JA 5IYBG 4DV7L 2F3IA 2OTLA 4LF4L 2CCZA 3RR5A 2HIXA 5DLQE 2JA8G 4JOIA 4LFAQ 2I5HA 4LF8Q 1EOVA 1V43A 3GTMH 2LXJA 2Q2UA 4IJLA 2L15A 2LXKA 4IPCA 1HR0Q 2WAQG 3J81j 1PH9A 4L5TA 1XTDA 2MFIA 4DV3L 4LF7L 4HIOA 3OW2A 4GLAC 4JBJA 2OCEA 3PIPA 3PO2G 4DAMA 4HIMA 1Q81C 1X55A 2JJQA 4IFDI 2R93H 3PUZA 1XNQL 1E22A 3RZOH 1VQGA 4Y52H 1HJPA 3H0GG 4DR4L 1UE6A 4DUYQ 3K81C 2ES2A 1VCIA 5LMNW 1PH3A 1VQBA 1HH2P 2K4KA 3KF6B 4DV6Q 3CCRA 4KHPQ 3S16H 1KXLA 2MO1A 4JG2A 4P73A 4JI8L 4A3MH 5JJKA 4DK3C 4NPSA 4HIKA 2JA5H 4DR2L 1Y14B 5JEAJ 4OWWB 3GTKH 2KENA 2BA1A 1YZ6A 1P16A 2ZTDA 1MIUA 2D0PA 4AYBG 4A3FH 1IXRA 2NZHA 1Q8KA 1RL2A 5M5YH 3HKZE 2JK8A 4DUZQ 4DR1Q 3CC4A 4BA2I 4A93H 1D7QA 2PQAB 3AQQA 2IHEA 3BZCA 4IOCA 3CF5A 1XPUA 3M7NA 4JI2Q 1HZCA 2VZAA 2NVQH 4B3SQ 2D0OA 3GTLH 1Q46A 1K0RA 2VUMG 3ULLA 5M3FH 2JA7H 1I50H 4IPGA 2MQHA 2OQ0A 5GAEC 2JA5G 5JJIA 2WFWA 1WI5A 1JB7A 3E0EA 1N33L 4GKKL 1R9TH 4JI3L 2ASBA 4OX9L 2K5NA 3S1NH 2EIFA 1YJNA 1X54A 5HGQA 2R92H 2ZJRA 3KJPA 1V9PA 3L0OA 4X62L 3CC7A 4LUOA 2QEXA 4GKJL 4JI1Q 4DV0Q 3I7FA 4MNOA 4IO9A 1XNRQ 1BKBA 4NXNL 3L7ZC 3D31A 1N36Q 4ALPA 2CQOA 3T1YQ 3I4NH 2BA0A 1TWAH 1B7YB 1NTGA 3G48A 4YWMA 5M3FG 2JA7G 1WJJA 1KRSA 1E7ZA 2K5VA 3U50C 5M5XH 2E2IH 3H3VH 2R7DA 3HOVH 3PSIA 3RLFA 2YV5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF6 L;  4LFA L;  1Q1E A;  4LF8 L;  4BY1 H;  2R92 G;  4UPA A;  5FJ8 H;  1AE3 A;  1PYB A;  4LWC A;  2I0Q A;  1VQH A;  1PVO A;  4UP7 A;  1JJC B;  1HR0 L;  5LMU Q;  1O7I A;  1CSQ A;  1XMO Q;  4RMF A;  1VQE A;  4DNI A;  1YBY A;  3CAM A;  3TRE A;  4P71 A;  1HZB A;  5IP7 H;  4JI5 Q;  4LF5 Q;  3HOZ H;  4TVA B;  1I94 Q;  1HNW L;  1TWH H;  3FP9 A;  4GN3 B;  4P72 A;  5IT9 c;  4HID A;  4LNQ A;  4UY8 C;  2WB1 G;  2F52 A;  3JAM i;  2Q2I A;  1Z47 A;  2PI2 E;  4OON A;  2UUB Q;  4C3H H;  4GN5 A;  4DV4 Q;  4XTC S;  2Y0S E;  4BY1 G;  4JI6 Q;  5FJ8 G;  4DUY L;  4Y7N H;  3FHW A;  5C44 G;  1NBW A;  1DGS A;  3M4Q A;  2ZJP A;  4BY7 H;  3UDX A;  4DV6 L;  4JI0 Q;  3D0F A;  4KHP L;  4DV5 Q;  1YJW A;  1QVG A;  1OXX K;  1PA6 A;  2UUC Q;  2I5L X;  1HNX L;  3M9B A;  5IP9 G;  5FLM H;  4A3J G;  1M90 C;  2ZJQ A;  4DPG A;  1K9M C;  1L1O C;  3UDG A;  5IP7 G;  4JI7 Q;  3CQZ H;  1IL2 A;  1FGU A;  1XPO A;  1ASZ A;  4DR1 L;  2NZO A;  1N34 Q;  3TRZ A;  1L1O A;  4DUZ L;  4L5Q A;  4JV5 Q;  3MXN B;  3H3V I;  1BBU A;  3ULJ A;  4IJH A;  2OTJ A;  1TWG H;  5IYD H;  2R7F A;  1BBW A;  2HHH Q;  1ASY A;  3ERS X;  4R4T A;  4BY7 G;  2N78 A;  4DR5 Q;  3F8T A;  4B3S L;  4MZ9 A;  5C3E H;  3KFU A;  1PH2 A;  5K36 G;  1H95 A;  4B3R Q;  4P74 A;  5AJ3 Q;  5FLM G;  1K8A C;  1D8L A;  1I5F A;  4NXM Q;  4L5S A;  5BR8 Q;  1LUZ A;  1NE3 A;  4OO1 G;  5LMN Q;  2E5L Q;  1JJG A;  4KI0 A;  1IBL Q;  5IYC G;  4DV1 Q;  2GVA A;  1PFS A;  4GOP C;  2YTX A;  1U5K A;  4A3C H;  2NVY H;  2ZTC A;  5IYD G;  4JI1 L;  3E9I A;  3JC6 6;  3J7Z C;  4JI4 Q;  1VQP A;  3RZD H;  1JJ2 A;  4GOP A;  4JCV E;  1N36 L;  4IFD J;  3F1Z A;  4B3M L;  3T1Y L;  4QIW E;  4DR7 Q;  3KYH C;  1G51 A;  2OQK A;  3RNU A;  5M3M H;  2RHQ B;  2FXQ A;  1HZ9 A;  3K0X A;  1OXV A;  2IX0 A;  1IBK Q;  2N8N A;  2NN6 G;  2UXC Q;  4EX5 A;  1SRU A;  2Q2T A;  1JE5 A;  4KHZ A;  4A3G H;  4OO1 I;  3NEM A;  2F4V Q;  1SRO A;  1X6O A;  1TWC H;  3G6E A;  4R4Q A;  1E1T A;  4J15 A;  4IPD A;  3EBE A;  2HT1 A;  3CMA A;  4JI5 L;  4LF5 L;  4DR6 Q;  4YY3 L;  1I3Q H;  4JYA L;  2BH8 A;  1I94 L;  1PH1 A;  2UU9 Q;  4YCV A;  1VQ4 A;  2DGY A;  3HKZ G;  4OWT B;  3STB C;  3HOU H;  1WYD A;  4QL5 A;  4DV4 L;  3K8A A;  3CPW A;  2XGT A;  4A3G G;  5EAY A;  2GN5 A;  1OXS C;  2EXD A;  2NN6 I;  3HFZ B;  2OWO A;  4JI0 L;  1B70 B;  2D62 A;  4X64 Q;  3H15 A;  1PH8 A;  3J7A 5;  1S3O A;  4DV5 L;  1MKH A;  2E2J H;  4B3T Q;  2VQF Q;  1TWF H;  4BA1 I;  3PUY A;  2ZM6 Q;  1SLJ A;  3HOW H;  4JI7 L;  2GVB A;  4A3M G;  2YYZ A;  3CD6 A;  3KDF A;  3U4Z A;  2KHI A;  1W3S A;  2MNA A;  4YCW A;  2R6G A;  1N34 L;  1A8V A;  3ZJY C;  1NMG A;  4P75 A;  4AIM A;  1KD1 C;  1HNZ Q;  3HOU G;  4JV5 L;  1GD7 A;  1YIJ A;  4A3F G;  1CKN B;  1QZG A;  2XTI A;  1Y1W H;  2HHH L;  1QVF A;  2Q2H A;  3J80 i;  4DR5 L;  1HR0 W;  1VS0 A;  1VQI A;  1PH6 A;  2ATW A;  4A93 G;  4B3R L;  1U0L A;  3JAM c;  1PH5 A;  3KF6 A;  5AJ3 L;  3M3Y H;  4NXM L;  5C4X H;  5BR8 L;  2JA6 H;  3HOW G;  2KCM A;  1KL9 A;  2E5L L;  3SGI A;  4DKA C;  4X6A H;  3AYH B;  3F2D A;  1IBL L;  2VY3 A;  4DV1 L;  4HJ7 A;  2VW9 A;  1E1O A;  3W5O A;  2VL6 A;  1VQ7 A;  4HJA A;  2Z0S A;  3FKI H;  3M85 A;  5JJL A;  3RLO A;  3J81 i;  2KBN A;  5C4J H;  3GDE A;  4DV7 Q;  4DR7 L;  1X9N A;  2RF4 A;  3EN2 A;  2IY5 B;  1GM5 A;  1CUK A;  2V1C C;  3TS0 A;  4A3K H;  3I4N G;  4OWX B;  1K83 H;  4A75 A;  1QVC A;  3A5Z B;  4POF A;  2JA6 G;  2K14 A;  1IBK L;  1UE1 A;  2HIV A;  3CXC A;  3CME A;  5ELN A;  4A3D H;  1JT8 A;  2Y0S G;  1A62 A;  4X65 Q;  3HOX H;  3HOV G;  4LW1 A;  2UXD Q;  4C3J H;  3GO5 A;  2IX1 A;  1VQF A;  2CKZ B;  4LUV A;  2CFM A;  3STB D;  1EIY B;  4GN4 B;  2UUA Q;  2A8V A;  4YWL A;  2F4V L;  1L1O B;  1OXU A;  1UEB A;  3WWV A;  1VQN A;  3S1Q H;  4JBW A;  5GRO A;  2JQO A;  4GNX C;  1AH9 A;  1SR3 A;  3CCV A;  4DR6 L;  2YTY A;  4A3L H;  4A76 A;  2VQE Q;  1IBM Q;  3RLN A;  4DR4 Q;  2UU9 L;  2NVX H;  2DUD A;  1WCM H;  3EIV A;  4C2M H;  4GNX A;  4GLX A;  4A3B H;  3HOZ G;  5HY6 A;  3M4O H;  4JI6 L;  2BH2 A;  4A3D G;  3IRB A;  1VQJ A;  3HOX G;  1G6P A;  4JBK A;  4YCU A;  4DAY B;  5C0X I;  1BVS A;  4X64 L;  4O0A A;  3GTP H;  5GQO A;  4JI2 L;  1XMQ Q;  1K3R A;  1NY4 A;  4APV A;  1VQ6 A;  1Q1B A;  2WB1 E;  4YHH Q;  2ZM6 L;  1W2B A;  1SE8 A;  4GOP B;  2AWO A;  2JA9 A;  4DR3 Q;  1J6Q A;  4POG A;  4EQ5 A;  2VNU D;  1WCM G;  1MJE A;  5ELO A;  1HNZ L;  5FLX c;  4A3B G;  2JEB I;  2AMC B;  1EYG A;  3W1B A;  1PV4 A;  1FJG Q;  1YHA A;  2KHJ A;  5IYB H;  3OTO Q;  1Q82 C;  1QUQ A;  1AE2 A;  3PUV A;  4DV0 L;  2PMZ E;  1XNR L;  1GKH A;  4ME3 A;  1UE5 A;  1MJC A;  4GS3 A;  3U4V A;  1XPR A;  1J5E Q;  4OX9 Q;  3TS2 A;  1LTL A;  4R4O A;  1FVI A;  2UXB Q;  5C3E G;  2K52 A;  3TEH B;  3I55 A;  1P8L A;  1X3F A;  3A74 A;  2VS1 A;  2A1A A;  3UE1 A;  1PYS B;  1N9W A;  3CCS A;  1CKO A;  4NB3 A;  4QQB X;  3CCM A;  4PZ7 A;  3CCL A;  3KF8 B;  1X3E A;  4PZ6 A;  3T1H Q;  4WJ4 A;  1A63 A;  4A3I H;  1CSP A;  1VQ5 A;  1G29 1;  4A3C G;  1VQC A;  2HQL A;  3I4M H;  5LMU L;  4LF6 Q;  1VQA A;  2QA4 A;  3S2D H;  1FL0 A;  1WFQ A;  3H0G H;  4AH6 A;  1XMO L;  1Z9F A;  1PHJ A;  3ICE A;  3K7A H;  3A5U A;  3L2P A;  4HJ5 A;  1EQQ A;  1KC8 C;  4WJ3 M;  5M3M G;  3J80 c;  4X65 L;  4LF9 Q;  3G71 A;  4AQY Q;  1SMX A;  2UXD L;  2K5H A;  2CWA A;  1LM0 A;  2IT1 A;  2B29 A;  3KDF B;  3NEL A;  2YTV A;  4PZ8 A;  2UUA L;  2WAQ E;  2UUB L;  2R93 G;  2EQS A;  1YHB A;  4A3I G;  1HNW Q;  3PUX A;  1V1Q A;  4L5R C;  3I4M G;  5GAD C;  1X3G A;  3DLL A;  1KQS A;  4X66 Q;  2UUC L;  4K0K Q;  2VQE L;  1IBM L;  3GTG H;  3I2Z A;  1EIF A;  2ID0 A;  3E9H A;  1YEZ A;  1A0I A;  5JEA G;  4JBM A;  4HJ8 A;  2MO0 A;  5GAH C;  5E7N A;  3CCU A;  3J81 c;  3PGZ A;  2VUM H;  1N32 L;  1WOC A;  1T9H A;  2JE6 I;  4IOA A;  1PH7 A;  2NVT H;  4GLV B;  4DV2 Q;  1HNX Q;  1E3P A;  3I4O A;  4LFC Q;  2YU9 H;  2JEA I;  3GD7 A;  3CCE A;  3PO3 H;  2QGQ A;  1GO3 E;  1XMQ L;  4QY7 A;  4FDB A;  3NEN A;  4YHH L;  2RCN A;  3S24 A;  3PV0 A;  1L0W A;  1KAW A;  3PIO A;  3GTQ H;  3KLW A;  2LSS A;  4AYB E;  4DR3 L;  2N3S A;  1N32 Q;  2H5X A;  3I56 A;  1KHI A;  1Q12 A;  1KIX A;  3K7U C;  5LMN L;  3S1R H;  1VQL A;  4LUZ A;  5M5W H;  2CWP A;  3F2B A;  2B63 H;  1IZ6 A;  2B3G A;  5IWA Q;  1N8R C;  4LFB Q;  2PNH A;  2K75 A;  1FJG L;  3OTO L;  3BJU A;  1YJ9 A;  2A19 A;  3PO3 G;  4JI4 L;  4C3I H;  1J5E L;  1Y1W G;  3G4S A;  3ULP A;  2PQA A;  3MEF A;  2UXB L;  4LF4 Q;  4PG3 A;  2E8G A;  4QJF A;  1IYJ B;  1K8G A;  2IHF A;  4MTN A;  3PF4 A;  3VDY A;  1YVC A;  5C4X G;  1UE7 A;  3PF5 A;  1OXT A;  4B3M Q;  5C0X G;  3AFQ A;  3W1G A;  1VQK A;  2B63 G;  3T1H L;  3UDI A;  4HJ9 A;  2UXC L;  1X65 A;  4DV3 Q;  4GNX B;  1VQM A;  2E2H H;  4LF7 Q;  3S17 H;  3S1M H;  3PUW A;  3CW2 C;  1CKN A;  1S72 A;  1KRT A;  1CKM A;  3Q8D A;  3UDF A;  3PCO B;  1B8A A;  4QGU A;  1PH4 A;  3FKI G;  3S2H H;  4DK6 C;  3CPF A;  1UWV A;  4H02 A;  5C0X J;  1S40 A;  5C44 H;  2PI2 A;  1XNQ Q;  3S14 H;  4BBS H;  4PMW A;  4R4C A;  1X56 A;  4OXP A;  4RG1 A;  2C35 B;  1HZA A;  5IE8 A;  4A3K G;  3A0J A;  4AQY L;  4LF9 L;  1E24 A;  5GAG C;  2KCT A;  3CCJ A;  3F2C A;  5IP9 H;  4XIG S;  4A3J H;  3GTJ H;  1VQ8 A;  1VQ9 A;  3RN5 A;  5J3B A;  3DM3 A;  1SFO H;  4JYA Q;  4YY3 Q;  1YI2 A;  1EWI A;  3B6Y A;  4JI8 Q;  1C7Y A;  1EFW A;  3KOJ A;  2ALY B;  5H1S E;  3HOY H;  3AEV A;  3GTO H;  2R7Z H;  4A4I A;  4DR2 Q;  1NJI C;  2I5M X;  2ZTE A;  1C9O A;  2AHO B;  4K0K L;  4X66 L;  4B3T L;  3TQY A;  2VQF L;  1QUQ B;  4BXX H;  1Y1V H;  1NMF A;  4IPH A;  4A3E H;  4BBS G;  1I6H H;  1YNX A;  4A3L G;  1SN8 A;  3ER0 A;  1VQO A;  4TQU S;  4BBR H;  4DV2 L;  1Q86 C;  4LFC L;  5IY0 A;  3CP0 A;  3RN2 A;  4YWK A;  2Z6K C;  4JC0 A;  3S15 H;  3HKS A;  3HOY G;  4R4I A;  1TXY A;  2R7Z G;  2AKW B;  3K80 C;  3M4P A;  5IYC H;  1M1K C;  4KLK A;  1N33 Q;  2JA8 H;  4BXX G;  4GKK Q;  4JI3 Q;  1L2F A;  2Z6K A;  3OYY A;  1Q7Y C;  2RHS B;  4UP8 A;  2K50 A;  1OTC A;  1YIT A;  3BZK A;  3UE0 A;  3BU2 A;  4O2D A;  3U58 A;  4UP9 A;  1XJV A;  1VQD A;  1Y1V G;  2AWN A;  2WP8 J;  3LGJ A;  4X62 Q;  3CCQ A;  4A3E G;  3CC2 A;  3KJO A;  4GKJ Q;  1RIP A;  3AFP A;  4NXN Q;  1QZH A;  5IWA L;  1JMC A;  1LYL A;  4LFB L;  2N49 A;  4BBR G;  1K73 C;  1GVP A;  1YHQ A;  4IFD G;  4JOI C;  3PO2 H;  3NBH B;  1C0A A;  1EQR A;  1EUJ A;  4R1J A;  5IYB G;  4DV7 L;  2F3I A;  2OTL A;  4LF4 L;  2CCZ A;  3RR5 A;  2HIX A;  5DLQ E;  2JA8 G;  4JOI A;  4LFA Q;  2I5H A;  4LF8 Q;  1EOV A;  1V43 A;  3GTM H;  2LXJ A;  2Q2U A;  4IJL A;  2L15 A;  2LXK A;  4IPC A;  1HR0 Q;  2WAQ G;  3J81 j;  1PH9 A;  4L5T A;  1XTD A;  2MFI A;  4DV3 L;  4LF7 L;  4HIO A;  3OW2 A;  4GLA C;  4JBJ A;  2OCE A;  3PIP A;  3PO2 G;  4DAM A;  4HIM A;  1Q81 C;  1X55 A;  2JJQ A;  4IFD I;  2R93 H;  3PUZ A;  1XNQ L;  1E22 A;  3RZO H;  1VQG A;  4Y52 H;  1HJP A;  3H0G G;  4DR4 L;  1UE6 A;  4DUY Q;  3K81 C;  2ES2 A;  1VCI A;  5LMN W;  1PH3 A;  1VQB A;  1HH2 P;  2K4K A;  3KF6 B;  4DV6 Q;  3CCR A;  4KHP Q;  3S16 H;  1KXL A;  2MO1 A;  4JG2 A;  4P73 A;  4JI8 L;  4A3M H;  5JJK A;  4DK3 C;  4NPS A;  4HIK A;  2JA5 H;  4DR2 L;  1Y14 B;  5JEA J;  4OWW B;  3GTK H;  2KEN A;  2BA1 A;  1YZ6 A;  1P16 A;  2ZTD A;  1MIU A;  2D0P A;  4AYB G;  4A3F H;  1IXR A;  2NZH A;  1Q8K A;  1RL2 A;  5M5Y H;  3HKZ E;  2JK8 A;  4DUZ Q;  4DR1 Q;  3CC4 A;  4BA2 I;  4A93 H;  1D7Q A;  2PQA B;  3AQQ A;  2IHE A;  3BZC A;  4IOC A;  3CF5 A;  1XPU A;  3M7N A;  4JI2 Q;  1HZC A;  2VZA A;  2NVQ H;  4B3S Q;  2D0O A;  3GTL H;  1Q46 A;  1K0R A;  2VUM G;  3ULL A;  5M3F H;  2JA7 H;  1I50 H;  4IPG A;  2MQH A;  2OQ0 A;  5GAE C;  2JA5 G;  5JJI A;  2WFW A;  1WI5 A;  1JB7 A;  3E0E A;  1N33 L;  4GKK L;  1R9T H;  4JI3 L;  2ASB A;  4OX9 L;  2K5N A;  3S1N H;  2EIF A;  1YJN A;  1X54 A;  5HGQ A;  2R92 H;  2ZJR A;  3KJP A;  1V9P A;  3L0O A;  4X62 L;  3CC7 A;  4LUO A;  2QEX A;  4GKJ L;  4JI1 Q;  4DV0 Q;  3I7F A;  4MNO A;  4IO9 A;  1XNR Q;  1BKB A;  4NXN L;  3L7Z C;  3D31 A;  1N36 Q;  4ALP A;  2CQO A;  3T1Y Q;  3I4N H;  2BA0 A;  1TWA H;  1B7Y B;  1NTG A;  3G48 A;  4YWM A;  5M3F G;  2JA7 G;  1WJJ A;  1KRS A;  1E7Z A;  2K5V A;  3U50 C;  5M5X H;  2E2I H;  3H3V H;  2R7D A;  3HOV H;  3PSI A;  3RLF A;  2YV5 A; 
#chains in the Genus database with same CATH topology
 5C4J B;  4LFA L;  1HQM C;  5CV5 A;  4IAL A;  2R92 G;  1PYB A;  1A6X A;  1PVO A;  4ILW A;  1TU2 B;  2R3Z A;  4EVO A;  1O7I A;  2QKI C;  3HOZ B;  1O7Y A;  1KLU D;  3OWE B;  3OW7 A;  1YBY A;  3CAM A;  2OEO A;  5DM6 3;  1HZB A;  3C3L A;  3HOZ H;  1HNW L;  3FP9 A;  3OOC A;  2Q2I A;  3S1Q B;  1B50 A;  2DJF C;  4OON A;  5JVG 3;  4GN5 A;  2RVL A;  2Y0S E;  4PQX A;  5C44 G;  1NBW A;  1DGS A;  3M4Q A;  2V4D A;  2WII B;  5COY A;  4KHP L;  1QVG A;  5FKA C;  5IP9 G;  5T1G A;  4RGN A;  4DPG A;  1F2Y A;  4OHJ A;  5KNC A;  1FGU A;  1ASZ A;  2O5I C;  1BOS A;  4JV5 Q;  5IYD H;  1BBU A;  3ULJ A;  5C3E B;  2Q8R E;  2HHH Q;  1ASY A;  1QNK A;  2A74 C;  2X69 A;  3F8T A;  4MZ9 A;  5C3E H;  3KFU A;  5K36 G;  1H9J A;  3O13 A;  4B9W A;  3A8J E;  2IX3 A;  1F9S A;  1D8L A;  5BR8 Q;  2CH4 W;  4M1U B;  1NE3 A;  1D2B A;  5CGK A;  1KTK A;  4DV1 Q;  2GVA A;  4GOP C;  2F0U A;  1ESF A;  2ZTC A;  5IYD G;  3J7Z C;  1JJ2 A;  5M3M B;  4GOP A;  4IFD J;  3T1Y L;  1PFB A;  1G2S A;  3RNU A;  4XYQ A;  5EGT A;  5M3M H;  1I4P A;  2IX0 A;  4B9X A;  4IUU A;  2UXC Q;  4EX5 A;  2Q2T A;  4KHZ A;  3R3O A;  3HG9 A;  5EPJ A;  4XQJ A;  4F87 A;  2L1B A;  3OSO A;  5JOB A;  1BCP C;  1WTQ A;  3G6E A;  2VB2 X;  2F0E A;  4G7Z C;  1E1T A;  2K33 A;  4ZYS A;  1MSG A;  2CH4 A;  2UU9 Q;  1VQ4 A;  1EL0 A;  1NCV A;  3NBH A;  1GUG A;  3KLS X;  1WYD A;  4QL5 A;  1VMP A;  1SNM A;  3K8A A;  5EAY A;  2NN6 I;  3HFZ B;  3FEW X;  1B70 B;  4X64 Q;  4QCL A;  1Q8I A;  2VQF Q;  4HCE A;  3PUY A;  5KRU A;  5LHY 1;  4CDD C;  5A35 A;  3CD6 A;  4A3M G;  4IUN A;  3PO3 B;  1DOM A;  1W3S A;  2LS0 1;  2R6G A;  2QEJ C;  4AIM A;  1NMG A;  1DD2 A;  1JR0 D;  4U67 3;  3J80 i;  4A93 G;  4ID6 A;  2ATW A;  1X32 A;  1PH6 A;  1U0L A;  3KF6 A;  2QIL A;  3V05 A;  4CDC C;  2NZ1 D;  1KL9 A;  3SGI A;  2K7V A;  3FKI B;  4DKA C;  1IBL L;  1QNU A;  4HJ7 A;  4C1N I;  3A8I E;  5IT9 L;  2K5D A;  2K04 A;  2Z0S A;  3FKI H;  3FDT A;  1U4L A;  3SR1 A;  1GM5 A;  2V1C C;  1K83 H;  3K57 A;  1J8I A;  2E2H B;  2XSC A;  2NTT A;  4POF A;  1IBK L;  1YNJ C;  4A3D H;  2SNS A;  3HOX H;  3HOV G;  4C3J H;  1JE4 A;  2IX1 A;  2CKZ B;  2UUA Q;  1EIY B;  3BG3 A;  3S14 B;  5BN3 A;  3DWQ A;  4ZUI A;  4YWL A;  2F4V L;  1L1O B;  1SMY D;  1TII D;  1O7Z A;  5ELD A;  4G7O C;  2NBF A;  2XVS A;  1SR3 A;  3CCV A;  2VQE Q;  2PMZ B;  3RLN A;  1WCM H;  4C2M H;  4A3B H;  4A3D G;  3IRB A;  3HOX G;  1G6P A;  4JBK A;  1SNQ A;  4C3J G;  1G2T A;  4LK1 C;  1KDA A;  4C3H G;  5EKI A;  1EY5 A;  5GQO A;  1XMQ Q;  1GUN A;  4APV A;  4BBR B;  1W2B A;  2AWO A;  2JA9 A;  2PQE A;  1J6Q A;  1LT3 D;  1HHV A;  4EQ5 A;  1D5M C;  1WCM G;  4A3B G;  1XXG A;  2EYM A;  3R93 A;  3F2U A;  3OTO Q;  3PUV A;  1AE2 A;  2PMZ E;  5CBA E;  4ME3 A;  1PRT D;  1MJC A;  3TS2 A;  4OX9 Q;  3I3C A;  1FVI A;  1RTN A;  1TY0 A;  2UXB Q;  2ZXO A;  1P8L A;  4ZLT F;  3UE1 A;  3PO2 B;  3CCS A;  2G5D A;  4NB3 A;  5CV9 A;  3CCL A;  1X3E A;  2I46 A;  3BYT B;  3MXU A;  4PZ6 A;  4WJ4 A;  3GTM B;  1B3Q A;  1DYQ A;  5LMU L;  2QA4 A;  4AH6 A;  3ICE A;  4CBV A;  3A5U A;  3LNN A;  1BBX C;  1STH A;  1SYB A;  3DEO A;  2J7Z A;  4LAA A;  4X65 L;  3U9S A;  4DAV A;  5ELC A;  3OMG A;  2UXD L;  1LM0 A;  2IT1 A;  2YTV A;  1PTO F;  1YHB A;  1HNW Q;  3R2T A;  3DEP A;  4NMZ A;  1A15 A;  1IBM L;  3I2Z A;  3SK8 A;  1CM9 A;  4K2K A;  2VUM B;  3AB9 A;  3H6M A;  4WRD A;  1SYC A;  3JAM L;  4ZKB B;  2EYO A;  5GAH C;  1A3U A;  2VUM H;  1T9H A;  1JOQ A;  4GLV B;  3GTK B;  1K3B C;  4DV2 Q;  1E3P A;  4LFC Q;  4E6I A;  3GD7 A;  2DNE A;  4CDF C;  4QY7 A;  5A2Q E;  2CQA A;  1S5B D;  3PV0 A;  3GTQ H;  2L5T A;  3KLW A;  3I70 A;  3FRP B;  3NE5 B;  5C0X H;  3S1R H;  5EBC A;  5CYU A;  4LUZ A;  5C3X A;  2RKS A;  2B63 H;  4LFB Q;  5IWA Q;  1RDP D;  4N9T A;  1YJ9 A;  4FO2 A;  4C3I H;  3OIQ A;  2PQA A;  3WDN A;  4PG3 A;  4LF4 Q;  1B2T A;  2KVM A;  2NTS A;  1K8G A;  1O78 A;  2IHF A;  1F9R A;  4FVM A;  4MTN A;  5IGD A;  3PF4 A;  4R8N A;  5C4X G;  5M5X B;  5C0X G;  1EOT A;  3ERQ A;  2B63 G;  1WD1 A;  1U9R A;  3S17 H;  1TT2 A;  4DK1 A;  1B8A A;  4C3I G;  3PIO 3;  1IHZ A;  4JW0 A;  3CPF A;  4H02 A;  1D5Z C;  4BBS H;  2CW0 D;  4OXP A;  2M2L A;  1EIH A;  5J3B A;  1Q90 A;  1YI2 A;  1EWI A;  4JI8 Q;  1FGB D;  5H1S E;  4A4I A;  4BY7 B;  2I5M X;  1C9O A;  4K0K L;  1LT4 D;  4B3T L;  1U4P A;  2VB3 X;  5E3F A;  2LY7 A;  1Y1V H;  1PFM A;  4IPH A;  4BBS G;  2A5H A;  1BXT A;  2Q8I B;  1SN8 A;  4FF2 A;  1VQO A;  3CQZ B;  3BVM A;  1LT5 D;  1CT1 D;  5CR3 A;  1LAB A;  4YWK A;  3K5L A;  1SAP A;  1MHW C;  3HKS A;  4I7Z C;  1H9R A;  4KY5 A;  1MGS A;  2AKW B;  5IYC H;  5JVH 3;  3BZD B;  3CRK C;  1N32 L;  3TZU A;  4O2D A;  3U58 A;  1VQD A;  1Y1V G;  3CCQ A;  3CC2 A;  2BDO A;  1HUM A;  1QZH A;  1GVP A;  2F0S A;  1WVL A;  2M00 A;  4JOI C;  4DFA A;  2NVY B;  1IW7 C;  3NBH B;  3V2T A;  4TRD A;  1EUJ A;  4R1J A;  2A69 D;  2F3I A;  3LX0 A;  3MWY W;  3MA2 B;  4JOI A;  1FD7 D;  3BDL A;  2E75 C;  1GUT A;  2PW5 A;  4IPC A;  1PTO D;  2WAQ G;  1XTD A;  1S5E D;  3N6R A;  1U4R A;  1HTL D;  3J81 L;  3OW2 A;  5ELE A;  1MSH A;  2D5D A;  2JJQ A;  1QWY A;  2I07 B;  1QCB D;  1VQG A;  1J9O A;  2B2V C;  3D3R A;  3E6Z X;  2PZU A;  2HQE A;  4DR4 L;  1UE6 A;  4K8I A;  3K81 C;  5L37 A;  2F0T A;  1PH3 A;  4DV6 Q;  1HH2 P;  3KF6 B;  3CCR A;  5NUC A;  5KEE A;  3HP3 A;  3A7L A;  4B08 A;  1IYV A;  1MD2 D;  4PMC A;  1AEX A;  2BA1 A;  1PH1 A;  2NZH A;  3P75 A;  2JK8 A;  3A55 A;  2H1E A;  2RDH A;  1D7Q A;  1IL8 A;  2IHE A;  1XPU A;  1YNN D;  2EYJ A;  2VZA A;  1Z7T A;  4WOR A;  3PIP 3;  5M3F H;  2QW7 A;  3S1N B;  5GAE C;  4WFN 3;  5JJI A;  1Y1W B;  2WFW A;  2RSO A;  3NTH A;  3S1N H;  1YJN A;  3TME A;  4X62 L;  4LUO A;  3I4N B;  4JI1 Q;  3DUZ A;  4MNO A;  2JA6 B;  3L7Z C;  1N36 Q;  1ILP A;  1EU4 A;  3KLR A;  3I4N H;  2BA0 A;  1TWA H;  5I6Y A;  4YWM A;  5M3F G;  1Y8N B;  1WJJ A;  1KRS A;  2RA4 A;  4L63 B;  1U4M A;  2E2I H;  4UPA A;  3RLF A;  1PRT C;  1Q1E A;  5J39 A;  4BY1 H;  1KNE A;  5FJ8 H;  2F0J A;  4RGO S;  4UP7 A;  5LMU Q;  2AQ2 B;  1CSQ A;  5IT9 E;  4DNI A;  4ZUJ A;  3TRE A;  2F0D A;  4P71 A;  4JI5 Q;  2K05 A;  1SYG A;  3BVZ A;  4LNQ A;  2WB1 G;  1PMR A;  1Z47 A;  4DN4 M;  2RDG A;  1I4H A;  4BY1 G;  4R9W A;  2MP1 A;  5I9P A;  5FJ8 G;  4Y7N H;  4DUY L;  3T13 A;  2NVX B;  1XX8 A;  1PA6 A;  2QCP X;  1HNX L;  3PMF A;  3M9B A;  1IKL A;  3K6O A;  1L1O C;  1VF7 A;  3CU7 A;  5JAV A;  3UDG A;  4OO1 H;  1HRJ A;  1XPO A;  3MTS A;  3GTP B;  1M4V A;  4FP5 D;  2B8G A;  4DR1 L;  2NZO A;  3I4L A;  1N34 Q;  1L1O A;  4DUZ L;  4L5Q A;  3W2D A;  3VA7 A;  1D1I A;  3ERS X;  4R4T A;  4CKB A;  3TZD A;  4B3S L;  1GUS A;  1L0X B;  2HUG A;  2JP1 A;  5D65 A;  1K8A C;  1R4P B;  1I5F A;  3VR4 A;  1LUZ A;  4K8J A;  4OO1 G;  1HQR D;  1SNP A;  1TQO A;  1PFS A;  2YTX A;  1U5K A;  3GV6 A;  5ISR A;  4A3C H;  3E9I A;  3JC6 6;  4ZK9 B;  1BUV T;  3WOE A;  3RZD H;  1H9S B;  2RQX A;  3F1Z A;  2K01 A;  1RKN A;  3SDZ A;  3RMH A;  4KD3 A;  2FXQ A;  4OEM B;  4A3I B;  1RHP A;  1OXV A;  4I65 A;  3I4M B;  1SRU A;  1JE5 A;  1ET9 A;  2E2D C;  4A3G H;  2HD3 A;  3I91 A;  4K5V A;  4H13 C;  5K5P A;  3EBE A;  1S4Z A;  5A2Q L;  4LF5 L;  4DR6 Q;  4YY3 L;  4JYA L;  1I94 L;  1I4G A;  2EVB A;  1RTO A;  2DGY A;  2DY7 A;  3FPP A;  3STB C;  3HOU H;  5CV8 A;  4DV4 L;  4ODG A;  1LLR D;  4KKS A;  4A3G G;  2GN5 A;  2JXM B;  3FPU B;  3QJY A;  4JI0 L;  2D62 A;  3J7A 5;  4DV5 L;  2L12 A;  4B3T Q;  3IAY A;  1JCK B;  3K5O A;  2Z9H A;  2NVT B;  1DJR D;  2ZM6 Q;  2YU9 B;  4JI7 L;  2PPB C;  2YYZ A;  3U4Z A;  2KHI A;  2MNA A;  4YCW A;  1CI3 M;  3HOU G;  1KD1 C;  1HNZ Q;  3DWA A;  1GD7 A;  3JAM E;  1STE A;  4A3F G;  1ZYR D;  1RJT A;  1QVF A;  2Q2H A;  4DR5 L;  3MVV A;  3A56 A;  1WTO A;  3SXH A;  1SNO A;  4B3R L;  1F9Q A;  4H44 C;  5AJ3 L;  2PCF B;  4NXM L;  1C4Q A;  5FO8 B;  2KCM A;  5CMD A;  4F8M A;  2E5L L;  3AYH B;  3F2D A;  3OWF A;  2VY3 A;  2N55 A;  2VW9 A;  1O7L A;  2KA7 A;  2J4X A;  4J8Q A;  1H9M A;  4N8X 1;  5JJL A;  1CZW A;  4DR7 L;  2KBN A;  5C4J H;  1WTP A;  3EN2 A;  1JB3 A;  1OO9 B;  2RBM A;  3D4D A;  1ZXT A;  1CUK A;  2A6E C;  3TS0 A;  4A75 A;  1TS4 A;  1EFI D;  3K58 A;  2K14 A;  3TP8 A;  2HIV A;  3NP8 A;  3CME A;  2Y0S G;  4KN7 C;  4RWS C;  3S2H B;  4LW1 A;  1VQF A;  1LO5 D;  2A8V A;  1E0B A;  3M4Y A;  1OXU A;  3WWV A;  3S1Q H;  1HFG A;  4DR4 Q;  4K2L A;  2O5J C;  3EIV A;  2BE5 C;  3HOY B;  3HOZ G;  4RGT A;  4MN3 A;  2BH2 A;  1VQJ A;  4YCU A;  5C0X I;  1BVS A;  1NNX A;  1II3 A;  3OMC A;  4DNT B;  2KEC A;  5KIX A;  1VQ6 A;  1E2Z A;  3BS1 A;  4ZQ3 A;  3A8K E;  4POG A;  2VNU D;  4G57 A;  2B2Y C;  5ELB A;  1WTW A;  2JA8 B;  2KCN A;  2JEB I;  2KQ3 A;  1EY4 A;  2B2Y A;  1Q82 C;  1NUC A;  2F0M A;  4DV0 L;  5EKL A;  1XNR L;  1GKH A;  1UE5 A;  1J5E Q;  4GS3 A;  1YNN C;  1EYA A;  5C3E G;  2K52 A;  4H0L C;  3TEH B;  3I55 A;  4OGQ C;  4O42 A;  1X3F A;  5HGT A;  1PYS B;  4ZCK A;  1LT6 D;  1NAP A;  5FO9 B;  1G29 1;  2HQL A;  1B4O A;  3LWE A;  2XN9 C;  3DM1 A;  5KYI A;  1FL0 A;  1PHJ A;  2LFN A;  1XMO L;  1Z9F A;  3C1F A;  3L2P A;  5M3M G;  3QB3 A;  4AQY Q;  5I4D A;  3OPO A;  1SMX A;  1FNV A;  2IPK D;  3KDF B;  2B29 A;  3NEL A;  2R93 B;  2UUB L;  2DNC A;  4IN3 A;  2EQS A;  2X6L A;  1V1Q A;  1KAA A;  4KN4 C;  4L5R C;  1DZ1 A;  4KY7 A;  3J81 E;  1CFM A;  1X3G A;  2XWJ B;  1CA5 A;  2UUC L;  3E9H A;  1YEZ A;  1NR4 A;  3E3X A;  5LL6 S;  4HJ8 A;  2JA5 B;  5E4X A;  1Q3L A;  3T16 A;  2VXW A;  1DOL A;  1HNX Q;  3I4O A;  2AUK A;  3CCE A;  3PO3 H;  1GO3 E;  3S9W A;  1WD0 A;  3NUC A;  1LTT D;  4IQZ A;  4YHH L;  2RCN A;  2NVQ B;  1L0W A;  4NKL A;  3PIO A;  1PRT B;  2LSS A;  4DR3 L;  2N3S A;  1KHI A;  1I50 B;  3HGB A;  3ZYY X;  4DAP A;  1VQL A;  2B3G A;  1AP0 A;  3T51 B;  1FJG L;  3K5M A;  1HUN A;  3C2P A;  3PO3 G;  3G4S A;  2EYL A;  1SXT A;  5CV4 A;  1BF4 A;  3DXJ C;  3A7A B;  4ABN A;  1LTB D;  1YVC A;  1OXT A;  4ZKC B;  1VDZ A;  3HOV B;  1VMC A;  3T1H L;  1X65 A;  4GNX B;  2E2H H;  2B39 A;  4CKE A;  3PUW A;  3CW2 C;  1S72 A;  1CKM A;  2IL8 A;  5T1I A;  3PCO B;  3J7Y W;  3FKI G;  1SYD A;  5IGB A;  4V19 0;  1UWV A;  2JYO A;  5KND A;  1XNQ Q;  3S14 H;  1SJE D;  1JWS D;  4J1M A;  3QR8 A;  4RKL A;  4A3J B;  4R4C A;  1D6E C;  2XIW A;  4RG1 A;  5IE8 A;  4LF9 L;  1S5C D;  2K5Q A;  5GAG C;  3CCJ A;  1TWH B;  4A3J H;  1VQ8 A;  5FOB B;  3DM3 A;  4JYA Q;  4YY3 Q;  3B6Y A;  4HSP A;  2PO4 A;  5EQ0 A;  3KOJ A;  5FLX L;  2ALY B;  1C7Y A;  2WKD A;  4X3K A;  1IYU A;  2ZTE A;  4DGZ A;  4X66 L;  1I6H B;  1QUQ B;  4L6T B;  1R4Q B;  1NMF A;  1I6H H;  4K14 A;  1EIG A;  3ER0 A;  4BBR H;  5IY0 A;  1EWC A;  3MXG A;  2Z6K C;  2ENB A;  1JWM D;  1TXY A;  3N52 A;  3M4P A;  1M1K C;  2IJ0 A;  2MGS A;  2Z6K A;  2RHS B;  3BZK A;  4UP9 A;  3NWS A;  3IL8 A;  4GKJ Q;  3P20 A;  2QDL A;  3AFP A;  4K6L A;  4NXN Q;  1F2L A;  4BBR G;  4U68 A;  3J80 L;  4RCN A;  2EYP A;  1GUW A;  1EY7 A;  4DAY A;  3PO2 H;  2EYF A;  4F7X A;  1EQR A;  1ZYR C;  1CA6 A;  2IWH A;  1DON A;  4DV7 L;  2CCZ A;  2HIX A;  1AN8 A;  4LFA Q;  1AZP A;  2I5H A;  1EOV A;  3GTM H;  2LXJ A;  2Q2U A;  4CGY B;  2K1B A;  3WOF A;  3J81 j;  3HKZ B;  4M8A A;  2MFI A;  4DV3 L;  4LF7 L;  4HIO A;  2ICI A;  4OIJ A;  4GLA C;  5C3W A;  4JBJ A;  3PIP A;  3PO2 G;  4FXD A;  4HIM A;  1Q81 C;  1TWC B;  3I90 A;  4IFD I;  3D4W A;  4Y52 H;  1H9S A;  1ICW A;  3KLS A;  1AFP A;  1I3Q B;  2ES2 A;  2AQ1 B;  1ICF B;  4KHP Q;  2PYK A;  2B2W C;  3EA6 A;  4JG2 A;  4KTA A;  4HIK A;  2PZW A;  4DR2 L;  1RCV D;  1Y14 B;  1B9M A;  2B2W A;  1SBB B;  4OWW B;  3GTK H;  2KEN A;  4QQB X;  1YZ6 A;  1P16 A;  2ZTD A;  1EZ8 A;  1IXR A;  3HKZ E;  2EJG C;  2F1M A;  2BCO A;  3URY A;  3HOW B;  3CF5 A;  1I4R A;  2D0O A;  1K0R A;  2VUM G;  3K0Y A;  2MQH A;  2OQ0 A;  1EZ6 A;  1WI5 A;  1N33 L;  4GKK L;  4JI3 L;  3IKJ A;  2EIF A;  1V1P A;  4LJZ C;  5F2D A;  1V9P A;  3CC7 A;  3M3Y B;  2QEX A;  4DV0 Q;  3I7F A;  1XNR Q;  5C4X B;  1BKB A;  3TP6 A;  3T1Y Q;  2B2T C;  3MZ5 A;  1PTO B;  4QMG A;  4RHS A;  2K5V A;  1CTM A;  1CZG A;  5M5X H;  3T53 B;  4QB4 A;  3J7A F;  2PZT A;  3MC0 B;  2B2T A;  2YV5 A;  2RCF A;  4LF8 L;  4N8F A;  1AE3 A;  2BOS A;  1JJC B;  4XT3 B;  5EPL A;  1SDF A;  1SEB D;  1B53 A;  1HR0 L;  4G7H C;  1XMO Q;  1VQE A;  1WTV A;  1ET6 A;  1Z6H A;  5IP7 H;  4TVA B;  4P72 A;  1BCP F;  4GN3 B;  3FMC A;  5IT9 c;  2F0W A;  2F52 A;  4HMJ A;  5G3L F;  2UUB Q;  1ILQ A;  4OEL B;  3G6J B;  1DCZ A;  2F0F A;  3FHW A;  5COR A;  4BY7 H;  2ZJP A;  2WV6 D;  1YJW A;  4XDX A;  1SND A;  3KK7 A;  1OXX K;  2UUC Q;  3M4O B;  1EY0 A;  2EXZ A;  2I5L X;  4KY6 A;  5FLM H;  2ZJQ A;  1K9M C;  4HCS A;  5IP7 G;  4QIW B;  3CQZ H;  3R8B A;  1IL2 A;  1ONL A;  3TRZ A;  3H3V I;  2OTJ A;  2EYH A;  5DAU A;  2R7F A;  1AW7 A;  1G91 A;  3EFX D;  4BY7 G;  2N78 A;  1PYW D;  1PH2 A;  1H95 A;  5I9O A;  4P74 A;  5HUR A;  3R2I A;  5DEH A;  5FLM G;  1A3T A;  4L5S A;  1GHK A;  3X3N A;  4K5X A;  2NN6 H;  1IBL Q;  5IYC G;  2D2C C;  2NVY H;  3HS0 C;  2F0G A;  1VQP A;  2R61 A;  2LKV A;  4B3M L;  4QIW E;  3GP7 A;  3KYH C;  1G51 A;  2OT2 A;  3TBI B;  3Q23 A;  2TMP A;  2RHQ B;  5KGU A;  1HZ9 A;  3VYT A;  4LMQ D;  1IBK Q;  1VF5 C;  2N8N A;  2NN6 G;  3ERO A;  4Q0F A;  5CV7 A;  4XXE A;  1FNW A;  4FNF A;  3NEM A;  2F4V Q;  1X6O A;  1SSO A;  4RHR A;  3SEB A;  4IPD A;  1F2Z A;  2CHB D;  2BH8 A;  4YCV A;  4OL7 A;  2MPM A;  3GV3 A;  4OWT B;  4L8J A;  1QJO A;  1JIC A;  3D8G A;  3CRL C;  3BDO A;  5E4W C;  3RUZ A;  1SMY C;  2F4I A;  3CPW A;  3GTG B;  1TWF B;  2QDB A;  2OWO A;  3H15 A;  5J1Z A;  1MKH A;  2A6H D;  1TR5 A;  1TWF H;  4BA1 I;  3MFY A;  1SLJ A;  4CDE C;  3TP5 A;  3KDF A;  2XRS D;  1C8C A;  1K8M A;  1A8V A;  3ZJY C;  4JV5 L;  1RF2 D;  1YIJ A;  1F77 A;  1Y1W H;  2HHH L;  1C48 A;  3ND9 A;  1BR9 A;  3JAM c;  1PH5 A;  5M5W B;  1I6V C;  5IOD A;  3L3O C;  3K59 A;  5BR8 L;  2JA6 H;  2LMC B;  3KBX A;  1LAC A;  4X6A H;  4DV1 L;  1E1O A;  2VL6 A;  1VQ7 A;  1M8A A;  2NWG A;  1EWH A;  1V8Q A;  3IFD A;  1MBY A;  3NTK A;  3VR3 A;  4DV7 Q;  4A3K B;  4HMI A;  1V1O A;  4HSV A;  1BCP D;  1QG7 A;  1DOK A;  4A3K H;  3I4N G;  2EJF C;  2G9D A;  2JA6 G;  3S1M B;  5G3L D;  1UE1 A;  2WB1 B;  1PZJ D;  1JT8 A;  1A62 A;  4X65 Q;  1JWU D;  2UXD Q;  5I2Y A;  3MFG A;  2CFM A;  5E1F A;  4EQN A;  4BWG B;  3A54 A;  3ITP A;  2RSN A;  3GQB A;  4JBW A;  2JQO A;  1L0Y B;  2F0H A;  4GNX C;  3T4A C;  4A3L H;  1IBM Q;  1SFO B;  2UU9 L;  2NVX H;  1RD9 D;  2DUD A;  4GNX A;  3GTO B;  2R7Z B;  5HY6 A;  3VA5 A;  1Y8O B;  4QUC A;  4DAY B;  4X64 L;  3I72 A;  4O0A A;  4A3E B;  3GTP H;  1K3R A;  5FLX E;  2WB1 E;  1CK1 A;  3S15 B;  5IGF A;  3ND8 A;  3G7L A;  5ELO A;  4ME5 A;  3BYY B;  3VYU A;  3E0J A;  1F9P A;  2F0O A;  1EYG A;  5IYB H;  1QUQ A;  1AZQ A;  1XPR A;  4Q5V A;  4RCO A;  1HA5 A;  1KLG D;  2VS1 A;  2FFK B;  1KAB A;  1UEA B;  1XWE A;  4PZ7 A;  3KF8 B;  3RD4 A;  2X6G A;  1BO0 A;  1A63 A;  3H0G B;  4A3I H;  1VQ5 A;  3K7A B;  4A3C G;  4EGV A;  3I4M H;  4NW2 A;  1VQA A;  3J80 E;  1QIL A;  2ICE C;  3H0G H;  3QWN A;  2EY5 A;  3K7A H;  4TKO B;  4HJ5 A;  2EPB A;  2OF1 A;  2TSS A;  2NYZ D;  3G71 A;  4AYB B;  1TY2 A;  2UUA L;  3RZO B;  1CQF A;  3KUP A;  4A3I G;  3PUX A;  1V1P B;  2KOL A;  2DN8 A;  2C5C A;  3I4M G;  2CW0 C;  2F0N A;  5GAD C;  4K0K Q;  1KQS A;  2VQE L;  1O80 A;  2ID0 A;  3S16 B;  1A0I A;  4JBM A;  2MO0 A;  3NSW A;  2AQ3 B;  3L9A X;  3J81 c;  3PGZ A;  1WOC A;  1PZK D;  2JE6 I;  3D4R A;  1PH7 A;  2NVT H;  4IOA A;  4A3F B;  3EJI A;  2YU9 H;  1ML0 D;  2QGQ A;  5I6W A;  1JOK A;  3NWT A;  1XMQ L;  4FDB A;  3NEN A;  4FF1 A;  2HDM A;  3GTL B;  4AYB E;  1N32 Q;  2H5X A;  3I56 A;  2JA7 B;  1EEI D;  1KIX A;  2K03 A;  5LMN L;  1R9T B;  2CWP A;  2PNH A;  2K75 A;  2R92 B;  3OTO L;  3BJU A;  5IGC A;  1T5X D;  1EYD A;  4JI4 L;  1S5D D;  4IUT A;  3MAQ A;  3ULP A;  2UXB L;  2E8G A;  4QJF A;  1IYJ B;  4N9P A;  2C9O A;  2KCC A;  1UE7 A;  4B3M Q;  5EJW A;  3AFQ A;  1VQK A;  3UDI A;  2A69 C;  1CKN A;  3UDF A;  3Q8D A;  4QGU A;  5C44 B;  3S2H H;  4DK6 C;  1EQV A;  2GA4 B;  4KKU A;  1S40 A;  1LTA D;  5C44 H;  1PTO C;  4PMW A;  2A68 D;  2C35 B;  1HZA A;  2KCT A;  3V96 A;  3F2C A;  5IP9 H;  4XIG S;  1VQ9 A;  2Z4H A;  4I7A A;  3VR2 A;  4HR7 B;  1SE3 A;  3U9O A;  5EKK A;  1EFW A;  3HOY H;  1PDQ A;  4PNY A;  4BXX H;  3X3M A;  4X3T A;  4HTH A;  2MUY A;  5K36 H;  1PLF A;  2B8F A;  1Q86 C;  4DV2 L;  4LFC L;  1EQT A;  3CP0 A;  3RN2 A;  3NQI A;  1HA6 A;  1CHP D;  3HOY G;  4R4I A;  3K80 C;  2JA8 H;  2L4N A;  1L2F A;  2KUM A;  1Q7Y C;  2WIN B;  2A6H C;  2K50 A;  3NPP A;  5TSS A;  1OTC A;  1YIT A;  3UE0 A;  3BU2 A;  4BXX G;  4X62 Q;  2AWN A;  2KED A;  3KJO A;  2XNA C;  4LFB L;  5IWA L;  3LWU A;  3BVG A;  3Q24 A;  1YHQ A;  1WTH A;  3NTI A;  1C0A A;  1SE4 A;  2OTL A;  4LF4 L;  2JA8 G;  4WJW A;  1STB A;  1UNS A;  2L55 A;  2Z6B A;  1V43 A;  1KNA A;  2FMC A;  4X3S A;  1DXM A;  2L15 A;  2LXK A;  4ZRZ A;  1PH9 A;  4L5T A;  1PRT F;  4FXK C;  3AMU A;  3MXP A;  2EY1 A;  3P1H A;  1STA A;  3SK6 A;  3I73 A;  4MTK A;  2F03 A;  4RGM A;  4IUV A;  1STG A;  1SYE A;  1K0S A;  1FNU A;  2EOT A;  2R93 H;  3PUZ A;  3SVM A;  1E22 A;  3C46 A;  5JPM C;  4A3M B;  4DUY Q;  1VCI A;  4KMU C;  1KXL A;  4A3M H;  4JI8 L;  5JJK A;  4DK3 C;  2JA5 H;  1BDO A;  1WTR A;  4A93 B;  2EDG A;  2NUC A;  4KD4 A;  1Q8K A;  4DR1 Q;  3CC4 A;  5D3I B;  2R93 G;  4DUZ Q;  4A93 H;  1I4X A;  5C4Z A;  3BZC A;  2PW7 A;  2HCC A;  1HZC A;  2NVQ H;  5JPN C;  4B3S Q;  4HAE A;  1I50 H;  2JA5 G;  1JB7 A;  2DY8 A;  4KV6 A;  2NB0 A;  2E74 C;  5CC4 A;  2ASB A;  2K5N A;  2K32 A;  1IW7 D;  3KBG A;  2ZJR A;  3KJP A;  3SHL A;  5BN4 A;  2L11 A;  2BDN A;  3QOL A;  1STY A;  1BQQ T;  2CQO A;  3TN2 A;  4JPB W;  3EQL C;  3BDC A;  1NTG A;  3G48 A;  3U50 C;  1E7Z A;  1Y8P B;  5C4H A;  3HOV H;  2F0Q A;  4KJO A;  4LF6 L;  4UAI A;  4RKB A;  4EQO A;  5IGE A;  3K5N A;  1ESR A;  2MHV A;  4LWC A;  3QG1 A;  2I0Q A;  1VQH A;  1K83 B;  2WAC A;  3SK4 A;  2QF7 A;  4RMF A;  4A3D B;  3HOX B;  4RH6 A;  1EU3 A;  4C3J B;  2L0C A;  4NDX A;  4LF5 Q;  4C3H B;  1I94 Q;  1TWH H;  4HID A;  2HDL A;  4ULL A;  4UY8 C;  3JAM i;  2PI2 E;  4CJ1 B;  3I8Z A;  4C3H H;  4DV4 Q;  4XTC S;  2Z4I A;  3NXW A;  3UDX A;  4DV6 L;  4JI0 Q;  1WCM B;  4C2M B;  1I4Q A;  2H4O A;  3D0F A;  4DV5 Q;  4A3B B;  1JOO A;  4A3J G;  1M90 C;  4JI7 Q;  1TWG B;  2AUJ D;  5C5L A;  4PMB A;  4UDU C;  2ZT9 C;  3MXN B;  3VYR A;  4IJH A;  1TWG H;  5D14 A;  1BBW A;  4BS9 A;  2JN4 A;  1NSN S;  4DR5 Q;  1B1Z A;  3AU7 A;  4B3R Q;  3W3A A;  4CHT B;  5EBD A;  5AJ3 Q;  2CVR A;  3Q6S A;  4NXM Q;  5LMN Q;  4J6H A;  2E5L Q;  4FF4 A;  1JJG A;  1IKM A;  4KI0 A;  4QF4 A;  4JI1 L;  4IZ8 A;  4JI4 Q;  4JCV E;  1N36 L;  1XTC D;  5DNF A;  4DR7 Q;  2OQK A;  4UHV A;  3QO2 A;  5C6A A;  3K0X A;  2K6A A;  3OHX C;  1MI2 A;  4OO1 I;  1SRO A;  1TWC H;  3NBI A;  4R4Q A;  4J15 A;  2HT1 A;  3CMA A;  3T56 B;  4JI5 L;  1I3Q H;  4JVZ A;  1SJH D;  3KF8 A;  2SDF A;  3HKZ G;  1JOR A;  2F0P A;  2E2J B;  2XGT A;  1ENA A;  1OXS C;  2EXD A;  1NR2 A;  1PH8 A;  5C5M A;  2A68 C;  5I2X A;  1S3O A;  2E2J H;  4FXG C;  2Z8L A;  3HOW H;  2GVB A;  1HFN A;  4XQN A;  1N34 L;  4P75 A;  4IUR A;  3H09 A;  1CKN B;  1QZG A;  2XTI A;  4MHE A;  3GTQ B;  1D5X C;  1HR0 W;  3H91 A;  1VS0 A;  1VQI A;  1SYF A;  3S1R B;  2B63 B;  3M3Y H;  3ONA B;  5C4X H;  3HOW G;  1G8Z D;  4C3I B;  3W5O A;  1PTO H;  3VYS A;  1LTI D;  4HJA A;  2E76 C;  2F0V A;  3HEJ A;  3M85 A;  3RLO A;  3J81 i;  3GDE A;  1X9N A;  2RF4 A;  4DF7 A;  5IIF A;  2IY5 B;  2K28 A;  5KNB A;  3MEH A;  4OWX B;  3S17 B;  1QVC A;  1TS2 A;  3A5Z B;  3NQT A;  3IFT A;  3CXC A;  5ELN A;  4O1N A;  3D6W A;  1ROD A;  1X3Q A;  3GO5 A;  1X3P A;  3STB D;  4LUV A;  4C56 C;  4GN4 B;  1EY6 A;  1LTG D;  4BBS B;  3H3V C;  2O4X A;  1UEB A;  1VQN A;  3DWP A;  2ZXR A;  5GRO A;  2F3V A;  1AH9 A;  2ZXP A;  1UAP A;  1ENF A;  4DR6 L;  2YTY A;  4A76 A;  1CQV A;  4CJ0 B;  4ZAI A;  4FF3 A;  4GLX A;  4G4K A;  3M4O H;  4JI6 L;  3VR6 A;  4JK1 C;  2EZV A;  2K5W A;  1Y1V B;  3QIA A;  1EEF D;  4KHV A;  2XWB B;  2F3W A;  4JI2 L;  1NY4 A;  1Q1B A;  4YHH Q;  2ZM6 L;  2SNM A;  1SE8 A;  4GOP B;  4DA2 A;  4DR3 Q;  3TP7 A;  1Y69 U;  1MJE A;  3UI2 A;  1HNZ L;  5FLX c;  1CHQ D;  2XRQ D;  4MIU A;  2AMC B;  1ENC A;  2M9V A;  4HN7 A;  3W1B A;  1PV4 A;  1FJG Q;  1YHA A;  2KHJ A;  3NK9 A;  4S3S A;  2FHT A;  3U4V A;  4RA8 A;  2WAQ B;  1LTL A;  4R4O A;  3DMU A;  3A74 A;  2A1A A;  1HTP A;  2G9H D;  1STN A;  1N9W A;  4DNR B;  2A6E D;  1BCP B;  1CKO A;  2HCI A;  1QB5 D;  3CCM A;  3T1H Q;  3S2D B;  1CSP A;  4PV1 C;  1VQC A;  4LF6 Q;  3S2D H;  1WFQ A;  5JEA H;  4V0B A;  1EYC A;  3HRZ C;  1EQQ A;  1KC8 C;  4WJ3 M;  4GZY C;  2A73 B;  2Z1C A;  2IW3 A;  3J80 c;  4LF9 Q;  2EY2 A;  2K5H A;  2CWA A;  4PZ8 A;  2BE5 D;  5DM7 3;  2WAQ E;  4CKC A;  3Q22 A;  3QOJ A;  1K28 A;  3TDQ A;  1TS5 A;  3DLL A;  4X66 Q;  4DK0 A;  3GTG H;  2D9U A;  1EIF A;  2L9H A;  2N88 A;  5JEA G;  3C1E A;  1HPC A;  1GUO A;  5LL6 X;  3VR5 A;  2B2V A;  5E7N A;  5KYL A;  3CCU A;  2JEA I;  1TS3 A;  4K5W A;  3S24 A;  1KAW A;  1DM0 B;  5ELF A;  3DHQ A;  5M3F B;  1UUP A;  3J7A V;  1Q12 A;  3K7U C;  5M5W H;  2OXP A;  3F2B A;  1IZ6 A;  2KEE A;  1N8R C;  4KK7 A;  2DJG C;  4HED A;  5EPK A;  2A19 A;  1J5E L;  4DU9 A;  1Y1W G;  4DXG A;  4CJ2 C;  4Z9C B;  2O2L D;  3MEF A;  4TSS A;  1A2T A;  1W6J A;  1TWA B;  1T5E A;  1WTX A;  3VDY A;  4IUQ A;  5AFW A;  3PF5 A;  2E2I B;  2SOB A;  1W6K A;  3W1G A;  2EJM A;  2UXC L;  4HJ9 A;  1VQM A;  4DV3 Q;  4LF7 Q;  1H9K A;  3S1M H;  4BY1 B;  2Q8T A;  3TSS A;  1PH4 A;  1KRT A;  1A2U A;  4P2C B;  5C0X J;  2PNR C;  2PI2 A;  1E2W A;  2B2U C;  3P7J A;  3GTJ B;  1X56 A;  1B3A A;  1GJX A;  3D6C A;  4A3K G;  3A0J A;  4AQY L;  1E24 A;  3OIP A;  2B2U A;  2FMM A;  3GTJ H;  3RN5 A;  1LTS D;  1SFO H;  1JC7 A;  1K8O A;  3AEV A;  3GTO H;  2R7Z H;  4DR2 Q;  1NJI C;  4Y7N B;  3SE0 A;  1HCZ A;  1E2V A;  2AHO B;  3TQY A;  2VQF L;  4XYO A;  4DXF A;  5JJZ A;  1D1K A;  4A3E H;  1GOZ A;  1F2M A;  1YNX A;  4R8I A;  4A3L G;  4KJN A;  3M7G A;  2KHS A;  3Q0A A;  4TQU S;  1ZEQ X;  5D3D A;  1QE6 A;  4IFD H;  4JC0 A;  3S15 H;  1KDC A;  2R7Z G;  4GKK Q;  1N33 Q;  4KLK A;  1PXU A;  1ZKO A;  4IUP A;  4JI3 Q;  3OYY A;  4UP8 A;  4RAU C;  2EE1 A;  3M7N A;  1KDB A;  1XJV A;  1EY9 A;  1TVX A;  3LGJ A;  2WP8 J;  4A3E G;  1TKW B;  1HXY D;  1XYI A;  1RIP A;  1JMC A;  5IOC A;  1LYL A;  2N49 A;  1K73 C;  1B9N A;  1PFN A;  4IFD G;  3E5S A;  1SE2 A;  1GHJ A;  1YNJ D;  3MXN A;  5BN5 A;  5IYB G;  3RZD B;  1JQY D;  2FIN B;  2EY6 A;  4RFB A;  5DLQ E;  3RR5 A;  2J0T D;  2F0K A;  2KJX A;  4LF8 Q;  1EY8 A;  4IJL A;  1HR0 Q;  4X3U A;  3CHB D;  2SEB D;  1BNZ A;  4A3G B;  1GXD C;  2F0L A;  2OCE A;  2JSO A;  4DAM A;  3PQI A;  1X55 A;  4NP5 A;  4K6D A;  1XNQ L;  1S5F D;  3RZO H;  1HJP A;  3H0G G;  3SK5 A;  5CV6 A;  1B44 D;  5IGG A;  3CKI B;  2MJ8 A;  5LMN W;  1VQB A;  2K4K A;  3HOU B;  1LTR D;  3EVQ A;  3S16 H;  2MO1 A;  4P73 A;  4NPS A;  5M5Y B;  3H94 A;  5JEA J;  1PZI D;  4JI6 Q;  4A3F H;  2D0P A;  4AYB G;  1MIU A;  1FR3 A;  1RL2 A;  5M5Y H;  4BA2 I;  1LV9 A;  2WKC A;  5FK9 C;  5J22 A;  2PQA B;  3AQQ A;  2P5Z X;  3MHB A;  4H7B A;  4IOC A;  1FYC A;  1G6Z A;  4JI2 Q;  4FYD A;  3FVQ A;  2RDF A;  1A3V A;  3GTL H;  1Q46 A;  4QUF A;  3ULL A;  2JA7 H;  3HZX A;  3NHH A;  4IPG A;  5M9O A;  3E0E A;  1R9T H;  4XT1 B;  2FJ2 A;  4OX9 L;  1X54 A;  5HGQ A;  2R92 H;  3L0O A;  4EQP A;  4OIK A;  4GKJ L;  4IO9 A;  4NXN L;  5CBE E;  4F88 A;  1QOH A;  3D31 A;  5FO7 B;  2Y0S B;  4YIJ A;  4ALP A;  1B7Y B;  1SNC A;  4C1N K;  2F0I A;  2JA7 G;  4XQQ A;  3H3V H;  4KKT A;  2R7D A;  3PSI A; 
#chains in the Genus database with same CATH homology
 4LF6 L;  4LFA L;  1Q1E A;  4LF8 L;  4BY1 H;  2R92 G;  4UPA A;  5FJ8 H;  1AE3 A;  1PYB A;  4LWC A;  2I0Q A;  1VQH A;  1PVO A;  4UP7 A;  1JJC B;  1HR0 L;  5LMU Q;  1O7I A;  1CSQ A;  1XMO Q;  4RMF A;  1VQE A;  4DNI A;  1YBY A;  3CAM A;  3TRE A;  4P71 A;  1HZB A;  5IP7 H;  4JI5 Q;  4LF5 Q;  3HOZ H;  4TVA B;  1I94 Q;  1HNW L;  1TWH H;  3FP9 A;  4GN3 B;  4P72 A;  5IT9 c;  4HID A;  4LNQ A;  4UY8 C;  2WB1 G;  2F52 A;  3JAM i;  2Q2I A;  1Z47 A;  2PI2 E;  4OON A;  2UUB Q;  4C3H H;  4GN5 A;  4DV4 Q;  4XTC S;  2Y0S E;  4BY1 G;  4JI6 Q;  5FJ8 G;  4DUY L;  4Y7N H;  3FHW A;  5C44 G;  1NBW A;  1DGS A;  3M4Q A;  2ZJP A;  4BY7 H;  3UDX A;  4DV6 L;  4JI0 Q;  3D0F A;  4KHP L;  4DV5 Q;  1YJW A;  1QVG A;  1OXX K;  1PA6 A;  2UUC Q;  2I5L X;  1HNX L;  3M9B A;  5IP9 G;  5FLM H;  4A3J G;  1M90 C;  2ZJQ A;  4DPG A;  1K9M C;  1L1O C;  3UDG A;  5IP7 G;  4JI7 Q;  3CQZ H;  1IL2 A;  1FGU A;  1XPO A;  1ASZ A;  4DR1 L;  2NZO A;  1N34 Q;  3TRZ A;  1L1O A;  4DUZ L;  4L5Q A;  4JV5 Q;  3MXN B;  3H3V I;  1BBU A;  3ULJ A;  4IJH A;  2OTJ A;  1TWG H;  5IYD H;  2R7F A;  1BBW A;  2HHH Q;  1ASY A;  3ERS X;  4R4T A;  4BY7 G;  2N78 A;  4DR5 Q;  3F8T A;  4B3S L;  4MZ9 A;  5C3E H;  3KFU A;  1PH2 A;  5K36 G;  1H95 A;  4B3R Q;  4P74 A;  5AJ3 Q;  5FLM G;  1K8A C;  1D8L A;  1I5F A;  4NXM Q;  4L5S A;  5BR8 Q;  1LUZ A;  1NE3 A;  4OO1 G;  5LMN Q;  2E5L Q;  1JJG A;  4KI0 A;  1IBL Q;  5IYC G;  4DV1 Q;  2GVA A;  1PFS A;  4GOP C;  2YTX A;  1U5K A;  4A3C H;  2NVY H;  2ZTC A;  5IYD G;  4JI1 L;  3E9I A;  3JC6 6;  3J7Z C;  4JI4 Q;  1VQP A;  3RZD H;  1JJ2 A;  4GOP A;  4JCV E;  1N36 L;  4IFD J;  3F1Z A;  4B3M L;  3T1Y L;  4QIW E;  4DR7 Q;  3KYH C;  1G51 A;  2OQK A;  3RNU A;  5M3M H;  2RHQ B;  2FXQ A;  1HZ9 A;  3K0X A;  1OXV A;  2IX0 A;  1IBK Q;  2N8N A;  2NN6 G;  2UXC Q;  4EX5 A;  1SRU A;  2Q2T A;  1JE5 A;  4KHZ A;  4A3G H;  4OO1 I;  3NEM A;  2F4V Q;  1SRO A;  1X6O A;  1TWC H;  3G6E A;  4R4Q A;  1E1T A;  4J15 A;  4IPD A;  3EBE A;  2HT1 A;  3CMA A;  4JI5 L;  4LF5 L;  4DR6 Q;  4YY3 L;  1I3Q H;  4JYA L;  2BH8 A;  1I94 L;  1PH1 A;  2UU9 Q;  4YCV A;  1VQ4 A;  2DGY A;  3HKZ G;  4OWT B;  3STB C;  3HOU H;  1WYD A;  4QL5 A;  4DV4 L;  3K8A A;  3CPW A;  2XGT A;  4A3G G;  5EAY A;  2GN5 A;  1OXS C;  2EXD A;  2NN6 I;  3HFZ B;  2OWO A;  4JI0 L;  1B70 B;  2D62 A;  4X64 Q;  3H15 A;  1PH8 A;  3J7A 5;  1S3O A;  4DV5 L;  1MKH A;  2E2J H;  4B3T Q;  2VQF Q;  1TWF H;  4BA1 I;  3PUY A;  2ZM6 Q;  1SLJ A;  3HOW H;  4JI7 L;  2GVB A;  4A3M G;  2YYZ A;  3CD6 A;  3KDF A;  3U4Z A;  2KHI A;  1W3S A;  2MNA A;  4YCW A;  2R6G A;  1N34 L;  1A8V A;  3ZJY C;  1NMG A;  4P75 A;  4AIM A;  1KD1 C;  1HNZ Q;  3HOU G;  4JV5 L;  1GD7 A;  1YIJ A;  4A3F G;  1CKN B;  1QZG A;  2XTI A;  1Y1W H;  2HHH L;  1QVF A;  2Q2H A;  3J80 i;  4DR5 L;  1HR0 W;  1VS0 A;  1VQI A;  1PH6 A;  2ATW A;  4A93 G;  4B3R L;  1U0L A;  3JAM c;  1PH5 A;  3KF6 A;  5AJ3 L;  3M3Y H;  4NXM L;  5C4X H;  5BR8 L;  2JA6 H;  3HOW G;  2KCM A;  1KL9 A;  2E5L L;  3SGI A;  4DKA C;  4X6A H;  3AYH B;  3F2D A;  1IBL L;  2VY3 A;  4DV1 L;  4HJ7 A;  2VW9 A;  1E1O A;  3W5O A;  2VL6 A;  1VQ7 A;  4HJA A;  2Z0S A;  3FKI H;  3M85 A;  5JJL A;  3RLO A;  3J81 i;  2KBN A;  5C4J H;  3GDE A;  4DV7 Q;  4DR7 L;  1X9N A;  2RF4 A;  3EN2 A;  2IY5 B;  1GM5 A;  1CUK A;  2V1C C;  3TS0 A;  4A3K H;  3I4N G;  4OWX B;  1K83 H;  4A75 A;  1QVC A;  3A5Z B;  4POF A;  2JA6 G;  2K14 A;  1IBK L;  1UE1 A;  2HIV A;  3CXC A;  3CME A;  5ELN A;  4A3D H;  1JT8 A;  2Y0S G;  1A62 A;  4X65 Q;  3HOX H;  3HOV G;  4LW1 A;  2UXD Q;  4C3J H;  3GO5 A;  2IX1 A;  1VQF A;  2CKZ B;  4LUV A;  2CFM A;  3STB D;  1EIY B;  4GN4 B;  2UUA Q;  2A8V A;  4YWL A;  2F4V L;  1L1O B;  1OXU A;  1UEB A;  3WWV A;  1VQN A;  3S1Q H;  4JBW A;  5GRO A;  2JQO A;  4GNX C;  1AH9 A;  1SR3 A;  3CCV A;  4DR6 L;  2YTY A;  4A3L H;  4A76 A;  2VQE Q;  1IBM Q;  3RLN A;  4DR4 Q;  2UU9 L;  2NVX H;  2DUD A;  1WCM H;  3EIV A;  4C2M H;  4GNX A;  4GLX A;  4A3B H;  3HOZ G;  5HY6 A;  3M4O H;  4JI6 L;  2BH2 A;  4A3D G;  3IRB A;  1VQJ A;  3HOX G;  1G6P A;  4JBK A;  4YCU A;  4DAY B;  5C0X I;  1BVS A;  4X64 L;  4O0A A;  3GTP H;  5GQO A;  4JI2 L;  1XMQ Q;  1K3R A;  1NY4 A;  4APV A;  1VQ6 A;  1Q1B A;  2WB1 E;  4YHH Q;  2ZM6 L;  1W2B A;  1SE8 A;  4GOP B;  2AWO A;  2JA9 A;  4DR3 Q;  1J6Q A;  4POG A;  4EQ5 A;  2VNU D;  1WCM G;  1MJE A;  5ELO A;  1HNZ L;  5FLX c;  4A3B G;  2JEB I;  2AMC B;  1EYG A;  3W1B A;  1PV4 A;  1FJG Q;  1YHA A;  2KHJ A;  5IYB H;  3OTO Q;  1Q82 C;  1QUQ A;  1AE2 A;  3PUV A;  4DV0 L;  2PMZ E;  1XNR L;  1GKH A;  4ME3 A;  1UE5 A;  1MJC A;  4GS3 A;  3U4V A;  1XPR A;  1J5E Q;  4OX9 Q;  3TS2 A;  1LTL A;  4R4O A;  1FVI A;  2UXB Q;  5C3E G;  2K52 A;  3TEH B;  3I55 A;  1P8L A;  1X3F A;  3A74 A;  2VS1 A;  2A1A A;  3UE1 A;  1PYS B;  1N9W A;  3CCS A;  1CKO A;  4NB3 A;  4QQB X;  3CCM A;  4PZ7 A;  3CCL A;  3KF8 B;  1X3E A;  4PZ6 A;  3T1H Q;  4WJ4 A;  1A63 A;  4A3I H;  1CSP A;  1VQ5 A;  1G29 1;  4A3C G;  1VQC A;  2HQL A;  3I4M H;  5LMU L;  4LF6 Q;  1VQA A;  2QA4 A;  3S2D H;  1FL0 A;  1WFQ A;  3H0G H;  4AH6 A;  1XMO L;  1Z9F A;  1PHJ A;  3ICE A;  3K7A H;  3A5U A;  3L2P A;  4HJ5 A;  1EQQ A;  1KC8 C;  4WJ3 M;  5M3M G;  3J80 c;  4X65 L;  4LF9 Q;  3G71 A;  4AQY Q;  1SMX A;  2UXD L;  2K5H A;  2CWA A;  1LM0 A;  2IT1 A;  2B29 A;  3KDF B;  3NEL A;  2YTV A;  4PZ8 A;  2UUA L;  2WAQ E;  2UUB L;  2R93 G;  2EQS A;  1YHB A;  4A3I G;  1HNW Q;  3PUX A;  1V1Q A;  4L5R C;  3I4M G;  5GAD C;  1X3G A;  3DLL A;  1KQS A;  4X66 Q;  2UUC L;  4K0K Q;  2VQE L;  1IBM L;  3GTG H;  3I2Z A;  1EIF A;  2ID0 A;  3E9H A;  1YEZ A;  1A0I A;  5JEA G;  4JBM A;  4HJ8 A;  2MO0 A;  5GAH C;  5E7N A;  3CCU A;  3J81 c;  3PGZ A;  2VUM H;  1N32 L;  1WOC A;  1T9H A;  2JE6 I;  4IOA A;  1PH7 A;  2NVT H;  4GLV B;  4DV2 Q;  1HNX Q;  1E3P A;  3I4O A;  4LFC Q;  2YU9 H;  2JEA I;  3GD7 A;  3CCE A;  3PO3 H;  2QGQ A;  1GO3 E;  1XMQ L;  4QY7 A;  4FDB A;  3NEN A;  4YHH L;  2RCN A;  3S24 A;  3PV0 A;  1L0W A;  1KAW A;  3PIO A;  3GTQ H;  3KLW A;  2LSS A;  4AYB E;  4DR3 L;  2N3S A;  1N32 Q;  2H5X A;  3I56 A;  1KHI A;  1Q12 A;  1KIX A;  3K7U C;  5LMN L;  3S1R H;  1VQL A;  4LUZ A;  5M5W H;  2CWP A;  3F2B A;  2B63 H;  1IZ6 A;  2B3G A;  5IWA Q;  1N8R C;  4LFB Q;  2PNH A;  2K75 A;  1FJG L;  3OTO L;  3BJU A;  1YJ9 A;  2A19 A;  3PO3 G;  4JI4 L;  4C3I H;  1J5E L;  1Y1W G;  3G4S A;  3ULP A;  2PQA A;  3MEF A;  2UXB L;  4LF4 Q;  4PG3 A;  2E8G A;  4QJF A;  1IYJ B;  1K8G A;  2IHF A;  4MTN A;  3PF4 A;  3VDY A;  1YVC A;  5C4X G;  1UE7 A;  3PF5 A;  1OXT A;  4B3M Q;  5C0X G;  3AFQ A;  3W1G A;  1VQK A;  2B63 G;  3T1H L;  3UDI A;  4HJ9 A;  2UXC L;  1X65 A;  4DV3 Q;  4GNX B;  1VQM A;  2E2H H;  4LF7 Q;  3S17 H;  3S1M H;  3PUW A;  3CW2 C;  1CKN A;  1S72 A;  1KRT A;  1CKM A;  3Q8D A;  3UDF A;  3PCO B;  1B8A A;  4QGU A;  1PH4 A;  3FKI G;  3S2H H;  4DK6 C;  3CPF A;  1UWV A;  4H02 A;  5C0X J;  1S40 A;  5C44 H;  2PI2 A;  1XNQ Q;  3S14 H;  4BBS H;  4PMW A;  4R4C A;  1X56 A;  4OXP A;  4RG1 A;  2C35 B;  1HZA A;  5IE8 A;  4A3K G;  3A0J A;  4AQY L;  4LF9 L;  1E24 A;  5GAG C;  2KCT A;  3CCJ A;  3F2C A;  5IP9 H;  4XIG S;  4A3J H;  3GTJ H;  1VQ8 A;  1VQ9 A;  3RN5 A;  5J3B A;  3DM3 A;  1SFO H;  4JYA Q;  4YY3 Q;  1YI2 A;  1EWI A;  3B6Y A;  4JI8 Q;  1C7Y A;  1EFW A;  3KOJ A;  2ALY B;  5H1S E;  3HOY H;  3AEV A;  3GTO H;  2R7Z H;  4A4I A;  4DR2 Q;  1NJI C;  2I5M X;  2ZTE A;  1C9O A;  2AHO B;  4K0K L;  4X66 L;  4B3T L;  3TQY A;  2VQF L;  1QUQ B;  4BXX H;  1Y1V H;  1NMF A;  4IPH A;  4A3E H;  4BBS G;  1I6H H;  1YNX A;  4A3L G;  1SN8 A;  3ER0 A;  1VQO A;  4TQU S;  4BBR H;  4DV2 L;  1Q86 C;  4LFC L;  5IY0 A;  3CP0 A;  3RN2 A;  4YWK A;  2Z6K C;  4JC0 A;  3S15 H;  3HKS A;  3HOY G;  4R4I A;  1TXY A;  2R7Z G;  2AKW B;  3K80 C;  3M4P A;  5IYC H;  1M1K C;  4KLK A;  1N33 Q;  2JA8 H;  4BXX G;  4GKK Q;  4JI3 Q;  1L2F A;  2Z6K A;  3OYY A;  1Q7Y C;  2RHS B;  4UP8 A;  2K50 A;  1OTC A;  1YIT A;  3BZK A;  3UE0 A;  3BU2 A;  4O2D A;  3U58 A;  4UP9 A;  1XJV A;  1VQD A;  1Y1V G;  2AWN A;  2WP8 J;  3LGJ A;  4X62 Q;  3CCQ A;  4A3E G;  3CC2 A;  3KJO A;  4GKJ Q;  1RIP A;  3AFP A;  4NXN Q;  1QZH A;  5IWA L;  1JMC A;  1LYL A;  4LFB L;  2N49 A;  4BBR G;  1K73 C;  1GVP A;  1YHQ A;  4IFD G;  4JOI C;  3PO2 H;  3NBH B;  1C0A A;  1EQR A;  1EUJ A;  4R1J A;  5IYB G;  4DV7 L;  2F3I A;  2OTL A;  4LF4 L;  2CCZ A;  3RR5 A;  2HIX A;  5DLQ E;  2JA8 G;  4JOI A;  4LFA Q;  2I5H A;  4LF8 Q;  1EOV A;  1V43 A;  3GTM H;  2LXJ A;  2Q2U A;  4IJL A;  2L15 A;  2LXK A;  4IPC A;  1HR0 Q;  2WAQ G;  3J81 j;  1PH9 A;  4L5T A;  1XTD A;  2MFI A;  4DV3 L;  4LF7 L;  4HIO A;  3OW2 A;  4GLA C;  4JBJ A;  2OCE A;  3PIP A;  3PO2 G;  4DAM A;  4HIM A;  1Q81 C;  1X55 A;  2JJQ A;  4IFD I;  2R93 H;  3PUZ A;  1XNQ L;  1E22 A;  3RZO H;  1VQG A;  4Y52 H;  1HJP A;  3H0G G;  4DR4 L;  1UE6 A;  4DUY Q;  3K81 C;  2ES2 A;  1VCI A;  5LMN W;  1PH3 A;  1VQB A;  1HH2 P;  2K4K A;  3KF6 B;  4DV6 Q;  3CCR A;  4KHP Q;  3S16 H;  1KXL A;  2MO1 A;  4JG2 A;  4P73 A;  4JI8 L;  4A3M H;  5JJK A;  4DK3 C;  4NPS A;  4HIK A;  2JA5 H;  4DR2 L;  1Y14 B;  5JEA J;  4OWW B;  3GTK H;  2KEN A;  2BA1 A;  1YZ6 A;  1P16 A;  2ZTD A;  1MIU A;  2D0P A;  4AYB G;  4A3F H;  1IXR A;  2NZH A;  1Q8K A;  1RL2 A;  5M5Y H;  3HKZ E;  2JK8 A;  4DUZ Q;  4DR1 Q;  3CC4 A;  4BA2 I;  4A93 H;  1D7Q A;  2PQA B;  3AQQ A;  2IHE A;  3BZC A;  4IOC A;  3CF5 A;  1XPU A;  3M7N A;  4JI2 Q;  1HZC A;  2VZA A;  2NVQ H;  4B3S Q;  2D0O A;  3GTL H;  1Q46 A;  1K0R A;  2VUM G;  3ULL A;  5M3F H;  2JA7 H;  1I50 H;  4IPG A;  2MQH A;  2OQ0 A;  5GAE C;  2JA5 G;  5JJI A;  2WFW A;  1WI5 A;  1JB7 A;  3E0E A;  1N33 L;  4GKK L;  1R9T H;  4JI3 L;  2ASB A;  4OX9 L;  2K5N A;  3S1N H;  2EIF A;  1YJN A;  1X54 A;  5HGQ A;  2R92 H;  2ZJR A;  3KJP A;  1V9P A;  3L0O A;  4X62 L;  3CC7 A;  4LUO A;  2QEX A;  4GKJ L;  4JI1 Q;  4DV0 Q;  3I7F A;  4MNO A;  4IO9 A;  1XNR Q;  1BKB A;  4NXN L;  3L7Z C;  3D31 A;  1N36 Q;  4ALP A;  2CQO A;  3T1Y Q;  3I4N H;  2BA0 A;  1TWA H;  1B7Y B;  1NTG A;  3G48 A;  4YWM A;  5M3F G;  2JA7 G;  1WJJ A;  1KRS A;  1E7Z A;  2K5V A;  3U50 C;  5M5X H;  2E2I H;  3H3V H;  2R7D A;  3HOV H;  3PSI A;  3RLF A;  2YV5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...