1SLJA

Solution structure of the s1 domain of rnase e from e. coli
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
96
structure length
96
Chain Sequence
GSHMLEQKKANIYKGKITRIEPSLEAAFVDYGAERHGFLPLKEIAREYFPANYSAHGRPNIKDVLREGQEVIVQIDKEERGNKGAALTTFISLAGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease E
publication title Structural characterization of the RNase E S1 domain and identification of its oligonucleotide-binding and dimerization interfaces.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 15
structure length 96
sequence length 96
ec nomenclature ec 3.1.26.12: Ribonuclease E.
pdb deposition date 2004-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1sljA00
3CQZH 3A5UA 3L2PA 2R93H 3TQYA 5IYBH 1K73C 4PMWA 3E9IA 4LF6L 1HH2P 1I50H 1TWFH 2GVBA 4UPAA 4X66L 5LMUL 1EFWA 1VQKA 1JT8A 1HZAA 4A3DH 5GAGC 4JI1Q 2VQFQ 1K8AC 1H95A 3I55A 4LF9L 4A3IG 5M3FH 3E9HA 4DV7L 1IBLQ 4X64Q 5M3MG 1X56A 2RF4A 3JC66 4R4CA 4HIDA 3NEMA 3PO2G 4A3MG 4LUOA 4JI4L 4DR2L 1FJGL 3CCLA 5FLMG 4NXNQ 4O0AA 3CCEA 1U0LA 1J5EL 1KHIA 2IT1A 3M7NA 1JJCB 4DAMA 3I4NG 3PV0A 1O7IA 5IWAQ 2JA8H 2R6GA 1OXXK 2CFMA 4LF7Q 4LFAL 5C4XG 4JC0A 1N36L 2R7ZH 5IE8A 2UUAQ 4A3EH 1NBWA 2ZM6Q 3PUYA 1M90C 4BBSG 2Q2IA 3JAMi 3RZDH 2BA1A 4X65Q 3I7FA 2QA4A 5GADC 3K80C 4HIKA 1N8RC 4DK6C 4LFCQ 2CWPA 4TVAB 4DV5Q 3HOWG 1IL2A 3T1YQ 4HIOA 4A93H 2JJQA 2ALYB 3HOYH 3KLWA 3CC7A 2ZTEA 4JI6L 5M5YH 2NVYH 4GN4B 4JI7L 1XNQL 4DUYL 1CKNB 4OWXB 1MKHA 4LF5L 1LTLA 1KL9A 1SROA 3F8TA 1I6HH 4DR7Q 5K36G 5IP7G 1IXRA 4JI2Q 4L5QA 4QL5A 4DR5L 2ZTDA 4UP9A 4EX5A 4DR3L 2OTLA 3LGJA 4PZ7A 2K50A 1WYDA 2NN6G 1N32L 1V1QA 3J81j 1G51A 4GN5A 4P72A 4R4OA 4YCWA 2HHHQ 4L5RC 2R92G 2RHQB 1AE2A 4A3JG 1XMOQ 5C3EH 3HKZE 1VQ6A 1X54A 3WWVA 1IBKQ 4B3TL 3I56A 2KHIA 1PA6A 4GKJQ 5IYDH 3H3VH 2PQAB 3PIOA 1A0IA 2JA7G 4QGUA 2VQEL 4ALPA 4JV5Q 4DV6Q 1G6PA 4GLXA 1N33L 3U4VA 1DGSA 2HT1A 5LMNQ 2E5LL 4LF8Q 2UXDQ 3I2ZA 4YWLA 4LF4L 1VQ4A 2Q2TA 1UEBA 1L1OC 4A76A 1XNRL 1E22A 2I5HA 2Y0SE 4LUVA 3S14H 3CAMA 3S24A 1QZHA 1I5FA 2UUCL 4B3MQ 3HFZB 3HOVG 3MEFA 2OQ0A 4JYAQ 1X65A 5C4JH 1CKOA 1VS0A 2YTYA 3KJOA 1YITA 2Q2UA 3H0GH 1XPUA 1J6QA 3GTOH 3S1NH 3TS2A 3RLFA 4L5SA 4A3FG 4BXXH 1XPOA 4LUZA 1QUQA 3Q8DA 3K0XA 1WCMH 1PHJA 4RG1A 1E1TA 5AJ3Q 4BA2I 1ASYA 4OO1G 1Y1WG 4DR4L 3BZCA 4YWKA 4MNOA 4QIWE 3GTGH 4GKKL 1V9PA 4JI0Q 1HZCA 4JI5L 3UE0A 3CXCA 4LF6Q 4B3RQ 5BR8L 1HZ9A 3W5OA 2B63G 4HJ8A 3VDYA 2UU9Q 2UXBL 2F4VL 4C3HH 2Z6KC 1PYBA 2QGQA 1P8LA 4LF9Q 1E3PA 2CWAA 4DV0Q 1X55A 2JK8A 5JEAJ 4IOAA 2RHSB 2VW9A 1RL2A 4JI4Q 4H02A 1EOVA 5DLQE 4DR2Q 4BBRG 1FJGQ 2XGTA 4QY7A 3KJPA 1JJGA 2JA5G 1L2FA 1KQSA 5IYCH 3W1BA 1JB7A 3PCOB 1X3FA 4JI3Q 4X62L 2E2IH 5GAEC 1J5EQ 4BY1G 3G4SA 3FP9A 3CCUA 1OXSC 4DV2L 2YTVA 2KBNA 1WI5A 4LFBL 3M85A 4A3LH 3PIPA 4FDBA 2VUMH 2WAQE 1BVSA 2BH8A 1HZBA 3A74A 3MXNB 4YY3L 2JEBI 4JBKA 2VS1A 2EXDA 5IP9H 3HOZH 1VQBA 1Y14B 4RMFA 1NJIC 2R93G 3PO3H 5IYBG 4DV4L 3CCQA 4IFDG 1A8VA 1LUZA 2KHJA 4AQYQ 3UDXA 4JI7Q 4DUYQ 1XNQQ 3I4MH 4ME3A 1NMFA 3S1MH 3FKIH 2XTIA 1T9HA 4NXML 4A3DG 1YHBA 4JBMA 1NMGA 4YHHQ 2AHOB 3STBC 4DKAC 1CSPA 2UXCQ 1FGUA 5M3FG 2PI2A 4DR5Q 1C0AA 1HNXQ 4JOIA 1VQJA 2UUBL 4DR3Q 2K14A 4TQUS 1EYGA 1N32Q 1NY4A 1HNZQ 3M9BA 2JE6I 4R4QA 1VQPA 3J81c 1B8AA 4JBWA 3J7A5 1XMQL 1P16A 1VQEA 3AQQA 4A4IA 1FVIA 4HJAA 1Q8KA 1X3EA 1YI2A 4B3SQ 2ZTCA 1QVFA 3AFQA 2JA8G 4OWTB 4HJ5A 2BH2A 5GQOA 1Y1VH 2JQOA 1L1OB 1SFOH 2R7ZG 1BBWA 3T1HL 2ES2A 1B70B 1I3QH 4A3EG 1IYJB 1N33Q 4K0KL 3UDFA 3ULJA 2E5LQ 5FJ8H 2MQHA 3ULPA 1LYLA 4LW1A 1IBML 4LF4Q 4PG3A 1WOCA 5JJLA 1Q46A 3RLOA 3KF6A 1CSQA 3CMEA 4A93G 1YNXA 3HOYG 1KRSA 4DPGA 3J7ZC 4J15A 1RIPA 3A0JA 4C2MH 3NELA 3K7UC 2V1CC 1QVGA 4Y52H 1K9MC 4UP8A 4JI1L 2E8GA 2VQFL 2Q2HA 1VQOA 2A8VA 3KYHC 2MFIA 4KI0A 4JG2A 4X64L 4HJ7A 2NN6I 1IZ6A 3AYHB 4IPCA 1Q82C 4IJHA 4YWMA 4NXNL 5C0XG 2K75A 1I94Q 1JJ2A 1BKBA 2IX0A 4GKKQ 1SN8A 5C3EG 2JA6H 3GTMH 5IYDG 4L5TA 2KENA 1EIFA 3GTQH 5BR8Q 2AWOA 2OCEA 4AIMA 3CCJA 4DR1L 4LF7L 5J3BA 2N78A 5C0XI 4DAYB 2UUAL 3KDFA 2ZM6L 1EQQA 2LXKA 1EIYB 5GROA 2VNUD 3PUXA 2H5XA 2K4KA 1K83H 3E0EA 3EN2A 4P71A 4DNIA 4X65L 1MIUA 4DV3Q 2N49A 3OTOL 1TXYA 1XJVA 1XPRA 3H15A 1PH9A 2F3IA 2MO1A 2LXJA 3K81C 4DV5L 2MO0A 1PH6A 3EBEA 1TWGH 3KFUA 3T1YL 3S1RH 2FXQA 1YEZA 5HGQA 1KRTA 5FLXc 2WB1G 1W2BA 1KC8C 1KD1C 3S17H 4A3CH 1MJCA 4DK3C 4X62Q 4GLAC 2VY3A 4A3KH 2A19A 4KLKA 4A3GH 1OXUA 2D0PA 4DV2Q 3K7AH 4DR7L 3D0FA 4OWWB 1YHAA 1YHQA 3H0GG 4JI2L 3UDIA 2JEAI 1NE3A 3DLLA 3A5ZB 2ZJRA 4BXXG 4PZ8A 2GN5A 3BU2A 4BY7H 3SGIA 1WCMG 1R9TH 4UY8C 1OXTA 1E24A 1K0RA 3ERSX 4IPGA 4X66Q 5C44H 5LMUQ 4IO9A 3CPFA 3HOUH 4OO1I 1PVOA 5EAYA 3GD7A 4X6AH 1TWHH 1Z47A 4YY3Q 3CPWA 1VQ9A 1D7QA 2OWOA 2IY5B 4JCVE 1EQRA 1TWCH 1XMOL 1CKNA 4DV7Q 4DV4Q 1YZ6A 4A3BH 4OX9L 3GTLH 4O2DA 2CCZA 1JMCA 1VQFA 2Z0SA 4NB3A 3IRBA 2E2JH 1GVPA 2B3GA 2WP8J 2R7FA 3G48A 3F2CA 1K3RA 3KF8B 4LWCA 4NXMQ 4JV5L 2IHEA 2C35B 2D0OA 3FHWA 2YTXA 4OXPA 4GNXC 3W1GA 4DR6L 4R1JA 5LMNL 2UXDL 4LF8L 1KIXA 2UUBQ 1GO3E 3ER0A 4GNXA 4R4TA 3HOXH 3J81i 2QEXA 1HNWL 1GKHA 4LFAQ 1N36Q 4POFA 4IFDJ 5IYCG 4IJLA 1WJJA 3J80c 1GM5A 2AKWB 1Q81C 2NVTH 1S40A 4P74A 3KF6B 2IX1A 2NZOA 5ELOA 3B6YA 3K8AA 4JBJA 3TREA 4B3ML 3RN5A 1SE8A 4P73A 1PYSB 1VQIA 2E2HH 4A3LG 1Q12A 4IPHA 4DUZL 3GTPH 1VQ5A 2I5LX 3OYYA 5HY6A 1A62A 2N8NA 3PUVA 3T1HQ 1YJWA 5LMNW 2VUMG 2ASBA 4WJ3M 1QVCA 4HJ9A 4JI6Q 5AJ3L 3PGZA 4YCUA 5M5WH 1X9NA 4LF5Q 5H1SE 2PMZE 4JOIC 5IP9G 3HOZG 1U5KA 4HIMA 2K5NA 2EQSA 2LSSA 2MNAA 1KAWA 3PO3G 1K8GA 4KHZA 4A3IH 4IFDI 1D8LA 1GD7A 1JE5A 3UDGA 5M3MH 3ICEA 2KCMA 1Q1BA 3PO2H 1X6OA 4B3RL 5JJIA 3I4MG 4A3MH 2VZAA 2UU9L 2JA9A 3FKIG 1YJNA 4KHPL 1UE7A 4AYBE 5FLMH 3CMAA 2ID0A 2YYZA 1M1KC 2AMCB 4JI8L 3PSIA 3G71A 4DV0L 4C3JH 3F2DA 1VQ7A 2NVXH 2K5VA 2PNHA 4POGA 4P75A 4B3TQ 3F2BA 3KDFB 2PI2E 3I4NH 1VCIA 1HR0L 1Q1EA 2A1AA 2ZJPA 4NPSA 5C4XH 1CKMA 3CF5A 2VQEQ 3PUWA 4Y7NH 3GDEA 3I4OA 4JI3L 4GLVB 4DV1L 3CW2C 4BBSH 2N3SA 1EUJA 3F1ZA 4BA1I 4GOPC 1V43A 2YV5A 4WJ4A 1MJEA 1N34L 1TWAH 3D31A 3UE1A 1QUQB 1Y1VG 4DR1Q 2NVQH 4GOPA 3BZKA 1W3SA 3L0OA 2CKZB 4EQ5A 1XNRQ 3HOWH 3HKZG 2NZHA 4XTCS 1L0WA 1Q86C 4MTNA 2UUCQ 2B29A 1UE6A 4XIGS 1YIJA 1HR0W 1OTCA 1A63A 5FJ8G 2HQLA 3OTOQ 5C0XJ 3RLNA 3PF4A 1YJ9A 1UE1A 2DGYA 3S1QH 5IP7H 3RNUA 3M3YH 2AWNA 1IBLL 2YU9H 1SRUA 1XTDA 1AE3A 2RCNA 3AFPA 4AQYL 1Z9FA 5GAHC 1PH2A 1CUKA 1VQNA 2CQOA 4YHHL 2R92H 3NENA 2Y0SG 3BJUA 1VQMA 4DR4Q 2UXCL 4A3JH 2I5MX 1LM0A 1HNXL 4JI5Q 1QZGA 1E1OA 4R4IA 3U58A 1SR3A 2ATWA 2UXBQ 5IWAL 1HNZL 4IPDA 1VQLA 4C3IH 1OXVA 2JA7H 4QQBX 2GVAA 2F4VQ 4GNXB 3AEVA 4PZ6A 3RZOH 4B3SL 4GS3A 5JJKA 3JAMc 2KCTA 4OX9Q 2I0QA 3H3VI 2D62A 1VQGA 2OQKA 1C7YA 4LFCL 4YCVA 3U50C 1YVCA 1FL0A 2IHFA 2OTJA 1G291 2K5HA 5ELNA 1ASZA 3KOJA 2JA6G 2DUDA 4DR6Q 1AH9A 3HOVH 3CCVA 1B7YB 4LFBQ 4IOCA 3CCRA 3RR5A 3RN2A 3J80i 1HNWQ 2R7DA 3HKSA 4MZ9A 4A3CG 4A3FH 3PUZA 1PH3A 1VQDA 5IT9c 4A3KG 1VQ8A 1L1OA 1EWIA 3ZJYC 4A3GG 1PH1A 3NBHB 1SMXA 4GN3B 1Y1WH 1E7ZA 2HHHL 1PH7A 2VL6A 4DUZQ 1PV4A 5E7NA 1PFSA 4OONA 2L15A 1IBKL 3CC4A 4A75A 3TS0A 4BY7G 4GKJL 3STBD 1C9OA 5C44G 3HOUG 3CCSA 5M5XH 2ZJQA 4QJFA 2WFWA 2B63H 2HIVA 3M4PA 3S2DH 3S15H 3GTKH 1I94L 2F52A 4DV6L 3CP0A 2WAQG 1NTGA 4AH6A 1KXLA 2WB1E 4A3BG 1Q7YC 3M4QA 1VQAA 5IY0A 1X3GA 3EIVA 1BBUA 4KHPQ 1VQHA 1WFQA 4BBRH 3GTJH 3CC2A 3GO5A 2JA5H 1XMQQ 3OW2A 2PQAA 4JI8Q 2BA0A 3S2HH 3ULLA 4DV3L 4GOPB 2K52A 4BY1H 1UWVA 1S3OA 2Z6KA 4APVA 4JYAL 4UP7A 3HOXG 1HR0Q 3L7ZC 3S16H 2EIFA 3TRZA 1PH5A 1VQCA 1UE5A 1N9WA 4DV1Q 3DM3A 4K0KQ 3U4ZA 3CCMA 4LNQA 1SLJA 1PH4A 1YBYA 3G6EA 5JEAG 1N34Q 1IBMQ 4AYBG 3PF5A 3M4OH 2HIXA 3TEHB 1S72A 1PH8A 3CD6A 1HJPA 4JI0L
chains in the Genus database with same CATH superfamily
2R93H 3E6ZX 5IYBH 3HOYB 2XRSD 5M5YB 1JT8A 4N8X1 4FF1A 4G4KA 5GAGC 1G2TA 1B4OA 4A3IG 3DHQA 1CT1D 1RJTA 1X56A 3JC66 1IKMA 3NEMA 4JI4L 4M8AA 3L9AX 3K5OA 1QILA 4O0AA 2D2CC 1D5MC 4HCSA 1U0LA 2F03A 2IT1A 4C3JG 2F0SA 1F9PA 1JJCB 1VMCA 4DAMA 3CHBD 4Z9CB 5DM63 4KJNA 1SYDA 2Z4IA 2R7ZH 4CBVA 5IE8A 2UUAQ 1A6XA 2B2UC 4KMUC 2HDLA 3JAMi 3RZDH 4OIJA 4X65Q 1CQVA 2QA4A 1ESRA 1JE4A 4J1MA 5GADC 3I90A 4TVAB 3HOWG 1EY7A 2WKDA 3J81E 2ZTEA 3CC7A 1XNQL 1RTOA 4OWXB 3PIP3 3C46A 1I6HH 2A69C 4DR7Q 1CK1A 2FINB 2L11A 3FRPB 4DR5L 3S1NB 4UP9A 3S1RB 1N32L 1WYDA 4A3GB 1D2BA 2HHHQ 3K7AB 1AE2A 2DJFC 1IBKQ 5EBCA 2OEOA 4BY7B 2M2LA 4C3IG 5E1FA 4C3HB 1N33L 1DGSA 5LMNQ 2E5LL 3IFDA 2QKIC 4YWLA 1HA6A 1PRTD 4QUCA 1E22A 1K8OA 4OHJA 1EY8A 2MP1A 3JAML 4B3MQ 2RDHA 2QILA 5C4JH 1LT4D 1J6QA 3FDTA 2L1BA 1JWUD 4LUZA 1PHJA 3K0XA 1E1TA 2NVTB 1ASYA 1WTRA 3LWEA 4GKKL 3GTGH 2E2HB 4FF4A 1V9PA 3NQTA 1HZCA 2F0WA 5IT9L 3HZXA 3UE0A 1VMPA 2R3ZA 4LF6Q 4HJ8A 1TIID 4NKLA 1FR3A 4KTAA 1RKNA 3FKIB 4RCNA 2L4NA 1OO9B 1P8LA 2QGQA 1BOSA 5ELBA 4IOAA 1DJRD 1ET6A 1XWEA 5C3XA 3NHHA 4DR2Q 4BBRG 1FJGQ 4QY7A 3KJPA 2EY2A 5IYCH 4X62L 3BYTB 3NWSA 3CCUA 1OXSC 2YTVA 3TN2A 1WI5A 1EFID 4QF4A 3PIPA 1BCPF 5C4XB 4WJWA 1CA5A 1BVSA 3H91A 3TP8A 3TZUA 4RMFA 2R93G 2PO4A 5IYBG 1A8VA 1YNND 4AQYQ 3RMHA 3V96A 4JI7Q 1B53A 4CGYB 4DUYQ 1NMFA 1Z6HA 2XTIA 1YHBA 1BNZA 3TMEA 3S1QB 5LL6X 1C0AA 3M3YB 3D6WA 2UUBL 1HQMC 4K14A 2JE6I 1HRJA 4B9WA 5CBAE 4R9WA 3J7A5 1MSGA 1Q8KA 1YI2A 3Q23A 4RWSC 1L1OB 2R7ZG 1BBWA 2JXMB 1B70B 4QIWB 5IGDA 2BDNA 4K0KL 4IN3A 3TP5A 4ILWA 4OEMB 2MQHA 1LYLA 2TMPA 4KHVA 4LW1A 4ZLTF 1WOCA 1CHPD 4QMGA 1Q46A 4K8JA 1CSQA 2K28A 2RVLA 4OGQC 3T13A 4ULLA 2EY6A 3A0JA 4C2MH 2XIWA 5L37A 1KDCA 2E8GA 3BVMA 2BDOA 2KUMA 2EYJA 3KYHC 4X64L 4A3FB 1STBA 1Q82C 2BE5C 2Z9HA 1I94Q 1JJ2A 5IGCA 1TWHB 2RA4A 3NPPA 5DNFA 2MPMA 5IGFA 3GTMH 2NWGA 3L3OC 1SNPA 2FFKB 4RGTA 1I4XA 2AWOA 4A3BB 3CCJA 4DR1L 1A15A 1JQYD 5J3BA 2N78A 5E3FA 4DAYB 3S15B 3KDFA 3PMFA 2DY8A 3PUXA 2H5XA 4DNIA 3EN2A 1XJVA 2JA6H 1UUPA 1TXYA 4DGZA 3VA5A 2LXJA 2F0DA 1KNAA 3T16A 2TSSA 3S1RH 1W2BA 1B9NA 1KD1C 1F9QA 4H7BA 4A3KH 4KLKA 4A3GH 3VYSA 2ZXRA 3A8KE 3CRLC 3K7AH 3JAME 3WDNA 1YHQA 2EVBA 5COYA 3HRZC 4AYBB 1NE3A 3DEOA 3NWTA 3GTPB 3S16B 2EJMA 2GN5A 4BY7H 4UY8C 3M4YA 1E24A 3ERSX 4IO9A 3CPFA 4K6DA 5M5WB 3GD7A 1SYFA 4YY3Q 3CPWA 4KY7A 5CV6A 2IY5B 2EYHA 1XMOL 1CKNA 2M9VA 4A3IB 2CCZA 3Q22A 3P75A 3HP3A 2C9OA 5IT9E 1GVPA 1VF5C 2K5WA 3F2CA 4NXMQ 4GNXC 4DR6L 5DEHA 5M3FB 4C3JB 1GO3E 4GNXA 3OMCA 4R4TA 1I4GA 2QEXA 1SNDA 3NP8A 5IYCG 5KNDA 1GM5A 1QCBD 2AKWB 2NVTH 2IX1A 1PRTC 2AQ3B 3KF6B 4L63B 4MHEA 3B6YA 3K8AA 5G3LF 3I4LA 2E2HH 5C4HA 2NVQB 1YJWA 2IX3A 5LMNW 1Q90A 5D65A 3PGZA 3DXJC 4YCUA 3K0YA 1X9NA 3RD4A 3N52A 4RKBA 2FMCA 1ZEQX 4KHZA 4ZCKA 1D8LA 3AB9A 3ICEA 2KCMA 3K58A 1X6OA 5D14A 2JA9A 1UE7A 4AYBE 5JAVA 5FLMH 1JB3A 5EQ0A 1M1KC 1LV9A 2AMCB 3G71A 4DV0L 3F2DA 2PNHA 4POGA 4B3TQ 1HR0L 1SYCA 1B50A 2K5QA 2PW5A 2A1AA 5C4XH 4C3IB 1CKMA 3PUWA 3KK7A 3ND8A 3GDEA 2MGSA 4GLVB 4DV1L 1EUJA 3R8BA 2YV5A 4WJ4A 3QO2A 2B2WC 4EQ5A 2NZHA 1SBBB 1L0WA 2B39A 2B29A 1A63A 1YIJA 4DF7A 1YJ9A 2DGYA 3S1QH 2B2YC 3M3YH 3O13A 1IBLL 2YU9H 1IW7C 2WINB 1V1OA 2A73B 2P5ZX 5CC4A 4YHHL 1YNNC 5EKLA 4A3JH 3H0GB 4F8MA 1HNXL 5IWAL 1C48A 2GVAA 1XX8A 3EFXD 3OW7A 1Y8NB 1QE6A 4PZ6A 4CDFC 1SYGA 4B3SL 3E0JA 4OX9Q 2D62A 3KLSX 2F0NA 1VQGA 1GUOA 2OQKA 4LFCL 2PCFB 1T5XD 1YVCA 4QCLA 1FL0A 4K5VA 4BBRB 3GTJB 3MWYW 1U9RA 1DOLA 3KOJA 4NW2A 2JA6G 3HOVH 1QJOA 5KNBA 1B7YB 4LFBQ 3LX0A 4ZK9B 1STNA 2H4OA 4A3FH 1BCPD 4FNFA 1BDOA 4A3KG 4A3GG 1KTKA 3LWUA 4GN3B 3S9WA 1E7ZA 1PV4A 1PTOB 4OONA 2L15A 3CC4A 2R93B 4BY7G 1H9KA 4GKJL 2VUMB 1C9OA 2A6EC 3CCSA 1G2SA 4JW0A 3S15H 4DV6L 3CP0A 4KD4A 3D4WA 4AH6A 3NK9A 2PW7A 2WB1E 5JPMC 1BBUA 1II3A 1U4RA 2EOTA 4RAUC 4FF2A 3I4MB 3GO5A 2JA5H 1XMQQ 2LY7A 4JI8Q 2SNSA 3TP6A 2GA4B 1GHKA 2NTTA 2DJGC 1I4QA 2Z6KA 4JYAL 4UP7A 2DNCA 3L7ZC 1K3BC 3S16H 1I6VC 5F2DA 3TRZA 2EJGC 1VQCA 2F0FA 1STGA 2HUGA 3RZDB 1SSOA 3TEHB 1AN8A 1HJPA 4JI0L 1Y1VB 3A5UA 3TQYA 3E9IA 2F0VA 4X66L 1EFWA 1NSNS 4A3DH 1I6HB 4JI1Q 4LF9L 5M3FH 3E9HA 1KLGD 4HIDA 3IAYA 5FO8B 4LUOA 1ENAA 3AMUA 3SK8A 5FLMG 5C5MA 4NXNQ 4N9PA 5JOBA 1J5EL 4IUTA 3PV0A 5C4XG 4JC0A 1SNCA 4HTHA 3R3OA 1EY6A 3K80C 1CZWA 4HIKA 4DK6C 4DU9A 1YNJD 1IL2A 3T56B 4A93H 4ID6A 1O7LA 2NVYH 1G6ZA 5HURA 4LAAA 2OF1A 5D3IB 1EY9A 2CH4A 1GUTA 4QL5A 1H9JA 3MXNA 3MAQA 1G51A 4L5RC 4MIUA 4A3JG 5C3EH 3HKZE 3GTGB 3GV3A 2KHIA 1PA6A 1JWMD 2NBFA 1STAA 4CDEC 1Y69U 2HCIA 1EWCA 2F3WA 4QGUA 3A56A 2VQEL 4ALPA 4JV5Q 1TR5A 3VR3A 2ZT9C 3GQBA 1EQTA 1JCKB 4A76A 5C4ZA 2KA7A 4PMBA 5JVH3 1QZHA 3OWFA 1KABA 5G3LD 1MBYA 3HFZB 3HOVG 2OQ0A 2F4IA 4ZQ3A 1X65A 1CKOA 2WACA 2YTYA 1SEBD 3KJOA 3TS2A 3H0GH 4HMIA 4L5SA 1U4PA 4A3FG 2F0TA 3GP7A 4RG1A 2F0GA 4DR4L 4YWKA 4JI5L 1PLFA 4ABNA 3CXCA 4B3RQ 5BR8L 1HZ9A 3SXHA 2F4VL 3BVGA 5I6WA 1PYBA 2F0JA 1E3PA 4F88A 2B2VA 2RHSB 1IKLA 4O42A 4JI4Q 3M7GA 4H02A 3PO2B 3QOJA 1JJGA 3U9SA 2JA5G 3W1BA 2F0MA 1BO0A 5CYUA 4DV2L 2KBNA 2PZWA 1RHPA 2VUMH 1KDBA 2KCCA 1TY2A 1B3QA 1LTBD 1Z7TA 1JWSD 1HZBA 5FK9C 1PMRA 3URYA 3TDQA 4JBKA 3MTSA 3HOZH 2KECA 4DV4L 1QWYA 4RGOS 5ELEA 3I4MH 1XNQQ 1PTOF 4C2MB 1S4ZA 1T9HA 4A3DG 1WTWA 1RODA 2PZUA 2QF7A 2AHOB 3NBIA 5DAUA 5ELDA 1CSPA 1FGUA 5M3FG 4DR5Q 3QR8A 4TQUS 1N32Q 2A68D 1HNZQ 1F9SA 4R4QA 1VQPA 3J81c 1Y8OB 5KIXA 4HJAA 1X3EA 1PFMA 3KF8A 3NSWA 1I4PA 3GTMB 4KY5A 4HJ5A 5IGEA 3K57A 1Y1VH 1XTCD 4HAEA 3T1HL 2ES2A 1N33Q 1XYIA 2LFNA 4WRDA 3UDFA 4HSPA 3ULJA 2E5LQ 5FJ8H 2JA6B 3SK5A 2EYOA 1RCVD 2I46A 1MGSA 1F2MA 4A93G 1YNXA 1LTAD 2QDLA 3J7ZC 3EROA 1NR2A 1HUNA 4A3KB 1K9MC 1G91A 2Q2HA 2WV6D 2MFIA 4H0LC 4JG2A 4HJ7A 1HXYD 3UI2A 4ZYSA 3AYHB 5J39A 4IPCA 1HFNA 4CDDC 1EU4A 2K75A 3SVMA 2IX0A 4GKKQ 5C3EG 4IUVA 5TSSA 4AIMA 1AP0A 4U68A 5C0XI 2B63B 5EPKA 2UUAL 1LTTD 3EQLC 1EQQA 5IIFA 4ME5A 5GROA 1EIYB 4P71A 4X65L 1MD2D 1XPRA 1MIUA 4UDUC 2N49A 5CBEE 2ICEC 1PH9A 3VYTA 1WD0A 1EOTA 1I4HA 1YEZA 2MJ8A 2WB1G 1G8ZD 4DK3C 4X62Q 1YNJC 4GLAC 1E0BA 2D0PA 3W3AA 1LT5D 4KV6A 1EYCA 4K5XA 4QUFA 4DR7L 3D0FA 1UAPA 3H0GG 3UDIA 2JEAI 2ZJRA 3J7AV 4PZ8A 2UXBL 1D5XC 4IUQA 1WTHA 1QOHA 1OXTA 5LMUQ 2K5DA 3T53B 3A7LA 4B08A 4X6AH 1VQ9A 1LO5D 4DV7Q 4DAVA 3CQZB 4O2DA 4NB3A 3IRBA 1TQOA 3T4AC 2R7FA 3G48A 1K3RA 4OXPA 4J8QA 2MUYA 5LMNL 1CA6A 2PNRC 4RHRA 5J22A 3DWAA 2UUBQ 2K6AA 4XT1B 1F9RA 1HNWL 1GKHA 3CU7A 4LFAQ 3SHLA 1N36Q 2RSNA 4POFA 1Q81C 2N88A 5D3DA 1S40A 4B3ML 3RN5A 1SE8A 4P73A 4L6TB 1VQIA 5JEAH 5CV9A 1DCZA 4IPHA 1VQ5A 3OYYA 2F0HA 3PUVA 4FF3A 2VUMG 1QVCA 3H09A 4JI6Q 5CV4A 4LF5Q 5H1SE 3HOZG 1U5KA 2LSSA 2EXZA 1K8GA 3TP7A 3D4DA 1JE5A 2YU9B 5JJIA 3PO2H 3I4MG 4KHPL 1YJNA 2A5HA 3NQIA 2CVRA 3VYRA 3PSIA 1SMYD 4KD3A 4A3JB 2NVXH 1Q3LA 4P75A 1PXUA 4IUPA 3KDFB 3F2BA 4FXGC 1Q1EA 2ZJPA 1DONA 2RDFA 4BBSH 3F1ZA 4BA1I 2ICIA 2QEJC 1V43A 4EVOA 1N34L 3D31A 1QUQB 1STYA 1Y1VG 4DR1Q 1WTVA 4X3KA 2DY7A 3BZKA 2JSOA 2CKZB 3L0OA 1XNRQ 1X32A 3HKZG 4DN4M 4MTNA 2UUCQ 1UE6A 5FJ8G 3HOVB 1H9SA 2BOSA 3HG9A 3VA7A 1LTRD 3AFPA 2RCNA 4AQYL 2HQEA 4XQJA 1MI2A 2CQOA 4EGVA 2R92H 3BJUA 1D1KA 1LM0A 1V1PB 4IALA 3U58A 5BN4A 5CV5A 2CQAA 4IPDA 1S5BD 1WCMB 4B9XA 1VQLA 2JA7H 4RGMA 4QQBX 2XNAC 3Q24A 4GNXB 2A68C 4GS3A 3JAMc 2I0QA 4RA8A 3U50C 3QG1A 2IPKD 2JA5B 1PRTB 2DUDA 4DR6Q 1JICA 1GUWA 3CCRA 4JVZA 1AEXA 3J80i 3RR5A 3RN2A 1TY0A 4MZ9A 1VQDA 5IT9c 1DD2A 1VQ8A 1JR0D 1L1OA 1SNQA 1FNWA 3NBHB 2RBMA 1SMXA 2IJ0A 4N8FA 1PH1A 4GZYC 2RQXA 2VL6A 5FLXL 2PQEA 1PFSA 2Z4HA 4F7XA 3STBD 1CQFA 2BCOA 2B63H 5T1IA 2WFWA 3S2DH 1I94L 4C1NI 4A3DB 1VDZA 3C1EA 1KXLA 3J7AF 1Q7YC 5A2QL 1TS4A 5DM73 1VQHA 3CC2A 2PQAA 3ULLA 1HA5A 2AUKA 5K5PA 4BY1H 3MHBA 2F0OA 2K7VA 1HR0Q 4I7ZC 4NP5A 2A6HD 1B44D 1EQVA 1STEA 1IHZA 4DV1Q 4OL7A 1EYDA 1ZXTA 1WTPA 4LNQA 5EKKA 1WVLA 2LMCB 5JEAG 3M4OH 1IBMQ 1PH8A 3CD6A 3J80L 3CQZH 5E4XA 3L2PA 1SFOB 1CFMA 4A93B 4IFDH 4PMWA 1SE4A 4KKTA 3R93A 4HCEA 2NVYB 1VQKA 4ODGA 3HS0C 2VQFQ 5JPNC 3BDLA 3I55A 3X3MA 2G5DA 1IBLQ 4OELB 3PO2G 2RF4A 4CKCA 1ILQA 1MHWC 3CCLA 1WTXA 4DXFA 1F77A 5FO9B 3ITPA 3M7NA 1KHIA 3FMCA 5C3EB 4RHSA 3C3LA 1O7IA 5IWAQ 5IGBA 4LF7Q 2ZM6Q 1M90C 3PUYA 4BBSG 2Q2IA 2BA1A 3I7FA 3FPUB 1JORA 1K28A 4LFCQ 4DV5Q 3I3CA 1ICWA 3T1YQ 2JJQA 3KLWA 2KHSA 1LLRD 2WB1B 1EU3A 1JOQA 1SROA 1EL0A 3A7AB 1IXRA 4JI2Q 4X3UA 4L5QA 1TWGB 2ZTDA 4G7HC 1O7ZA 4DR3L 4KN7C 4PZ7A 1V1QA 4GN5A 4R4OA 2HDMA 4YCWA 5C0XH 2R92G 1SNMA 3C1FA 1H9MA 1O80A 1W6KA 2K1BA 2K33A 3WWVA 1VQ6A 4B3TL 3I56A 4GKJQ 2JA7G 3HOUB 5HGTA 4DV6Q 1G6PA 4GLXA 3A55A 3U4VA 2I07B 2UXDQ 4LF8Q 1GHJA 4RCOA 4LF4L 3GTLB 1S5DD 4HN7A 2RKSA 4PQXA 1VQ4A 1UEBA 3S14H 2Y0SE 3CAMA 3R2IA 3S24A 4YIJA 4DXGA 3MEFA 4JYAQ 1XPUA 1YITA 3GTOH 2Q2UA 2E2DC 1R4PB 1XPOA 1WCMH 2NB0A 3SR1A 5AJ3Q 2PYKA 4F87A 4G7ZC 4BA2I 3BZCA 4UAIA 1PZKD 4MNOA 1FGBD 2F1MA 1RD9D 4JI0Q 3HOZB 1TS3A 5FLXE 3PQIA 3OIPA 2B63G 2PZTA 4V0BA 3VDYA 2UU9Q 2FJ2A 3QIAA 2L5TA 2Z6KC 1R4QB 3K5LA 1CZGA 4LF9Q 1QNKA 2CWAA 2JK8A 4XYOA 2EJFC 3BZDB 2VW9A 1GUSA 3DMUA 5M3MB 1EOVA 1D1IA 5KGUA 1RTNA 1ESFA 3K5MA 4N9TA 1KQSA 1X3FA 4JI3Q 4LK1C 2E2IH 1V8QA 1J5EQ 4BY1G 5JJZA 1PRTF 4LFBL 5EGTA 1W6JA 3HKZB 2BH8A 1DYQA 3A74A 3MXNB 4RH6A 2JEBI 1O7YA 4EQOA 5CORA 1QG7A 1TWAB 1SYBA 1TT2A 1X3PA 3PO3H 2A69D 3CCQA 4C56C 1LUZA 2KHJA 4IFDG 3J80E 3NTHA 3UDXA 3S1MH 4ME3A 3W2DA 1NMGA 2KCNA 3STBC 2UXCQ 2PI2A 2F0PA 4JOIA 1EYGA 1SJHD 5JVG3 5IOCA 3N6RA 3OHXC 4JBWA 1XMQL 3AQQA 1VQEA 3R2TA 1FVIA 1QVFA 2ZTCA 3AFQA 3RUZA 4OWTB 2CW0D 3A54A 1TS2A 2BH2A 2JQOA 1SFOH 2A74C 1KDAA 1IYJB 1E2WA 1PFBA 3RZOB 5CGKA 1EWHA 1BQQT 4IQZA 4PG3A 3J81L 2XRQD 1T5EA 4PNYA 4J15A 1SAPA 1RIPA 1LTSD 4TRDA 2D5DA 3NELA 3K7UC 1QVGA 4Y52H 2SDFA 4JI1L 1NR4A 4KK7A 1GOZA 1EIGA 2A8VA 4KI0A 3H6MA 4NXNL 5C0XG 2EY1A 1LABA 2Q8RE 4WFN3 3SDZA 5IGGA 1EIFA 3GTQH 5BR8Q 1EYAA 2OCEA 2KEEA 1M8AA 1CI3M 4XQQA 2VNUD 2V4DA 3E0EA 1K83H 4DA2A 4DV3Q 3OTOL 2F3IA 1PH6A 1TWGH 3KFUA 3S17H 1KC8C 4A3CH 1MJCA 3E3XA 2OT2A 2VY3A 2A19A 1BCPB 4DV2Q 2ENBA 2LS01 2RDGA 2C5CA 3BU2A 3SGIA 1WCMG 1R9TH 1K0RA 4K2LA 1PVOA 3HOUH 1PZID 5EAYA 1D7QA 2B2VC 4JCVE 1EQRA 1TWCH 2NUCA 3NUCA 4DV4Q 3GTLH 3LNNA 3AU7A 2E2JH 5J1ZA 1TWFB 2B3GA 3KBGA 5FKAC 3WOFA 4JV5L 3KF8B 4LWCA 4LJZC 2AQ1B 3TSSA 1J9OA 2D0OA 1HPCA 3VR2A 3W1GA 1ZYRD 3MA2B 2NVXB 3HOXH 2IW3A 2N55A 4K6LA 4EQNA 4IJLA 1EIHA 4G7OC 4P74A 2NZOA 5ELOA 3TREA 4BBSB 1S5ED 1BCPC 1PYSB 1Q12A 4RGNA 4DUZL 2JA8B 2I5LX 5HY6A 3T1HQ 2M00A 2ASBA 4HJ9A 4A3EB 4MN3A 1J8IA 1TVXA 4CHTB 4HIMA 2K5NA 2MNAA 1IL8A 3PO3G 4IFDI 1BF4A 4ZRZA 3UDGA 5M3MH 4B3RL 1B3AA 1Q1BA 3OSOA 4A3MH 1U4LA 1IYVA 4DK0A 1ENCA 1MSHA 1ML0D 2F0IA 3QWNA 2ID0A 3CMAA 2R92B 3HGBA 2BE5D 2Q8TA 3I4NH 3D8GA 1VCIA 4DAPA 4KN4C 2PPBC 4Y7NH 2JA7B 3CW2C 2L55A 2N3SA 3OMGA 5ELFA 5C6AA 4GOPC 2E75C 1MJEA 1LTGD 1TWAH 3UE1A 4GOPA 3BG3A 1SYEA 2EYFA 1HQRD 4K2KA 1B2TA 4HR7B 3RLNA 2B2UA 2JP1A 3OOCA 1UE1A 3DWPA 5K36H 5I9PA 5IP7H 2JYOA 1SRUA 1XTDA 5GAHC 4G57A 1CUKA 3NXWA 2NN6H 1VQNA 4XT3B 3NTKA 4DNTB 1NAPA 3OIQA 3NENA 2Y0SG 3H94A 3D6CA 2OXPA 3EA6A 2I5MX 1E1OA 2ATWA 2UXBQ 4CJ0B 1HNZL 4HMJA 1OXVA 4CDCC 3S2DB 3RZOH 2ZXOA 1A2TA 1RDPD 5JJKA 2L0CA 1E2ZA 1C7YA 3WOEA 4YCVA 3H3VC 3BDCA 3U9OA 1A3UA 2F0UA 1G291 3D4RA 4M1UB 2CW0C 3OPOA 5ELNA 1PDQA 1AH9A 1EY5A 3D3RA 4BS9A 3HEJA 4BY1B 3CCVA 4DNRB 1HNWQ 2R7DA 3HKSA 1EY0A 4A3CG 1B9MA 1HTLD 2IL8A 2VXWA 2EY5A 1EWIA 3ZJYC 5CV8A 4L8JA 4OO1H 5I2XA 1Y1WH 2HHHL 3M4OB 1PH7A 5E7NA 5KYLA 1EEFD 1IBKL 2O5IC 4J6HA 3TZDA 4I65A 2QCPX 3HOUG 2ZJQA 3I70A 2HIVA 3M4PA 5C3WA 1NUCA 1L0YB 3IFTA 1WD1A 4JK1C 3M4QA 1VQAA 1X3GA 4KHPQ 3ZYYX 1UEAB 5EJWA 3A8IE 3MXGA 3S2HH 2BA0A 2WIIB 3PIO3 2K52A 5I6YA 3I8ZA 1UWVA 1Q8IA 3HOXG 1JC7A 2EIFA 4CJ2C 1AZQA 1NCVA 1PH5A 1A3TA 1N9WA 1H9SB 4K0KQ 3U4ZA 1LT6D 1N34Q 2HIXA 1S72A 2RSOA 1K0SA 4XQNA 2KQ3A 1EEID 1K73C 1DOMA 1I3QB 4LF6L 1HH2P 1I50H 1TWFH 2GVBA 4UPAA 5LMUL 2B8GA 5IODA 2HCCA 1HZAA 1IW7D 1IYUA 3Q6SA 1K8AC 1H95A 1LACA 3G7LA 4DV7L 4O1NA 5M9OA 4X64Q 5M3MG 4R4CA 2EYLA 4A3MG 5BN3A 4DR2L 4KKSA 3A8JE 1FJGL 3EJIA 2DN8A 2E76C 3CCEA 4IUUA 4C1NK 3I4NG 3BDOA 2JA8H 2R6GA 1OXXK 2CFMA 4QB4A 4LFAL 1N36L 1ZYRC 4A3EH 1NBWA 3K59A 1N8RC 4OIKA 2CWPA 2XN9C 4HIOA 5FO7B 1LTID 2ALYB 3HOYH 2AUJD 5KYIA 5M5YH 2F0LA 2G9HD 4JI6L 3S14B 4GN4B 4JI7L 3QOLA 5LHY1 1CKNB 4DUYL 1MKHA 3NE5B 3SK4A 4LF5L 1LTLA 2F0EA 1KL9A 3F8TA 1WTOA 3K6OA 5K36G 5IP7G 2SEBD 3GTOB 4EX5A 2OTLA 5A35A 1SDFA 3LGJA 2K50A 2NN6G 3J81j 3FPPA 5CMDA 2K03A 3GV6A 3DWQA 4P72A 2RHQB 2K01A 2A6ED 1XMOQ 2WKCA 1X54A 3F2UA 4ZKCB 4HSVA 5IYDH 3H3VH 2PQAB 3PIOA 5BN5A 1A0IA 1ONLA 3VR5A 2L12A 4I7AA 5C44B 5EPLA 3KLRA 2HT1A 1X3QA 2WAQB 3I2ZA 2B8FA 3I72A 1F2LA 2Q2TA 3J7YW 1L1OC 1XNRL 5LL6S 2I5HA 4LUVA 2LKVA 1I5FA 1H9RA 2UUCL 1BBXC 2F0QA 2E2IB 2D9UA 4CKBA 2K05A 4IUNA 1VS0A 4NMZA 2FMMA 2HD3A 3S1NH 3RLFA 4Q0FA 4BXXH 1DZ1A 1LT3D 1QUQA 3BYYB 3Q8DA 1CHQD 1PTOD 4OO1G 3KUPA 1Y1WG 2NTSA 3I91A 4QIWE 1XXGA 1HFGA 3KLSA 3PO3B 2ZXPA 4P2CB 4LMQD 3W5OA 4FXKC 4MTKA 3S1MB 4C3HH 4DV0Q 4KKUA 1X55A 3BS1A 3QB3A 5JEAJ 1RL2A 1S5FD 4FP5D 5DLQE 1GXDC 2XGTA 1FYCA 1V1PA 1L2FA 1JB7A 3PCOB 4FO2A 5GAEC 1K8MA 4FVMA 3G4SA 4CJ1B 3FP9A 2EYPA 4DAYA 1S5CD 4BWGB 4A3LH 1UNSA 3M85A 2RCFA 1GJXA 4CKEA 4ZAIA 1SE3A 4FDBA 3MFYA 1F2ZA 2WAQE 4KY6A 5T1GA 3Q0AA 1HHVA 4YY3L 4PV1C 2VS1A 1DM0B 2EXDA 5IP9H 1VQBA 1Y14B 1NJIC 3HOWB 1SJED 2KOLA 3FKIH 4NXML 4JBMA 4YHHQ 4DKAC 1FNVA 2Y0SB 3NBHA 3MFGA 2X69A 3DUZA 3BVZA 1HNXQ 1VQJA 4K5WA 4DR3Q 2K14A 1NY4A 3M9BA 2B2TC 1GUNA 2J7ZA 1B8AA 3X3NA 4IZ8A 1P16A 4A4IA 2B2TA 2EPBA 2X6LA 4ZKBB 4B3SQ 3MZ5A 1U4MA 2JA8G 3GTQB 5GQOA 5CR3A 5C5LA 1I3QH 4A3EG 2EDGA 1KNEA 3V05A 2DNEA 1I4RA 4UHVA 1K83B 3ULPA 1IBML 4LF4Q 5JJLA 3RLOA 3KF6A 5I2YA 4XDXA 3CMEA 3HOYG 5NUCA 1KRSA 1JOKA 4DPGA 3S17B 2B2WA 1WTQA 3I73A 2V1CC 4UP8A 2VQFL 4V190 2L9HA 5E4WC 1VQOA 4X3TA 2NN6I 1IZ6A 2B2YA 1QB5D 1R9TB 1SMYC 4IJHA 4YWMA 1BKBA 1SN8A 2E74C 3T51B 1TWCB 2Q8IB 1D5ZC 5IYDG 1HCZA 3OWEB 1C4QA 2KENA 1O78A 2XVSA 3MXPA 4L5TA 3C2PA 3CRKC 4TKOB 4LF7L 1BUVT 2QDBA 5M5XB 2E2JB 3GTKB 2ZM6L 2LXKA 3MC0B 2K4KA 2SNMA 5I4DA 3SE0A 4Q5VA 3H15A 2MO1A 4E6IA 3K81C 4DV5L 2MO0A 3EBEA 2PMZB 3HOXB 1JOOA 5ISRA 3T1YL 2FXQA 5HGQA 5FLXc 1KRTA 1KAAA 2O4XA 1STHA 1ZKOA 1OXUA 3VR4A 4OWWB 1YHAA 1DOKA 4JI2L 1SE2A 1FD7D 3DLLA 3A5ZB 4BXXG 5CV7A 4FYDA 4S3SA 4IPGA 4X66Q 5C44H 4OO1I 1TWHH 1L0XB 1Z47A 3IL8A 2OWOA 4TSSA 1CM9A 3P20A 1YZ6A 1ENFA 4R8IA 4OX9L 4A3BH 1JMCA 1VQFA 2Z0SA 2WP8J 4A3MB 4C3HG 5A2QE 3P1HA 2IHEA 2C35B 3FHWA 2YTXA 1ET9A 1EZ6A 2H1EA 4R1JA 2UXDL 4LF8L 1KIXA 3ER0A 3I4NB 3J81i 3KBXA 3E5SA 2FHTA 4IFDJ 1WJJA 1HTPA 1AW7A 3J80c 1Y8PB 4Y7NB 1VF7A 4JBJA 5I9OA 4U673 4R8NA 2F0KA 4A3LG 2SOBA 3P7JA 3GTPH 5FOBB 5KNCA 1A62A 2N8NA 2R7ZB 3FEWX 4WJ3M 5AJ3L 5M5WH 1QNUA 2PMZE 4JOIC 5IP9G 2EQSA 1KAWA 1NNXA 1PTOC 4A3IH 3FVQA 1GD7A 2KEDA 2KJXA 1HUMA 4XYQA 2VZAA 2UU9L 1ICFB 3FKIG 1RF2D 2O5JC 1E2VA 2YYZA 1CTMA 4JI8L 1VQ7A 2Z8LA 4C3JH 2K5VA 2Z1CA 2PI2E 3MXUA 1TS5A 2VB2X 4NPSA 3CF5A 2VQEQ 3I4OA 3ND9A 5EPJA 2MHVA 4JI3L 2A6HC 1F2YA 4XXEA 2NVQH 3HOWH 1ILPA 1W3SA 3G6JB 4XTCS 1EY4A 1Q86C 1BR9A 1TKWB 4XIGS 4ZUJA 1PZJD 1HR0W 1OTCA 2HQLA 3OTOQ 5C0XJ 1EZ8A 1A2UA 3PF4A 2QW7A 4DFAA 2J0TD 3IKJA 3RNUA 2AWNA 2R61A 1AE3A 3QJYA 1D6EC 2EYMA 1Z9FA 4K8IA 1PH2A 1BXTA 2J4XA 3VYUA 4DR4Q 1VQMA 1Y1WB 5C4JB 2UXCL 2O2LD 4RKLA 3ERQA 4JI5Q 2NYZD 2EZVA 1QZGA 2XWJB 4R4IA 1TU2B 1SR3A 4FXDA 4HEDA 2IWHA 3ONAB 4C3IH 1SNOA 2F4VQ 4ZUIA 4KJOA 3AEVA 2JN4A 1GUGA 2KVMA 2KCTA 3H3VI 3EVQA 2VB3X 2CH4W 2Z6BA 2IHFA 2OTJA 2K5HA 2NZ1D 3K5NA 1ASZA 3CKIB 3MVVA 3S2HB 4JPBW 2K32A 4IOCA 1FNUA 3VR6A 1PYWD 2G9DA 1DXMA 3PUZA 1PH3A 4H13C 1A3VA 4WORA 3SK6A 4X3SA 2X6GA 1B1ZA 1C8CA 5EKIA 5KRUA 4DUZQ 5EBDA 4A75A 1M4VA 3TS0A 4IURA 1KLUD 5C44G 1I50B 5M5XH 4QJFA 3V2TA 4NDXA 5ELCA 3GTKH 2F52A 4RFBA 2WAQG 3DEPA 1NTGA 4A3BG 4DK1A 1PFNA 3MEHA 2XWBB 5IY0A 3TBIB 3EIVA 1WFQA 4BBRH 3GTJH 2AQ2B 3SEBA 3OW2A 4DV3L 4GOPB 2F3VA 1AFPA 3NTIA 1S3OA 2CHBD 4APVA 1AZPA 3DM1A 4H44C 4EQPA 2K04A 1UE5A 3DM3A 2EE1A 2XSCA 3CCMA 1SLJA 1PH4A 1YBYA 3G6EA 5KEEA 4AYBG 3PF5A 5AFWA 4PMCA 1PTOH 1SXTA
chains in the Genus database with same CATH topology
3CQZH 3A5UA 3L2PA 2R93H 3TQYA 5IYBH 1K73C 4PMWA 3E9IA 4LF6L 1HH2P 1I50H 1TWFH 2GVBA 4UPAA 4X66L 5LMUL 1EFWA 1VQKA 1JT8A 1HZAA 4A3DH 5GAGC 4JI1Q 2VQFQ 1K8AC 1H95A 3I55A 4LF9L 4A3IG 5M3FH 3E9HA 4DV7L 1IBLQ 4X64Q 5M3MG 1X56A 2RF4A 3JC66 4R4CA 4HIDA 3NEMA 3PO2G 4A3MG 4LUOA 4JI4L 4DR2L 1FJGL 3CCLA 5FLMG 4NXNQ 4O0AA 3CCEA 1U0LA 1J5EL 1KHIA 2IT1A 3M7NA 1JJCB 4DAMA 3I4NG 3PV0A 1O7IA 5IWAQ 2JA8H 2R6GA 1OXXK 2CFMA 4LF7Q 4LFAL 5C4XG 4JC0A 1N36L 2R7ZH 5IE8A 2UUAQ 4A3EH 1NBWA 2ZM6Q 3PUYA 1M90C 4BBSG 2Q2IA 3JAMi 3RZDH 2BA1A 4X65Q 3I7FA 2QA4A 5GADC 3K80C 4HIKA 1N8RC 4DK6C 4LFCQ 2CWPA 4TVAB 4DV5Q 3HOWG 1IL2A 3T1YQ 4HIOA 4A93H 2JJQA 2ALYB 3HOYH 3KLWA 3CC7A 2ZTEA 4JI6L 5M5YH 2NVYH 4GN4B 4JI7L 1XNQL 4DUYL 1CKNB 4OWXB 1MKHA 4LF5L 1LTLA 1KL9A 1SROA 3F8TA 1I6HH 4DR7Q 5K36G 5IP7G 1IXRA 4JI2Q 4L5QA 4QL5A 4DR5L 2ZTDA 4UP9A 4EX5A 4DR3L 2OTLA 3LGJA 4PZ7A 2K50A 1WYDA 2NN6G 1N32L 1V1QA 3J81j 1G51A 4GN5A 4P72A 4R4OA 4YCWA 2HHHQ 4L5RC 2R92G 2RHQB 1AE2A 4A3JG 1XMOQ 5C3EH 3HKZE 1VQ6A 1X54A 3WWVA 1IBKQ 4B3TL 3I56A 2KHIA 1PA6A 4GKJQ 5IYDH 3H3VH 2PQAB 3PIOA 1A0IA 2JA7G 4QGUA 2VQEL 4ALPA 4JV5Q 4DV6Q 1G6PA 4GLXA 1N33L 3U4VA 1DGSA 2HT1A 5LMNQ 2E5LL 4LF8Q 2UXDQ 3I2ZA 4YWLA 4LF4L 1VQ4A 2Q2TA 1UEBA 1L1OC 4A76A 1XNRL 1E22A 2I5HA 2Y0SE 4LUVA 3S14H 3CAMA 3S24A 1QZHA 1I5FA 2UUCL 4B3MQ 3HFZB 3HOVG 3MEFA 2OQ0A 4JYAQ 1X65A 5C4JH 1CKOA 1VS0A 2YTYA 3KJOA 1YITA 2Q2UA 3H0GH 1XPUA 1J6QA 3GTOH 3S1NH 3TS2A 3RLFA 4L5SA 4A3FG 4BXXH 1XPOA 4LUZA 1QUQA 3Q8DA 3K0XA 1WCMH 1PHJA 4RG1A 1E1TA 5AJ3Q 4BA2I 1ASYA 4OO1G 1Y1WG 4DR4L 3BZCA 4YWKA 4MNOA 4QIWE 3GTGH 4GKKL 1V9PA 4JI0Q 1HZCA 4JI5L 3UE0A 3CXCA 4LF6Q 4B3RQ 5BR8L 1HZ9A 3W5OA 2B63G 4HJ8A 3VDYA 2UU9Q 2UXBL 2F4VL 4C3HH 2Z6KC 1PYBA 2QGQA 1P8LA 4LF9Q 1E3PA 2CWAA 4DV0Q 1X55A 2JK8A 5JEAJ 4IOAA 2RHSB 2VW9A 1RL2A 4JI4Q 4H02A 1EOVA 5DLQE 4DR2Q 4BBRG 1FJGQ 2XGTA 4QY7A 3KJPA 1JJGA 2JA5G 1L2FA 1KQSA 5IYCH 3W1BA 1JB7A 3PCOB 1X3FA 4JI3Q 4X62L 2E2IH 5GAEC 1J5EQ 4BY1G 3G4SA 3FP9A 3CCUA 1OXSC 4DV2L 2YTVA 2KBNA 1WI5A 4LFBL 3M85A 4A3LH 3PIPA 4FDBA 2VUMH 2WAQE 1BVSA 2BH8A 1HZBA 3A74A 3MXNB 4YY3L 2JEBI 4JBKA 2VS1A 2EXDA 5IP9H 3HOZH 1VQBA 1Y14B 4RMFA 1NJIC 2R93G 3PO3H 5IYBG 4DV4L 3CCQA 4IFDG 1A8VA 1LUZA 2KHJA 4AQYQ 3UDXA 4JI7Q 4DUYQ 1XNQQ 3I4MH 4ME3A 1NMFA 3S1MH 3FKIH 2XTIA 1T9HA 4NXML 4A3DG 1YHBA 4JBMA 1NMGA 4YHHQ 2AHOB 3STBC 4DKAC 1CSPA 2UXCQ 1FGUA 5M3FG 2PI2A 4DR5Q 1C0AA 1HNXQ 4JOIA 1VQJA 2UUBL 4DR3Q 2K14A 4TQUS 1EYGA 1N32Q 1NY4A 1HNZQ 3M9BA 2JE6I 4R4QA 1VQPA 3J81c 1B8AA 4JBWA 3J7A5 1XMQL 1P16A 1VQEA 3AQQA 4A4IA 1FVIA 4HJAA 1Q8KA 1X3EA 1YI2A 4B3SQ 2ZTCA 1QVFA 3AFQA 2JA8G 4OWTB 4HJ5A 2BH2A 5GQOA 1Y1VH 2JQOA 1L1OB 1SFOH 2R7ZG 1BBWA 3T1HL 2ES2A 1B70B 1I3QH 4A3EG 1IYJB 1N33Q 4K0KL 3UDFA 3ULJA 2E5LQ 5FJ8H 2MQHA 3ULPA 1LYLA 4LW1A 1IBML 4LF4Q 4PG3A 1WOCA 5JJLA 1Q46A 3RLOA 3KF6A 1CSQA 3CMEA 4A93G 1YNXA 3HOYG 1KRSA 4DPGA 3J7ZC 4J15A 1RIPA 3A0JA 4C2MH 3NELA 3K7UC 2V1CC 1QVGA 4Y52H 1K9MC 4UP8A 4JI1L 2E8GA 2VQFL 2Q2HA 1VQOA 2A8VA 3KYHC 2MFIA 4KI0A 4JG2A 4X64L 4HJ7A 2NN6I 1IZ6A 3AYHB 4IPCA 1Q82C 4IJHA 4YWMA 4NXNL 5C0XG 2K75A 1I94Q 1JJ2A 1BKBA 2IX0A 4GKKQ 1SN8A 5C3EG 2JA6H 3GTMH 5IYDG 4L5TA 2KENA 1EIFA 3GTQH 5BR8Q 2AWOA 2OCEA 4AIMA 3CCJA 4DR1L 4LF7L 5J3BA 2N78A 5C0XI 4DAYB 2UUAL 3KDFA 2ZM6L 1EQQA 2LXKA 1EIYB 5GROA 2VNUD 3PUXA 2H5XA 2K4KA 1K83H 3E0EA 3EN2A 4P71A 4DNIA 4X65L 1MIUA 4DV3Q 2N49A 3OTOL 1TXYA 1XJVA 1XPRA 3H15A 1PH9A 2F3IA 2MO1A 2LXJA 3K81C 4DV5L 2MO0A 1PH6A 3EBEA 1TWGH 3KFUA 3T1YL 3S1RH 2FXQA 1YEZA 5HGQA 1KRTA 5FLXc 2WB1G 1W2BA 1KC8C 1KD1C 3S17H 4A3CH 1MJCA 4DK3C 4X62Q 4GLAC 2VY3A 4A3KH 2A19A 4KLKA 4A3GH 1OXUA 2D0PA 4DV2Q 3K7AH 4DR7L 3D0FA 4OWWB 1YHAA 1YHQA 3H0GG 4JI2L 3UDIA 2JEAI 1NE3A 3DLLA 3A5ZB 2ZJRA 4BXXG 4PZ8A 2GN5A 3BU2A 4BY7H 3SGIA 1WCMG 1R9TH 4UY8C 1OXTA 1E24A 1K0RA 3ERSX 4IPGA 4X66Q 5C44H 5LMUQ 4IO9A 3CPFA 3HOUH 4OO1I 1PVOA 5EAYA 3GD7A 4X6AH 1TWHH 1Z47A 4YY3Q 3CPWA 1VQ9A 1D7QA 2OWOA 2IY5B 4JCVE 1EQRA 1TWCH 1XMOL 1CKNA 4DV7Q 4DV4Q 1YZ6A 4A3BH 4OX9L 3GTLH 4O2DA 2CCZA 1JMCA 1VQFA 2Z0SA 4NB3A 3IRBA 2E2JH 1GVPA 2B3GA 2WP8J 2R7FA 3G48A 3F2CA 1K3RA 3KF8B 4LWCA 4NXMQ 4JV5L 2IHEA 2C35B 2D0OA 3FHWA 2YTXA 4OXPA 4GNXC 3W1GA 4DR6L 4R1JA 5LMNL 2UXDL 4LF8L 1KIXA 2UUBQ 1GO3E 3ER0A 4GNXA 4R4TA 3HOXH 3J81i 2QEXA 1HNWL 1GKHA 4LFAQ 1N36Q 4POFA 4IFDJ 5IYCG 4IJLA 1WJJA 3J80c 1GM5A 2AKWB 1Q81C 2NVTH 1S40A 4P74A 3KF6B 2IX1A 2NZOA 5ELOA 3B6YA 3K8AA 4JBJA 3TREA 4B3ML 3RN5A 1SE8A 4P73A 1PYSB 1VQIA 2E2HH 4A3LG 1Q12A 4IPHA 4DUZL 3GTPH 1VQ5A 2I5LX 3OYYA 5HY6A 1A62A 2N8NA 3PUVA 3T1HQ 1YJWA 5LMNW 2VUMG 2ASBA 4WJ3M 1QVCA 4HJ9A 4JI6Q 5AJ3L 3PGZA 4YCUA 5M5WH 1X9NA 4LF5Q 5H1SE 2PMZE 4JOIC 5IP9G 3HOZG 1U5KA 4HIMA 2K5NA 2EQSA 2LSSA 2MNAA 1KAWA 3PO3G 1K8GA 4KHZA 4A3IH 4IFDI 1D8LA 1GD7A 1JE5A 3UDGA 5M3MH 3ICEA 2KCMA 1Q1BA 3PO2H 1X6OA 4B3RL 5JJIA 3I4MG 4A3MH 2VZAA 2UU9L 2JA9A 3FKIG 1YJNA 4KHPL 1UE7A 4AYBE 5FLMH 3CMAA 2ID0A 2YYZA 1M1KC 2AMCB 4JI8L 3PSIA 3G71A 4DV0L 4C3JH 3F2DA 1VQ7A 2NVXH 2K5VA 2PNHA 4POGA 4P75A 4B3TQ 3F2BA 3KDFB 2PI2E 3I4NH 1VCIA 1HR0L 1Q1EA 2A1AA 2ZJPA 4NPSA 5C4XH 1CKMA 3CF5A 2VQEQ 3PUWA 4Y7NH 3GDEA 3I4OA 4JI3L 4GLVB 4DV1L 3CW2C 4BBSH 2N3SA 1EUJA 3F1ZA 4BA1I 4GOPC 1V43A 2YV5A 4WJ4A 1MJEA 1N34L 1TWAH 3D31A 3UE1A 1QUQB 1Y1VG 4DR1Q 2NVQH 4GOPA 3BZKA 1W3SA 3L0OA 2CKZB 4EQ5A 1XNRQ 3HOWH 3HKZG 2NZHA 4XTCS 1L0WA 1Q86C 4MTNA 2UUCQ 2B29A 1UE6A 4XIGS 1YIJA 1HR0W 1OTCA 1A63A 5FJ8G 2HQLA 3OTOQ 5C0XJ 3RLNA 3PF4A 1YJ9A 1UE1A 2DGYA 3S1QH 5IP7H 3RNUA 3M3YH 2AWNA 1IBLL 2YU9H 1SRUA 1XTDA 1AE3A 2RCNA 3AFPA 4AQYL 1Z9FA 5GAHC 1PH2A 1CUKA 1VQNA 2CQOA 4YHHL 2R92H 3NENA 2Y0SG 3BJUA 1VQMA 4DR4Q 2UXCL 4A3JH 2I5MX 1LM0A 1HNXL 4JI5Q 1QZGA 1E1OA 4R4IA 3U58A 1SR3A 2ATWA 2UXBQ 5IWAL 1HNZL 4IPDA 1VQLA 4C3IH 1OXVA 2JA7H 4QQBX 2GVAA 2F4VQ 4GNXB 3AEVA 4PZ6A 3RZOH 4B3SL 4GS3A 5JJKA 3JAMc 2KCTA 4OX9Q 2I0QA 3H3VI 2D62A 1VQGA 2OQKA 1C7YA 4LFCL 4YCVA 3U50C 1YVCA 1FL0A 2IHFA 2OTJA 1G291 2K5HA 5ELNA 1ASZA 3KOJA 2JA6G 2DUDA 4DR6Q 1AH9A 3HOVH 3CCVA 1B7YB 4LFBQ 4IOCA 3CCRA 3RR5A 3RN2A 3J80i 1HNWQ 2R7DA 3HKSA 4MZ9A 4A3CG 4A3FH 3PUZA 1PH3A 1VQDA 5IT9c 4A3KG 1VQ8A 1L1OA 1EWIA 3ZJYC 4A3GG 1PH1A 3NBHB 1SMXA 4GN3B 1Y1WH 1E7ZA 2HHHL 1PH7A 2VL6A 4DUZQ 1PV4A 5E7NA 1PFSA 4OONA 2L15A 1IBKL 3CC4A 4A75A 3TS0A 4BY7G 4GKJL 3STBD 1C9OA 5C44G 3HOUG 3CCSA 5M5XH 2ZJQA 4QJFA 2WFWA 2B63H 2HIVA 3M4PA 3S2DH 3S15H 3GTKH 1I94L 2F52A 4DV6L 3CP0A 2WAQG 1NTGA 4AH6A 1KXLA 2WB1E 4A3BG 1Q7YC 3M4QA 1VQAA 5IY0A 1X3GA 3EIVA 1BBUA 4KHPQ 1VQHA 1WFQA 4BBRH 3GTJH 3CC2A 3GO5A 2JA5H 1XMQQ 3OW2A 2PQAA 4JI8Q 2BA0A 3S2HH 3ULLA 4DV3L 4GOPB 2K52A 4BY1H 1UWVA 1S3OA 2Z6KA 4APVA 4JYAL 4UP7A 3HOXG 1HR0Q 3L7ZC 3S16H 2EIFA 3TRZA 1PH5A 1VQCA 1UE5A 1N9WA 4DV1Q 3DM3A 4K0KQ 3U4ZA 3CCMA 4LNQA 1SLJA 1PH4A 1YBYA 3G6EA 5JEAG 1N34Q 1IBMQ 4AYBG 3PF5A 3M4OH 2HIXA 3TEHB 1S72A 1PH8A 3CD6A 1HJPA 4JI0L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CQZ H;  3A5U A;  3L2P A;  2R93 H;  3TQY A;  5IYB H;  1K73 C;  4PMW A;  3E9I A;  4LF6 L;  1HH2 P;  1I50 H;  1TWF H;  2GVB A;  4UPA A;  4X66 L;  5LMU L;  1EFW A;  1VQK A;  1JT8 A;  1HZA A;  4A3D H;  5GAG C;  4JI1 Q;  2VQF Q;  1K8A C;  1H95 A;  3I55 A;  4LF9 L;  4A3I G;  5M3F H;  3E9H A;  4DV7 L;  1IBL Q;  4X64 Q;  5M3M G;  1X56 A;  2RF4 A;  3JC6 6;  4R4C A;  4HID A;  3NEM A;  3PO2 G;  4A3M G;  4LUO A;  4JI4 L;  4DR2 L;  1FJG L;  3CCL A;  5FLM G;  4NXN Q;  4O0A A;  3CCE A;  1U0L A;  1J5E L;  1KHI A;  2IT1 A;  3M7N A;  1JJC B;  4DAM A;  3I4N G;  3PV0 A;  1O7I A;  5IWA Q;  2JA8 H;  2R6G A;  1OXX K;  2CFM A;  4LF7 Q;  4LFA L;  5C4X G;  4JC0 A;  1N36 L;  2R7Z H;  5IE8 A;  2UUA Q;  4A3E H;  1NBW A;  2ZM6 Q;  3PUY A;  1M90 C;  4BBS G;  2Q2I A;  3JAM i;  3RZD H;  2BA1 A;  4X65 Q;  3I7F A;  2QA4 A;  5GAD C;  3K80 C;  4HIK A;  1N8R C;  4DK6 C;  4LFC Q;  2CWP A;  4TVA B;  4DV5 Q;  3HOW G;  1IL2 A;  3T1Y Q;  4HIO A;  4A93 H;  2JJQ A;  2ALY B;  3HOY H;  3KLW A;  3CC7 A;  2ZTE A;  4JI6 L;  5M5Y H;  2NVY H;  4GN4 B;  4JI7 L;  1XNQ L;  4DUY L;  1CKN B;  4OWX B;  1MKH A;  4LF5 L;  1LTL A;  1KL9 A;  1SRO A;  3F8T A;  1I6H H;  4DR7 Q;  5K36 G;  5IP7 G;  1IXR A;  4JI2 Q;  4L5Q A;  4QL5 A;  4DR5 L;  2ZTD A;  4UP9 A;  4EX5 A;  4DR3 L;  2OTL A;  3LGJ A;  4PZ7 A;  2K50 A;  1WYD A;  2NN6 G;  1N32 L;  1V1Q A;  3J81 j;  1G51 A;  4GN5 A;  4P72 A;  4R4O A;  4YCW A;  2HHH Q;  4L5R C;  2R92 G;  2RHQ B;  1AE2 A;  4A3J G;  1XMO Q;  5C3E H;  3HKZ E;  1VQ6 A;  1X54 A;  3WWV A;  1IBK Q;  4B3T L;  3I56 A;  2KHI A;  1PA6 A;  4GKJ Q;  5IYD H;  3H3V H;  2PQA B;  3PIO A;  1A0I A;  2JA7 G;  4QGU A;  2VQE L;  4ALP A;  4JV5 Q;  4DV6 Q;  1G6P A;  4GLX A;  1N33 L;  3U4V A;  1DGS A;  2HT1 A;  5LMN Q;  2E5L L;  4LF8 Q;  2UXD Q;  3I2Z A;  4YWL A;  4LF4 L;  1VQ4 A;  2Q2T A;  1UEB A;  1L1O C;  4A76 A;  1XNR L;  1E22 A;  2I5H A;  2Y0S E;  4LUV A;  3S14 H;  3CAM A;  3S24 A;  1QZH A;  1I5F A;  2UUC L;  4B3M Q;  3HFZ B;  3HOV G;  3MEF A;  2OQ0 A;  4JYA Q;  1X65 A;  5C4J H;  1CKO A;  1VS0 A;  2YTY A;  3KJO A;  1YIT A;  2Q2U A;  3H0G H;  1XPU A;  1J6Q A;  3GTO H;  3S1N H;  3TS2 A;  3RLF A;  4L5S A;  4A3F G;  4BXX H;  1XPO A;  4LUZ A;  1QUQ A;  3Q8D A;  3K0X A;  1WCM H;  1PHJ A;  4RG1 A;  1E1T A;  5AJ3 Q;  4BA2 I;  1ASY A;  4OO1 G;  1Y1W G;  4DR4 L;  3BZC A;  4YWK A;  4MNO A;  4QIW E;  3GTG H;  4GKK L;  1V9P A;  4JI0 Q;  1HZC A;  4JI5 L;  3UE0 A;  3CXC A;  4LF6 Q;  4B3R Q;  5BR8 L;  1HZ9 A;  3W5O A;  2B63 G;  4HJ8 A;  3VDY A;  2UU9 Q;  2UXB L;  2F4V L;  4C3H H;  2Z6K C;  1PYB A;  2QGQ A;  1P8L A;  4LF9 Q;  1E3P A;  2CWA A;  4DV0 Q;  1X55 A;  2JK8 A;  5JEA J;  4IOA A;  2RHS B;  2VW9 A;  1RL2 A;  4JI4 Q;  4H02 A;  1EOV A;  5DLQ E;  4DR2 Q;  4BBR G;  1FJG Q;  2XGT A;  4QY7 A;  3KJP A;  1JJG A;  2JA5 G;  1L2F A;  1KQS A;  5IYC H;  3W1B A;  1JB7 A;  3PCO B;  1X3F A;  4JI3 Q;  4X62 L;  2E2I H;  5GAE C;  1J5E Q;  4BY1 G;  3G4S A;  3FP9 A;  3CCU A;  1OXS C;  4DV2 L;  2YTV A;  2KBN A;  1WI5 A;  4LFB L;  3M85 A;  4A3L H;  3PIP A;  4FDB A;  2VUM H;  2WAQ E;  1BVS A;  2BH8 A;  1HZB A;  3A74 A;  3MXN B;  4YY3 L;  2JEB I;  4JBK A;  2VS1 A;  2EXD A;  5IP9 H;  3HOZ H;  1VQB A;  1Y14 B;  4RMF A;  1NJI C;  2R93 G;  3PO3 H;  5IYB G;  4DV4 L;  3CCQ A;  4IFD G;  1A8V A;  1LUZ A;  2KHJ A;  4AQY Q;  3UDX A;  4JI7 Q;  4DUY Q;  1XNQ Q;  3I4M H;  4ME3 A;  1NMF A;  3S1M H;  3FKI H;  2XTI A;  1T9H A;  4NXM L;  4A3D G;  1YHB A;  4JBM A;  1NMG A;  4YHH Q;  2AHO B;  3STB C;  4DKA C;  1CSP A;  2UXC Q;  1FGU A;  5M3F G;  2PI2 A;  4DR5 Q;  1C0A A;  1HNX Q;  4JOI A;  1VQJ A;  2UUB L;  4DR3 Q;  2K14 A;  4TQU S;  1EYG A;  1N32 Q;  1NY4 A;  1HNZ Q;  3M9B A;  2JE6 I;  4R4Q A;  1VQP A;  3J81 c;  1B8A A;  4JBW A;  3J7A 5;  1XMQ L;  1P16 A;  1VQE A;  3AQQ A;  4A4I A;  1FVI A;  4HJA A;  1Q8K A;  1X3E A;  1YI2 A;  4B3S Q;  2ZTC A;  1QVF A;  3AFQ A;  2JA8 G;  4OWT B;  4HJ5 A;  2BH2 A;  5GQO A;  1Y1V H;  2JQO A;  1L1O B;  1SFO H;  2R7Z G;  1BBW A;  3T1H L;  2ES2 A;  1B70 B;  1I3Q H;  4A3E G;  1IYJ B;  1N33 Q;  4K0K L;  3UDF A;  3ULJ A;  2E5L Q;  5FJ8 H;  2MQH A;  3ULP A;  1LYL A;  4LW1 A;  1IBM L;  4LF4 Q;  4PG3 A;  1WOC A;  5JJL A;  1Q46 A;  3RLO A;  3KF6 A;  1CSQ A;  3CME A;  4A93 G;  1YNX A;  3HOY G;  1KRS A;  4DPG A;  3J7Z C;  4J15 A;  1RIP A;  3A0J A;  4C2M H;  3NEL A;  3K7U C;  2V1C C;  1QVG A;  4Y52 H;  1K9M C;  4UP8 A;  4JI1 L;  2E8G A;  2VQF L;  2Q2H A;  1VQO A;  2A8V A;  3KYH C;  2MFI A;  4KI0 A;  4JG2 A;  4X64 L;  4HJ7 A;  2NN6 I;  1IZ6 A;  3AYH B;  4IPC A;  1Q82 C;  4IJH A;  4YWM A;  4NXN L;  5C0X G;  2K75 A;  1I94 Q;  1JJ2 A;  1BKB A;  2IX0 A;  4GKK Q;  1SN8 A;  5C3E G;  2JA6 H;  3GTM H;  5IYD G;  4L5T A;  2KEN A;  1EIF A;  3GTQ H;  5BR8 Q;  2AWO A;  2OCE A;  4AIM A;  3CCJ A;  4DR1 L;  4LF7 L;  5J3B A;  2N78 A;  5C0X I;  4DAY B;  2UUA L;  3KDF A;  2ZM6 L;  1EQQ A;  2LXK A;  1EIY B;  5GRO A;  2VNU D;  3PUX A;  2H5X A;  2K4K A;  1K83 H;  3E0E A;  3EN2 A;  4P71 A;  4DNI A;  4X65 L;  1MIU A;  4DV3 Q;  2N49 A;  3OTO L;  1TXY A;  1XJV A;  1XPR A;  3H15 A;  1PH9 A;  2F3I A;  2MO1 A;  2LXJ A;  3K81 C;  4DV5 L;  2MO0 A;  1PH6 A;  3EBE A;  1TWG H;  3KFU A;  3T1Y L;  3S1R H;  2FXQ A;  1YEZ A;  5HGQ A;  1KRT A;  5FLX c;  2WB1 G;  1W2B A;  1KC8 C;  1KD1 C;  3S17 H;  4A3C H;  1MJC A;  4DK3 C;  4X62 Q;  4GLA C;  2VY3 A;  4A3K H;  2A19 A;  4KLK A;  4A3G H;  1OXU A;  2D0P A;  4DV2 Q;  3K7A H;  4DR7 L;  3D0F A;  4OWW B;  1YHA A;  1YHQ A;  3H0G G;  4JI2 L;  3UDI A;  2JEA I;  1NE3 A;  3DLL A;  3A5Z B;  2ZJR A;  4BXX G;  4PZ8 A;  2GN5 A;  3BU2 A;  4BY7 H;  3SGI A;  1WCM G;  1R9T H;  4UY8 C;  1OXT A;  1E24 A;  1K0R A;  3ERS X;  4IPG A;  4X66 Q;  5C44 H;  5LMU Q;  4IO9 A;  3CPF A;  3HOU H;  4OO1 I;  1PVO A;  5EAY A;  3GD7 A;  4X6A H;  1TWH H;  1Z47 A;  4YY3 Q;  3CPW A;  1VQ9 A;  1D7Q A;  2OWO A;  2IY5 B;  4JCV E;  1EQR A;  1TWC H;  1XMO L;  1CKN A;  4DV7 Q;  4DV4 Q;  1YZ6 A;  4A3B H;  4OX9 L;  3GTL H;  4O2D A;  2CCZ A;  1JMC A;  1VQF A;  2Z0S A;  4NB3 A;  3IRB A;  2E2J H;  1GVP A;  2B3G A;  2WP8 J;  2R7F A;  3G48 A;  3F2C A;  1K3R A;  3KF8 B;  4LWC A;  4NXM Q;  4JV5 L;  2IHE A;  2C35 B;  2D0O A;  3FHW A;  2YTX A;  4OXP A;  4GNX C;  3W1G A;  4DR6 L;  4R1J A;  5LMN L;  2UXD L;  4LF8 L;  1KIX A;  2UUB Q;  1GO3 E;  3ER0 A;  4GNX A;  4R4T A;  3HOX H;  3J81 i;  2QEX A;  1HNW L;  1GKH A;  4LFA Q;  1N36 Q;  4POF A;  4IFD J;  5IYC G;  4IJL A;  1WJJ A;  3J80 c;  1GM5 A;  2AKW B;  1Q81 C;  2NVT H;  1S40 A;  4P74 A;  3KF6 B;  2IX1 A;  2NZO A;  5ELO A;  3B6Y A;  3K8A A;  4JBJ A;  3TRE A;  4B3M L;  3RN5 A;  1SE8 A;  4P73 A;  1PYS B;  1VQI A;  2E2H H;  4A3L G;  1Q12 A;  4IPH A;  4DUZ L;  3GTP H;  1VQ5 A;  2I5L X;  3OYY A;  5HY6 A;  1A62 A;  2N8N A;  3PUV A;  3T1H Q;  1YJW A;  5LMN W;  2VUM G;  2ASB A;  4WJ3 M;  1QVC A;  4HJ9 A;  4JI6 Q;  5AJ3 L;  3PGZ A;  4YCU A;  5M5W H;  1X9N A;  4LF5 Q;  5H1S E;  2PMZ E;  4JOI C;  5IP9 G;  3HOZ G;  1U5K A;  4HIM A;  2K5N A;  2EQS A;  2LSS A;  2MNA A;  1KAW A;  3PO3 G;  1K8G A;  4KHZ A;  4A3I H;  4IFD I;  1D8L A;  1GD7 A;  1JE5 A;  3UDG A;  5M3M H;  3ICE A;  2KCM A;  1Q1B A;  3PO2 H;  1X6O A;  4B3R L;  5JJI A;  3I4M G;  4A3M H;  2VZA A;  2UU9 L;  2JA9 A;  3FKI G;  1YJN A;  4KHP L;  1UE7 A;  4AYB E;  5FLM H;  3CMA A;  2ID0 A;  2YYZ A;  1M1K C;  2AMC B;  4JI8 L;  3PSI A;  3G71 A;  4DV0 L;  4C3J H;  3F2D A;  1VQ7 A;  2NVX H;  2K5V A;  2PNH A;  4POG A;  4P75 A;  4B3T Q;  3F2B A;  3KDF B;  2PI2 E;  3I4N H;  1VCI A;  1HR0 L;  1Q1E A;  2A1A A;  2ZJP A;  4NPS A;  5C4X H;  1CKM A;  3CF5 A;  2VQE Q;  3PUW A;  4Y7N H;  3GDE A;  3I4O A;  4JI3 L;  4GLV B;  4DV1 L;  3CW2 C;  4BBS H;  2N3S A;  1EUJ A;  3F1Z A;  4BA1 I;  4GOP C;  1V43 A;  2YV5 A;  4WJ4 A;  1MJE A;  1N34 L;  1TWA H;  3D31 A;  3UE1 A;  1QUQ B;  1Y1V G;  4DR1 Q;  2NVQ H;  4GOP A;  3BZK A;  1W3S A;  3L0O A;  2CKZ B;  4EQ5 A;  1XNR Q;  3HOW H;  3HKZ G;  2NZH A;  4XTC S;  1L0W A;  1Q86 C;  4MTN A;  2UUC Q;  2B29 A;  1UE6 A;  4XIG S;  1YIJ A;  1HR0 W;  1OTC A;  1A63 A;  5FJ8 G;  2HQL A;  3OTO Q;  5C0X J;  3RLN A;  3PF4 A;  1YJ9 A;  1UE1 A;  2DGY A;  3S1Q H;  5IP7 H;  3RNU A;  3M3Y H;  2AWN A;  1IBL L;  2YU9 H;  1SRU A;  1XTD A;  1AE3 A;  2RCN A;  3AFP A;  4AQY L;  1Z9F A;  5GAH C;  1PH2 A;  1CUK A;  1VQN A;  2CQO A;  4YHH L;  2R92 H;  3NEN A;  2Y0S G;  3BJU A;  1VQM A;  4DR4 Q;  2UXC L;  4A3J H;  2I5M X;  1LM0 A;  1HNX L;  4JI5 Q;  1QZG A;  1E1O A;  4R4I A;  3U58 A;  1SR3 A;  2ATW A;  2UXB Q;  5IWA L;  1HNZ L;  4IPD A;  1VQL A;  4C3I H;  1OXV A;  2JA7 H;  4QQB X;  2GVA A;  2F4V Q;  4GNX B;  3AEV A;  4PZ6 A;  3RZO H;  4B3S L;  4GS3 A;  5JJK A;  3JAM c;  2KCT A;  4OX9 Q;  2I0Q A;  3H3V I;  2D62 A;  1VQG A;  2OQK A;  1C7Y A;  4LFC L;  4YCV A;  3U50 C;  1YVC A;  1FL0 A;  2IHF A;  2OTJ A;  1G29 1;  2K5H A;  5ELN A;  1ASZ A;  3KOJ A;  2JA6 G;  2DUD A;  4DR6 Q;  1AH9 A;  3HOV H;  3CCV A;  1B7Y B;  4LFB Q;  4IOC A;  3CCR A;  3RR5 A;  3RN2 A;  3J80 i;  1HNW Q;  2R7D A;  3HKS A;  4MZ9 A;  4A3C G;  4A3F H;  3PUZ A;  1PH3 A;  1VQD A;  5IT9 c;  4A3K G;  1VQ8 A;  1L1O A;  1EWI A;  3ZJY C;  4A3G G;  1PH1 A;  3NBH B;  1SMX A;  4GN3 B;  1Y1W H;  1E7Z A;  2HHH L;  1PH7 A;  2VL6 A;  4DUZ Q;  1PV4 A;  5E7N A;  1PFS A;  4OON A;  2L15 A;  1IBK L;  3CC4 A;  4A75 A;  3TS0 A;  4BY7 G;  4GKJ L;  3STB D;  1C9O A;  5C44 G;  3HOU G;  3CCS A;  5M5X H;  2ZJQ A;  4QJF A;  2WFW A;  2B63 H;  2HIV A;  3M4P A;  3S2D H;  3S15 H;  3GTK H;  1I94 L;  2F52 A;  4DV6 L;  3CP0 A;  2WAQ G;  1NTG A;  4AH6 A;  1KXL A;  2WB1 E;  4A3B G;  1Q7Y C;  3M4Q A;  1VQA A;  5IY0 A;  1X3G A;  3EIV A;  1BBU A;  4KHP Q;  1VQH A;  1WFQ A;  4BBR H;  3GTJ H;  3CC2 A;  3GO5 A;  2JA5 H;  1XMQ Q;  3OW2 A;  2PQA A;  4JI8 Q;  2BA0 A;  3S2H H;  3ULL A;  4DV3 L;  4GOP B;  2K52 A;  4BY1 H;  1UWV A;  1S3O A;  2Z6K A;  4APV A;  4JYA L;  4UP7 A;  3HOX G;  1HR0 Q;  3L7Z C;  3S16 H;  2EIF A;  3TRZ A;  1PH5 A;  1VQC A;  1UE5 A;  1N9W A;  4DV1 Q;  3DM3 A;  4K0K Q;  3U4Z A;  3CCM A;  4LNQ A;  1SLJ A;  1PH4 A;  1YBY A;  3G6E A;  5JEA G;  1N34 Q;  1IBM Q;  4AYB G;  3PF5 A;  3M4O H;  2HIX A;  3TEH B;  1S72 A;  1PH8 A;  3CD6 A;  1HJP A;  4JI0 L; 
#chains in the Genus database with same CATH topology
 2R93 H;  3E6Z X;  5IYB H;  3HOY B;  2XRS D;  5M5Y B;  1JT8 A;  4N8X 1;  4FF1 A;  4G4K A;  5GAG C;  1G2T A;  1B4O A;  4A3I G;  3DHQ A;  1CT1 D;  1RJT A;  1X56 A;  3JC6 6;  1IKM A;  3NEM A;  4JI4 L;  4M8A A;  3L9A X;  3K5O A;  1QIL A;  4O0A A;  2D2C C;  1D5M C;  4HCS A;  1U0L A;  2F03 A;  2IT1 A;  4C3J G;  2F0S A;  1F9P A;  1JJC B;  1VMC A;  4DAM A;  3CHB D;  4Z9C B;  5DM6 3;  4KJN A;  1SYD A;  2Z4I A;  2R7Z H;  4CBV A;  5IE8 A;  2UUA Q;  1A6X A;  2B2U C;  4KMU C;  2HDL A;  3JAM i;  3RZD H;  4OIJ A;  4X65 Q;  1CQV A;  2QA4 A;  1ESR A;  1JE4 A;  4J1M A;  5GAD C;  3I90 A;  4TVA B;  3HOW G;  1EY7 A;  2WKD A;  3J81 E;  2ZTE A;  3CC7 A;  1XNQ L;  1RTO A;  4OWX B;  3PIP 3;  3C46 A;  1I6H H;  2A69 C;  4DR7 Q;  1CK1 A;  2FIN B;  2L11 A;  3FRP B;  4DR5 L;  3S1N B;  4UP9 A;  3S1R B;  1N32 L;  1WYD A;  4A3G B;  1D2B A;  2HHH Q;  3K7A B;  1AE2 A;  2DJF C;  1IBK Q;  5EBC A;  2OEO A;  4BY7 B;  2M2L A;  4C3I G;  5E1F A;  4C3H B;  1N33 L;  1DGS A;  5LMN Q;  2E5L L;  3IFD A;  2QKI C;  4YWL A;  1HA6 A;  1PRT D;  4QUC A;  1E22 A;  1K8O A;  4OHJ A;  1EY8 A;  2MP1 A;  3JAM L;  4B3M Q;  2RDH A;  2QIL A;  5C4J H;  1LT4 D;  1J6Q A;  3FDT A;  2L1B A;  1JWU D;  4LUZ A;  1PHJ A;  3K0X A;  1E1T A;  2NVT B;  1ASY A;  1WTR A;  3LWE A;  4GKK L;  3GTG H;  2E2H B;  4FF4 A;  1V9P A;  3NQT A;  1HZC A;  2F0W A;  5IT9 L;  3HZX A;  3UE0 A;  1VMP A;  2R3Z A;  4LF6 Q;  4HJ8 A;  1TII D;  4NKL A;  1FR3 A;  4KTA A;  1RKN A;  3FKI B;  4RCN A;  2L4N A;  1OO9 B;  1P8L A;  2QGQ A;  1BOS A;  5ELB A;  4IOA A;  1DJR D;  1ET6 A;  1XWE A;  5C3X A;  3NHH A;  4DR2 Q;  4BBR G;  1FJG Q;  4QY7 A;  3KJP A;  2EY2 A;  5IYC H;  4X62 L;  3BYT B;  3NWS A;  3CCU A;  1OXS C;  2YTV A;  3TN2 A;  1WI5 A;  1EFI D;  4QF4 A;  3PIP A;  1BCP F;  5C4X B;  4WJW A;  1CA5 A;  1BVS A;  3H91 A;  3TP8 A;  3TZU A;  4RMF A;  2R93 G;  2PO4 A;  5IYB G;  1A8V A;  1YNN D;  4AQY Q;  3RMH A;  3V96 A;  4JI7 Q;  1B53 A;  4CGY B;  4DUY Q;  1NMF A;  1Z6H A;  2XTI A;  1YHB A;  1BNZ A;  3TME A;  3S1Q B;  5LL6 X;  1C0A A;  3M3Y B;  3D6W A;  2UUB L;  1HQM C;  4K14 A;  2JE6 I;  1HRJ A;  4B9W A;  5CBA E;  4R9W A;  3J7A 5;  1MSG A;  1Q8K A;  1YI2 A;  3Q23 A;  4RWS C;  1L1O B;  2R7Z G;  1BBW A;  2JXM B;  1B70 B;  4QIW B;  5IGD A;  2BDN A;  4K0K L;  4IN3 A;  3TP5 A;  4ILW A;  4OEM B;  2MQH A;  1LYL A;  2TMP A;  4KHV A;  4LW1 A;  4ZLT F;  1WOC A;  1CHP D;  4QMG A;  1Q46 A;  4K8J A;  1CSQ A;  2K28 A;  2RVL A;  4OGQ C;  3T13 A;  4ULL A;  2EY6 A;  3A0J A;  4C2M H;  2XIW A;  5L37 A;  1KDC A;  2E8G A;  3BVM A;  2BDO A;  2KUM A;  2EYJ A;  3KYH C;  4X64 L;  4A3F B;  1STB A;  1Q82 C;  2BE5 C;  2Z9H A;  1I94 Q;  1JJ2 A;  5IGC A;  1TWH B;  2RA4 A;  3NPP A;  5DNF A;  2MPM A;  5IGF A;  3GTM H;  2NWG A;  3L3O C;  1SNP A;  2FFK B;  4RGT A;  1I4X A;  2AWO A;  4A3B B;  3CCJ A;  4DR1 L;  1A15 A;  1JQY D;  5J3B A;  2N78 A;  5E3F A;  4DAY B;  3S15 B;  3KDF A;  3PMF A;  2DY8 A;  3PUX A;  2H5X A;  4DNI A;  3EN2 A;  1XJV A;  2JA6 H;  1UUP A;  1TXY A;  4DGZ A;  3VA5 A;  2LXJ A;  2F0D A;  1KNA A;  3T16 A;  2TSS A;  3S1R H;  1W2B A;  1B9N A;  1KD1 C;  1F9Q A;  4H7B A;  4A3K H;  4KLK A;  4A3G H;  3VYS A;  2ZXR A;  3A8K E;  3CRL C;  3K7A H;  3JAM E;  3WDN A;  1YHQ A;  2EVB A;  5COY A;  3HRZ C;  4AYB B;  1NE3 A;  3DEO A;  3NWT A;  3GTP B;  3S16 B;  2EJM A;  2GN5 A;  4BY7 H;  4UY8 C;  3M4Y A;  1E24 A;  3ERS X;  4IO9 A;  3CPF A;  4K6D A;  5M5W B;  3GD7 A;  1SYF A;  4YY3 Q;  3CPW A;  4KY7 A;  5CV6 A;  2IY5 B;  2EYH A;  1XMO L;  1CKN A;  2M9V A;  4A3I B;  2CCZ A;  3Q22 A;  3P75 A;  3HP3 A;  2C9O A;  5IT9 E;  1GVP A;  1VF5 C;  2K5W A;  3F2C A;  4NXM Q;  4GNX C;  4DR6 L;  5DEH A;  5M3F B;  4C3J B;  1GO3 E;  4GNX A;  3OMC A;  4R4T A;  1I4G A;  2QEX A;  1SND A;  3NP8 A;  5IYC G;  5KND A;  1GM5 A;  1QCB D;  2AKW B;  2NVT H;  2IX1 A;  1PRT C;  2AQ3 B;  3KF6 B;  4L63 B;  4MHE A;  3B6Y A;  3K8A A;  5G3L F;  3I4L A;  2E2H H;  5C4H A;  2NVQ B;  1YJW A;  2IX3 A;  5LMN W;  1Q90 A;  5D65 A;  3PGZ A;  3DXJ C;  4YCU A;  3K0Y A;  1X9N A;  3RD4 A;  3N52 A;  4RKB A;  2FMC A;  1ZEQ X;  4KHZ A;  4ZCK A;  1D8L A;  3AB9 A;  3ICE A;  2KCM A;  3K58 A;  1X6O A;  5D14 A;  2JA9 A;  1UE7 A;  4AYB E;  5JAV A;  5FLM H;  1JB3 A;  5EQ0 A;  1M1K C;  1LV9 A;  2AMC B;  3G71 A;  4DV0 L;  3F2D A;  2PNH A;  4POG A;  4B3T Q;  1HR0 L;  1SYC A;  1B50 A;  2K5Q A;  2PW5 A;  2A1A A;  5C4X H;  4C3I B;  1CKM A;  3PUW A;  3KK7 A;  3ND8 A;  3GDE A;  2MGS A;  4GLV B;  4DV1 L;  1EUJ A;  3R8B A;  2YV5 A;  4WJ4 A;  3QO2 A;  2B2W C;  4EQ5 A;  2NZH A;  1SBB B;  1L0W A;  2B39 A;  2B29 A;  1A63 A;  1YIJ A;  4DF7 A;  1YJ9 A;  2DGY A;  3S1Q H;  2B2Y C;  3M3Y H;  3O13 A;  1IBL L;  2YU9 H;  1IW7 C;  2WIN B;  1V1O A;  2A73 B;  2P5Z X;  5CC4 A;  4YHH L;  1YNN C;  5EKL A;  4A3J H;  3H0G B;  4F8M A;  1HNX L;  5IWA L;  1C48 A;  2GVA A;  1XX8 A;  3EFX D;  3OW7 A;  1Y8N B;  1QE6 A;  4PZ6 A;  4CDF C;  1SYG A;  4B3S L;  3E0J A;  4OX9 Q;  2D62 A;  3KLS X;  2F0N A;  1VQG A;  1GUO A;  2OQK A;  4LFC L;  2PCF B;  1T5X D;  1YVC A;  4QCL A;  1FL0 A;  4K5V A;  4BBR B;  3GTJ B;  3MWY W;  1U9R A;  1DOL A;  3KOJ A;  4NW2 A;  2JA6 G;  3HOV H;  1QJO A;  5KNB A;  1B7Y B;  4LFB Q;  3LX0 A;  4ZK9 B;  1STN A;  2H4O A;  4A3F H;  1BCP D;  4FNF A;  1BDO A;  4A3K G;  4A3G G;  1KTK A;  3LWU A;  4GN3 B;  3S9W A;  1E7Z A;  1PV4 A;  1PTO B;  4OON A;  2L15 A;  3CC4 A;  2R93 B;  4BY7 G;  1H9K A;  4GKJ L;  2VUM B;  1C9O A;  2A6E C;  3CCS A;  1G2S A;  4JW0 A;  3S15 H;  4DV6 L;  3CP0 A;  4KD4 A;  3D4W A;  4AH6 A;  3NK9 A;  2PW7 A;  2WB1 E;  5JPM C;  1BBU A;  1II3 A;  1U4R A;  2EOT A;  4RAU C;  4FF2 A;  3I4M B;  3GO5 A;  2JA5 H;  1XMQ Q;  2LY7 A;  4JI8 Q;  2SNS A;  3TP6 A;  2GA4 B;  1GHK A;  2NTT A;  2DJG C;  1I4Q A;  2Z6K A;  4JYA L;  4UP7 A;  2DNC A;  3L7Z C;  1K3B C;  3S16 H;  1I6V C;  5F2D A;  3TRZ A;  2EJG C;  1VQC A;  2F0F A;  1STG A;  2HUG A;  3RZD B;  1SSO A;  3TEH B;  1AN8 A;  1HJP A;  4JI0 L;  1Y1V B;  3A5U A;  3TQY A;  3E9I A;  2F0V A;  4X66 L;  1EFW A;  1NSN S;  4A3D H;  1I6H B;  4JI1 Q;  4LF9 L;  5M3F H;  3E9H A;  1KLG D;  4HID A;  3IAY A;  5FO8 B;  4LUO A;  1ENA A;  3AMU A;  3SK8 A;  5FLM G;  5C5M A;  4NXN Q;  4N9P A;  5JOB A;  1J5E L;  4IUT A;  3PV0 A;  5C4X G;  4JC0 A;  1SNC A;  4HTH A;  3R3O A;  1EY6 A;  3K80 C;  1CZW A;  4HIK A;  4DK6 C;  4DU9 A;  1YNJ D;  1IL2 A;  3T56 B;  4A93 H;  4ID6 A;  1O7L A;  2NVY H;  1G6Z A;  5HUR A;  4LAA A;  2OF1 A;  5D3I B;  1EY9 A;  2CH4 A;  1GUT A;  4QL5 A;  1H9J A;  3MXN A;  3MAQ A;  1G51 A;  4L5R C;  4MIU A;  4A3J G;  5C3E H;  3HKZ E;  3GTG B;  3GV3 A;  2KHI A;  1PA6 A;  1JWM D;  2NBF A;  1STA A;  4CDE C;  1Y69 U;  2HCI A;  1EWC A;  2F3W A;  4QGU A;  3A56 A;  2VQE L;  4ALP A;  4JV5 Q;  1TR5 A;  3VR3 A;  2ZT9 C;  3GQB A;  1EQT A;  1JCK B;  4A76 A;  5C4Z A;  2KA7 A;  4PMB A;  5JVH 3;  1QZH A;  3OWF A;  1KAB A;  5G3L D;  1MBY A;  3HFZ B;  3HOV G;  2OQ0 A;  2F4I A;  4ZQ3 A;  1X65 A;  1CKO A;  2WAC A;  2YTY A;  1SEB D;  3KJO A;  3TS2 A;  3H0G H;  4HMI A;  4L5S A;  1U4P A;  4A3F G;  2F0T A;  3GP7 A;  4RG1 A;  2F0G A;  4DR4 L;  4YWK A;  4JI5 L;  1PLF A;  4ABN A;  3CXC A;  4B3R Q;  5BR8 L;  1HZ9 A;  3SXH A;  2F4V L;  3BVG A;  5I6W A;  1PYB A;  2F0J A;  1E3P A;  4F88 A;  2B2V A;  2RHS B;  1IKL A;  4O42 A;  4JI4 Q;  3M7G A;  4H02 A;  3PO2 B;  3QOJ A;  1JJG A;  3U9S A;  2JA5 G;  3W1B A;  2F0M A;  1BO0 A;  5CYU A;  4DV2 L;  2KBN A;  2PZW A;  1RHP A;  2VUM H;  1KDB A;  2KCC A;  1TY2 A;  1B3Q A;  1LTB D;  1Z7T A;  1JWS D;  1HZB A;  5FK9 C;  1PMR A;  3URY A;  3TDQ A;  4JBK A;  3MTS A;  3HOZ H;  2KEC A;  4DV4 L;  1QWY A;  4RGO S;  5ELE A;  3I4M H;  1XNQ Q;  1PTO F;  4C2M B;  1S4Z A;  1T9H A;  4A3D G;  1WTW A;  1ROD A;  2PZU A;  2QF7 A;  2AHO B;  3NBI A;  5DAU A;  5ELD A;  1CSP A;  1FGU A;  5M3F G;  4DR5 Q;  3QR8 A;  4TQU S;  1N32 Q;  2A68 D;  1HNZ Q;  1F9S A;  4R4Q A;  1VQP A;  3J81 c;  1Y8O B;  5KIX A;  4HJA A;  1X3E A;  1PFM A;  3KF8 A;  3NSW A;  1I4P A;  3GTM B;  4KY5 A;  4HJ5 A;  5IGE A;  3K57 A;  1Y1V H;  1XTC D;  4HAE A;  3T1H L;  2ES2 A;  1N33 Q;  1XYI A;  2LFN A;  4WRD A;  3UDF A;  4HSP A;  3ULJ A;  2E5L Q;  5FJ8 H;  2JA6 B;  3SK5 A;  2EYO A;  1RCV D;  2I46 A;  1MGS A;  1F2M A;  4A93 G;  1YNX A;  1LTA D;  2QDL A;  3J7Z C;  3ERO A;  1NR2 A;  1HUN A;  4A3K B;  1K9M C;  1G91 A;  2Q2H A;  2WV6 D;  2MFI A;  4H0L C;  4JG2 A;  4HJ7 A;  1HXY D;  3UI2 A;  4ZYS A;  3AYH B;  5J39 A;  4IPC A;  1HFN A;  4CDD C;  1EU4 A;  2K75 A;  3SVM A;  2IX0 A;  4GKK Q;  5C3E G;  4IUV A;  5TSS A;  4AIM A;  1AP0 A;  4U68 A;  5C0X I;  2B63 B;  5EPK A;  2UUA L;  1LTT D;  3EQL C;  1EQQ A;  5IIF A;  4ME5 A;  5GRO A;  1EIY B;  4P71 A;  4X65 L;  1MD2 D;  1XPR A;  1MIU A;  4UDU C;  2N49 A;  5CBE E;  2ICE C;  1PH9 A;  3VYT A;  1WD0 A;  1EOT A;  1I4H A;  1YEZ A;  2MJ8 A;  2WB1 G;  1G8Z D;  4DK3 C;  4X62 Q;  1YNJ C;  4GLA C;  1E0B A;  2D0P A;  3W3A A;  1LT5 D;  4KV6 A;  1EYC A;  4K5X A;  4QUF A;  4DR7 L;  3D0F A;  1UAP A;  3H0G G;  3UDI A;  2JEA I;  2ZJR A;  3J7A V;  4PZ8 A;  2UXB L;  1D5X C;  4IUQ A;  1WTH A;  1QOH A;  1OXT A;  5LMU Q;  2K5D A;  3T53 B;  3A7L A;  4B08 A;  4X6A H;  1VQ9 A;  1LO5 D;  4DV7 Q;  4DAV A;  3CQZ B;  4O2D A;  4NB3 A;  3IRB A;  1TQO A;  3T4A C;  2R7F A;  3G48 A;  1K3R A;  4OXP A;  4J8Q A;  2MUY A;  5LMN L;  1CA6 A;  2PNR C;  4RHR A;  5J22 A;  3DWA A;  2UUB Q;  2K6A A;  4XT1 B;  1F9R A;  1HNW L;  1GKH A;  3CU7 A;  4LFA Q;  3SHL A;  1N36 Q;  2RSN A;  4POF A;  1Q81 C;  2N88 A;  5D3D A;  1S40 A;  4B3M L;  3RN5 A;  1SE8 A;  4P73 A;  4L6T B;  1VQI A;  5JEA H;  5CV9 A;  1DCZ A;  4IPH A;  1VQ5 A;  3OYY A;  2F0H A;  3PUV A;  4FF3 A;  2VUM G;  1QVC A;  3H09 A;  4JI6 Q;  5CV4 A;  4LF5 Q;  5H1S E;  3HOZ G;  1U5K A;  2LSS A;  2EXZ A;  1K8G A;  3TP7 A;  3D4D A;  1JE5 A;  2YU9 B;  5JJI A;  3PO2 H;  3I4M G;  4KHP L;  1YJN A;  2A5H A;  3NQI A;  2CVR A;  3VYR A;  3PSI A;  1SMY D;  4KD3 A;  4A3J B;  2NVX H;  1Q3L A;  4P75 A;  1PXU A;  4IUP A;  3KDF B;  3F2B A;  4FXG C;  1Q1E A;  2ZJP A;  1DON A;  2RDF A;  4BBS H;  3F1Z A;  4BA1 I;  2ICI A;  2QEJ C;  1V43 A;  4EVO A;  1N34 L;  3D31 A;  1QUQ B;  1STY A;  1Y1V G;  4DR1 Q;  1WTV A;  4X3K A;  2DY7 A;  3BZK A;  2JSO A;  2CKZ B;  3L0O A;  1XNR Q;  1X32 A;  3HKZ G;  4DN4 M;  4MTN A;  2UUC Q;  1UE6 A;  5FJ8 G;  3HOV B;  1H9S A;  2BOS A;  3HG9 A;  3VA7 A;  1LTR D;  3AFP A;  2RCN A;  4AQY L;  2HQE A;  4XQJ A;  1MI2 A;  2CQO A;  4EGV A;  2R92 H;  3BJU A;  1D1K A;  1LM0 A;  1V1P B;  4IAL A;  3U58 A;  5BN4 A;  5CV5 A;  2CQA A;  4IPD A;  1S5B D;  1WCM B;  4B9X A;  1VQL A;  2JA7 H;  4RGM A;  4QQB X;  2XNA C;  3Q24 A;  4GNX B;  2A68 C;  4GS3 A;  3JAM c;  2I0Q A;  4RA8 A;  3U50 C;  3QG1 A;  2IPK D;  2JA5 B;  1PRT B;  2DUD A;  4DR6 Q;  1JIC A;  1GUW A;  3CCR A;  4JVZ A;  1AEX A;  3J80 i;  3RR5 A;  3RN2 A;  1TY0 A;  4MZ9 A;  1VQD A;  5IT9 c;  1DD2 A;  1VQ8 A;  1JR0 D;  1L1O A;  1SNQ A;  1FNW A;  3NBH B;  2RBM A;  1SMX A;  2IJ0 A;  4N8F A;  1PH1 A;  4GZY C;  2RQX A;  2VL6 A;  5FLX L;  2PQE A;  1PFS A;  2Z4H A;  4F7X A;  3STB D;  1CQF A;  2BCO A;  2B63 H;  5T1I A;  2WFW A;  3S2D H;  1I94 L;  4C1N I;  4A3D B;  1VDZ A;  3C1E A;  1KXL A;  3J7A F;  1Q7Y C;  5A2Q L;  1TS4 A;  5DM7 3;  1VQH A;  3CC2 A;  2PQA A;  3ULL A;  1HA5 A;  2AUK A;  5K5P A;  4BY1 H;  3MHB A;  2F0O A;  2K7V A;  1HR0 Q;  4I7Z C;  4NP5 A;  2A6H D;  1B44 D;  1EQV A;  1STE A;  1IHZ A;  4DV1 Q;  4OL7 A;  1EYD A;  1ZXT A;  1WTP A;  4LNQ A;  5EKK A;  1WVL A;  2LMC B;  5JEA G;  3M4O H;  1IBM Q;  1PH8 A;  3CD6 A;  3J80 L;  3CQZ H;  5E4X A;  3L2P A;  1SFO B;  1CFM A;  4A93 B;  4IFD H;  4PMW A;  1SE4 A;  4KKT A;  3R93 A;  4HCE A;  2NVY B;  1VQK A;  4ODG A;  3HS0 C;  2VQF Q;  5JPN C;  3BDL A;  3I55 A;  3X3M A;  2G5D A;  1IBL Q;  4OEL B;  3PO2 G;  2RF4 A;  4CKC A;  1ILQ A;  1MHW C;  3CCL A;  1WTX A;  4DXF A;  1F77 A;  5FO9 B;  3ITP A;  3M7N A;  1KHI A;  3FMC A;  5C3E B;  4RHS A;  3C3L A;  1O7I A;  5IWA Q;  5IGB A;  4LF7 Q;  2ZM6 Q;  1M90 C;  3PUY A;  4BBS G;  2Q2I A;  2BA1 A;  3I7F A;  3FPU B;  1JOR A;  1K28 A;  4LFC Q;  4DV5 Q;  3I3C A;  1ICW A;  3T1Y Q;  2JJQ A;  3KLW A;  2KHS A;  1LLR D;  2WB1 B;  1EU3 A;  1JOQ A;  1SRO A;  1EL0 A;  3A7A B;  1IXR A;  4JI2 Q;  4X3U A;  4L5Q A;  1TWG B;  2ZTD A;  4G7H C;  1O7Z A;  4DR3 L;  4KN7 C;  4PZ7 A;  1V1Q A;  4GN5 A;  4R4O A;  2HDM A;  4YCW A;  5C0X H;  2R92 G;  1SNM A;  3C1F A;  1H9M A;  1O80 A;  1W6K A;  2K1B A;  2K33 A;  3WWV A;  1VQ6 A;  4B3T L;  3I56 A;  4GKJ Q;  2JA7 G;  3HOU B;  5HGT A;  4DV6 Q;  1G6P A;  4GLX A;  3A55 A;  3U4V A;  2I07 B;  2UXD Q;  4LF8 Q;  1GHJ A;  4RCO A;  4LF4 L;  3GTL B;  1S5D D;  4HN7 A;  2RKS A;  4PQX A;  1VQ4 A;  1UEB A;  3S14 H;  2Y0S E;  3CAM A;  3R2I A;  3S24 A;  4YIJ A;  4DXG A;  3MEF A;  4JYA Q;  1XPU A;  1YIT A;  3GTO H;  2Q2U A;  2E2D C;  1R4P B;  1XPO A;  1WCM H;  2NB0 A;  3SR1 A;  5AJ3 Q;  2PYK A;  4F87 A;  4G7Z C;  4BA2 I;  3BZC A;  4UAI A;  1PZK D;  4MNO A;  1FGB D;  2F1M A;  1RD9 D;  4JI0 Q;  3HOZ B;  1TS3 A;  5FLX E;  3PQI A;  3OIP A;  2B63 G;  2PZT A;  4V0B A;  3VDY A;  2UU9 Q;  2FJ2 A;  3QIA A;  2L5T A;  2Z6K C;  1R4Q B;  3K5L A;  1CZG A;  4LF9 Q;  1QNK A;  2CWA A;  2JK8 A;  4XYO A;  2EJF C;  3BZD B;  2VW9 A;  1GUS A;  3DMU A;  5M3M B;  1EOV A;  1D1I A;  5KGU A;  1RTN A;  1ESF A;  3K5M A;  4N9T A;  1KQS A;  1X3F A;  4JI3 Q;  4LK1 C;  2E2I H;  1V8Q A;  1J5E Q;  4BY1 G;  5JJZ A;  1PRT F;  4LFB L;  5EGT A;  1W6J A;  3HKZ B;  2BH8 A;  1DYQ A;  3A74 A;  3MXN B;  4RH6 A;  2JEB I;  1O7Y A;  4EQO A;  5COR A;  1QG7 A;  1TWA B;  1SYB A;  1TT2 A;  1X3P A;  3PO3 H;  2A69 D;  3CCQ A;  4C56 C;  1LUZ A;  2KHJ A;  4IFD G;  3J80 E;  3NTH A;  3UDX A;  3S1M H;  4ME3 A;  3W2D A;  1NMG A;  2KCN A;  3STB C;  2UXC Q;  2PI2 A;  2F0P A;  4JOI A;  1EYG A;  1SJH D;  5JVG 3;  5IOC A;  3N6R A;  3OHX C;  4JBW A;  1XMQ L;  3AQQ A;  1VQE A;  3R2T A;  1FVI A;  1QVF A;  2ZTC A;  3AFQ A;  3RUZ A;  4OWT B;  2CW0 D;  3A54 A;  1TS2 A;  2BH2 A;  2JQO A;  1SFO H;  2A74 C;  1KDA A;  1IYJ B;  1E2W A;  1PFB A;  3RZO B;  5CGK A;  1EWH A;  1BQQ T;  4IQZ A;  4PG3 A;  3J81 L;  2XRQ D;  1T5E A;  4PNY A;  4J15 A;  1SAP A;  1RIP A;  1LTS D;  4TRD A;  2D5D A;  3NEL A;  3K7U C;  1QVG A;  4Y52 H;  2SDF A;  4JI1 L;  1NR4 A;  4KK7 A;  1GOZ A;  1EIG A;  2A8V A;  4KI0 A;  3H6M A;  4NXN L;  5C0X G;  2EY1 A;  1LAB A;  2Q8R E;  4WFN 3;  3SDZ A;  5IGG A;  1EIF A;  3GTQ H;  5BR8 Q;  1EYA A;  2OCE A;  2KEE A;  1M8A A;  1CI3 M;  4XQQ A;  2VNU D;  2V4D A;  3E0E A;  1K83 H;  4DA2 A;  4DV3 Q;  3OTO L;  2F3I A;  1PH6 A;  1TWG H;  3KFU A;  3S17 H;  1KC8 C;  4A3C H;  1MJC A;  3E3X A;  2OT2 A;  2VY3 A;  2A19 A;  1BCP B;  4DV2 Q;  2ENB A;  2LS0 1;  2RDG A;  2C5C A;  3BU2 A;  3SGI A;  1WCM G;  1R9T H;  1K0R A;  4K2L A;  1PVO A;  3HOU H;  1PZI D;  5EAY A;  1D7Q A;  2B2V C;  4JCV E;  1EQR A;  1TWC H;  2NUC A;  3NUC A;  4DV4 Q;  3GTL H;  3LNN A;  3AU7 A;  2E2J H;  5J1Z A;  1TWF B;  2B3G A;  3KBG A;  5FKA C;  3WOF A;  4JV5 L;  3KF8 B;  4LWC A;  4LJZ C;  2AQ1 B;  3TSS A;  1J9O A;  2D0O A;  1HPC A;  3VR2 A;  3W1G A;  1ZYR D;  3MA2 B;  2NVX B;  3HOX H;  2IW3 A;  2N55 A;  4K6L A;  4EQN A;  4IJL A;  1EIH A;  4G7O C;  4P74 A;  2NZO A;  5ELO A;  3TRE A;  4BBS B;  1S5E D;  1BCP C;  1PYS B;  1Q12 A;  4RGN A;  4DUZ L;  2JA8 B;  2I5L X;  5HY6 A;  3T1H Q;  2M00 A;  2ASB A;  4HJ9 A;  4A3E B;  4MN3 A;  1J8I A;  1TVX A;  4CHT B;  4HIM A;  2K5N A;  2MNA A;  1IL8 A;  3PO3 G;  4IFD I;  1BF4 A;  4ZRZ A;  3UDG A;  5M3M H;  4B3R L;  1B3A A;  1Q1B A;  3OSO A;  4A3M H;  1U4L A;  1IYV A;  4DK0 A;  1ENC A;  1MSH A;  1ML0 D;  2F0I A;  3QWN A;  2ID0 A;  3CMA A;  2R92 B;  3HGB A;  2BE5 D;  2Q8T A;  3I4N H;  3D8G A;  1VCI A;  4DAP A;  4KN4 C;  2PPB C;  4Y7N H;  2JA7 B;  3CW2 C;  2L55 A;  2N3S A;  3OMG A;  5ELF A;  5C6A A;  4GOP C;  2E75 C;  1MJE A;  1LTG D;  1TWA H;  3UE1 A;  4GOP A;  3BG3 A;  1SYE A;  2EYF A;  1HQR D;  4K2K A;  1B2T A;  4HR7 B;  3RLN A;  2B2U A;  2JP1 A;  3OOC A;  1UE1 A;  3DWP A;  5K36 H;  5I9P A;  5IP7 H;  2JYO A;  1SRU A;  1XTD A;  5GAH C;  4G57 A;  1CUK A;  3NXW A;  2NN6 H;  1VQN A;  4XT3 B;  3NTK A;  4DNT B;  1NAP A;  3OIQ A;  3NEN A;  2Y0S G;  3H94 A;  3D6C A;  2OXP A;  3EA6 A;  2I5M X;  1E1O A;  2ATW A;  2UXB Q;  4CJ0 B;  1HNZ L;  4HMJ A;  1OXV A;  4CDC C;  3S2D B;  3RZO H;  2ZXO A;  1A2T A;  1RDP D;  5JJK A;  2L0C A;  1E2Z A;  1C7Y A;  3WOE A;  4YCV A;  3H3V C;  3BDC A;  3U9O A;  1A3U A;  2F0U A;  1G29 1;  3D4R A;  4M1U B;  2CW0 C;  3OPO A;  5ELN A;  1PDQ A;  1AH9 A;  1EY5 A;  3D3R A;  4BS9 A;  3HEJ A;  4BY1 B;  3CCV A;  4DNR B;  1HNW Q;  2R7D A;  3HKS A;  1EY0 A;  4A3C G;  1B9M A;  1HTL D;  2IL8 A;  2VXW A;  2EY5 A;  1EWI A;  3ZJY C;  5CV8 A;  4L8J A;  4OO1 H;  5I2X A;  1Y1W H;  2HHH L;  3M4O B;  1PH7 A;  5E7N A;  5KYL A;  1EEF D;  1IBK L;  2O5I C;  4J6H A;  3TZD A;  4I65 A;  2QCP X;  3HOU G;  2ZJQ A;  3I70 A;  2HIV A;  3M4P A;  5C3W A;  1NUC A;  1L0Y B;  3IFT A;  1WD1 A;  4JK1 C;  3M4Q A;  1VQA A;  1X3G A;  4KHP Q;  3ZYY X;  1UEA B;  5EJW A;  3A8I E;  3MXG A;  3S2H H;  2BA0 A;  2WII B;  3PIO 3;  2K52 A;  5I6Y A;  3I8Z A;  1UWV A;  1Q8I A;  3HOX G;  1JC7 A;  2EIF A;  4CJ2 C;  1AZQ A;  1NCV A;  1PH5 A;  1A3T A;  1N9W A;  1H9S B;  4K0K Q;  3U4Z A;  1LT6 D;  1N34 Q;  2HIX A;  1S72 A;  2RSO A;  1K0S A;  4XQN A;  2KQ3 A;  1EEI D;  1K73 C;  1DOM A;  1I3Q B;  4LF6 L;  1HH2 P;  1I50 H;  1TWF H;  2GVB A;  4UPA A;  5LMU L;  2B8G A;  5IOD A;  2HCC A;  1HZA A;  1IW7 D;  1IYU A;  3Q6S A;  1K8A C;  1H95 A;  1LAC A;  3G7L A;  4DV7 L;  4O1N A;  5M9O A;  4X64 Q;  5M3M G;  4R4C A;  2EYL A;  4A3M G;  5BN3 A;  4DR2 L;  4KKS A;  3A8J E;  1FJG L;  3EJI A;  2DN8 A;  2E76 C;  3CCE A;  4IUU A;  4C1N K;  3I4N G;  3BDO A;  2JA8 H;  2R6G A;  1OXX K;  2CFM A;  4QB4 A;  4LFA L;  1N36 L;  1ZYR C;  4A3E H;  1NBW A;  3K59 A;  1N8R C;  4OIK A;  2CWP A;  2XN9 C;  4HIO A;  5FO7 B;  1LTI D;  2ALY B;  3HOY H;  2AUJ D;  5KYI A;  5M5Y H;  2F0L A;  2G9H D;  4JI6 L;  3S14 B;  4GN4 B;  4JI7 L;  3QOL A;  5LHY 1;  1CKN B;  4DUY L;  1MKH A;  3NE5 B;  3SK4 A;  4LF5 L;  1LTL A;  2F0E A;  1KL9 A;  3F8T A;  1WTO A;  3K6O A;  5K36 G;  5IP7 G;  2SEB D;  3GTO B;  4EX5 A;  2OTL A;  5A35 A;  1SDF A;  3LGJ A;  2K50 A;  2NN6 G;  3J81 j;  3FPP A;  5CMD A;  2K03 A;  3GV6 A;  3DWQ A;  4P72 A;  2RHQ B;  2K01 A;  2A6E D;  1XMO Q;  2WKC A;  1X54 A;  3F2U A;  4ZKC B;  4HSV A;  5IYD H;  3H3V H;  2PQA B;  3PIO A;  5BN5 A;  1A0I A;  1ONL A;  3VR5 A;  2L12 A;  4I7A A;  5C44 B;  5EPL A;  3KLR A;  2HT1 A;  1X3Q A;  2WAQ B;  3I2Z A;  2B8F A;  3I72 A;  1F2L A;  2Q2T A;  3J7Y W;  1L1O C;  1XNR L;  5LL6 S;  2I5H A;  4LUV A;  2LKV A;  1I5F A;  1H9R A;  2UUC L;  1BBX C;  2F0Q A;  2E2I B;  2D9U A;  4CKB A;  2K05 A;  4IUN A;  1VS0 A;  4NMZ A;  2FMM A;  2HD3 A;  3S1N H;  3RLF A;  4Q0F A;  4BXX H;  1DZ1 A;  1LT3 D;  1QUQ A;  3BYY B;  3Q8D A;  1CHQ D;  1PTO D;  4OO1 G;  3KUP A;  1Y1W G;  2NTS A;  3I91 A;  4QIW E;  1XXG A;  1HFG A;  3KLS A;  3PO3 B;  2ZXP A;  4P2C B;  4LMQ D;  3W5O A;  4FXK C;  4MTK A;  3S1M B;  4C3H H;  4DV0 Q;  4KKU A;  1X55 A;  3BS1 A;  3QB3 A;  5JEA J;  1RL2 A;  1S5F D;  4FP5 D;  5DLQ E;  1GXD C;  2XGT A;  1FYC A;  1V1P A;  1L2F A;  1JB7 A;  3PCO B;  4FO2 A;  5GAE C;  1K8M A;  4FVM A;  3G4S A;  4CJ1 B;  3FP9 A;  2EYP A;  4DAY A;  1S5C D;  4BWG B;  4A3L H;  1UNS A;  3M85 A;  2RCF A;  1GJX A;  4CKE A;  4ZAI A;  1SE3 A;  4FDB A;  3MFY A;  1F2Z A;  2WAQ E;  4KY6 A;  5T1G A;  3Q0A A;  1HHV A;  4YY3 L;  4PV1 C;  2VS1 A;  1DM0 B;  2EXD A;  5IP9 H;  1VQB A;  1Y14 B;  1NJI C;  3HOW B;  1SJE D;  2KOL A;  3FKI H;  4NXM L;  4JBM A;  4YHH Q;  4DKA C;  1FNV A;  2Y0S B;  3NBH A;  3MFG A;  2X69 A;  3DUZ A;  3BVZ A;  1HNX Q;  1VQJ A;  4K5W A;  4DR3 Q;  2K14 A;  1NY4 A;  3M9B A;  2B2T C;  1GUN A;  2J7Z A;  1B8A A;  3X3N A;  4IZ8 A;  1P16 A;  4A4I A;  2B2T A;  2EPB A;  2X6L A;  4ZKB B;  4B3S Q;  3MZ5 A;  1U4M A;  2JA8 G;  3GTQ B;  5GQO A;  5CR3 A;  5C5L A;  1I3Q H;  4A3E G;  2EDG A;  1KNE A;  3V05 A;  2DNE A;  1I4R A;  4UHV A;  1K83 B;  3ULP A;  1IBM L;  4LF4 Q;  5JJL A;  3RLO A;  3KF6 A;  5I2Y A;  4XDX A;  3CME A;  3HOY G;  5NUC A;  1KRS A;  1JOK A;  4DPG A;  3S17 B;  2B2W A;  1WTQ A;  3I73 A;  2V1C C;  4UP8 A;  2VQF L;  4V19 0;  2L9H A;  5E4W C;  1VQO A;  4X3T A;  2NN6 I;  1IZ6 A;  2B2Y A;  1QB5 D;  1R9T B;  1SMY C;  4IJH A;  4YWM A;  1BKB A;  1SN8 A;  2E74 C;  3T51 B;  1TWC B;  2Q8I B;  1D5Z C;  5IYD G;  1HCZ A;  3OWE B;  1C4Q A;  2KEN A;  1O78 A;  2XVS A;  3MXP A;  4L5T A;  3C2P A;  3CRK C;  4TKO B;  4LF7 L;  1BUV T;  2QDB A;  5M5X B;  2E2J B;  3GTK B;  2ZM6 L;  2LXK A;  3MC0 B;  2K4K A;  2SNM A;  5I4D A;  3SE0 A;  4Q5V A;  3H15 A;  2MO1 A;  4E6I A;  3K81 C;  4DV5 L;  2MO0 A;  3EBE A;  2PMZ B;  3HOX B;  1JOO A;  5ISR A;  3T1Y L;  2FXQ A;  5HGQ A;  5FLX c;  1KRT A;  1KAA A;  2O4X A;  1STH A;  1ZKO A;  1OXU A;  3VR4 A;  4OWW B;  1YHA A;  1DOK A;  4JI2 L;  1SE2 A;  1FD7 D;  3DLL A;  3A5Z B;  4BXX G;  5CV7 A;  4FYD A;  4S3S A;  4IPG A;  4X66 Q;  5C44 H;  4OO1 I;  1TWH H;  1L0X B;  1Z47 A;  3IL8 A;  2OWO A;  4TSS A;  1CM9 A;  3P20 A;  1YZ6 A;  1ENF A;  4R8I A;  4OX9 L;  4A3B H;  1JMC A;  1VQF A;  2Z0S A;  2WP8 J;  4A3M B;  4C3H G;  5A2Q E;  3P1H A;  2IHE A;  2C35 B;  3FHW A;  2YTX A;  1ET9 A;  1EZ6 A;  2H1E A;  4R1J A;  2UXD L;  4LF8 L;  1KIX A;  3ER0 A;  3I4N B;  3J81 i;  3KBX A;  3E5S A;  2FHT A;  4IFD J;  1WJJ A;  1HTP A;  1AW7 A;  3J80 c;  1Y8P B;  4Y7N B;  1VF7 A;  4JBJ A;  5I9O A;  4U67 3;  4R8N A;  2F0K A;  4A3L G;  2SOB A;  3P7J A;  3GTP H;  5FOB B;  5KNC A;  1A62 A;  2N8N A;  2R7Z B;  3FEW X;  4WJ3 M;  5AJ3 L;  5M5W H;  1QNU A;  2PMZ E;  4JOI C;  5IP9 G;  2EQS A;  1KAW A;  1NNX A;  1PTO C;  4A3I H;  3FVQ A;  1GD7 A;  2KED A;  2KJX A;  1HUM A;  4XYQ A;  2VZA A;  2UU9 L;  1ICF B;  3FKI G;  1RF2 D;  2O5J C;  1E2V A;  2YYZ A;  1CTM A;  4JI8 L;  1VQ7 A;  2Z8L A;  4C3J H;  2K5V A;  2Z1C A;  2PI2 E;  3MXU A;  1TS5 A;  2VB2 X;  4NPS A;  3CF5 A;  2VQE Q;  3I4O A;  3ND9 A;  5EPJ A;  2MHV A;  4JI3 L;  2A6H C;  1F2Y A;  4XXE A;  2NVQ H;  3HOW H;  1ILP A;  1W3S A;  3G6J B;  4XTC S;  1EY4 A;  1Q86 C;  1BR9 A;  1TKW B;  4XIG S;  4ZUJ A;  1PZJ D;  1HR0 W;  1OTC A;  2HQL A;  3OTO Q;  5C0X J;  1EZ8 A;  1A2U A;  3PF4 A;  2QW7 A;  4DFA A;  2J0T D;  3IKJ A;  3RNU A;  2AWN A;  2R61 A;  1AE3 A;  3QJY A;  1D6E C;  2EYM A;  1Z9F A;  4K8I A;  1PH2 A;  1BXT A;  2J4X A;  3VYU A;  4DR4 Q;  1VQM A;  1Y1W B;  5C4J B;  2UXC L;  2O2L D;  4RKL A;  3ERQ A;  4JI5 Q;  2NYZ D;  2EZV A;  1QZG A;  2XWJ B;  4R4I A;  1TU2 B;  1SR3 A;  4FXD A;  4HED A;  2IWH A;  3ONA B;  4C3I H;  1SNO A;  2F4V Q;  4ZUI A;  4KJO A;  3AEV A;  2JN4 A;  1GUG A;  2KVM A;  2KCT A;  3H3V I;  3EVQ A;  2VB3 X;  2CH4 W;  2Z6B A;  2IHF A;  2OTJ A;  2K5H A;  2NZ1 D;  3K5N A;  1ASZ A;  3CKI B;  3MVV A;  3S2H B;  4JPB W;  2K32 A;  4IOC A;  1FNU A;  3VR6 A;  1PYW D;  2G9D A;  1DXM A;  3PUZ A;  1PH3 A;  4H13 C;  1A3V A;  4WOR A;  3SK6 A;  4X3S A;  2X6G A;  1B1Z A;  1C8C A;  5EKI A;  5KRU A;  4DUZ Q;  5EBD A;  4A75 A;  1M4V A;  3TS0 A;  4IUR A;  1KLU D;  5C44 G;  1I50 B;  5M5X H;  4QJF A;  3V2T A;  4NDX A;  5ELC A;  3GTK H;  2F52 A;  4RFB A;  2WAQ G;  3DEP A;  1NTG A;  4A3B G;  4DK1 A;  1PFN A;  3MEH A;  2XWB B;  5IY0 A;  3TBI B;  3EIV A;  1WFQ A;  4BBR H;  3GTJ H;  2AQ2 B;  3SEB A;  3OW2 A;  4DV3 L;  4GOP B;  2F3V A;  1AFP A;  3NTI A;  1S3O A;  2CHB D;  4APV A;  1AZP A;  3DM1 A;  4H44 C;  4EQP A;  2K04 A;  1UE5 A;  3DM3 A;  2EE1 A;  2XSC A;  3CCM A;  1SLJ A;  1PH4 A;  1YBY A;  3G6E A;  5KEE A;  4AYB G;  3PF5 A;  5AFW A;  4PMC A;  1PTO H;  1SXT A; 
#chains in the Genus database with same CATH homology
 3CQZ H;  3A5U A;  3L2P A;  2R93 H;  3TQY A;  5IYB H;  1K73 C;  4PMW A;  3E9I A;  4LF6 L;  1HH2 P;  1I50 H;  1TWF H;  2GVB A;  4UPA A;  4X66 L;  5LMU L;  1EFW A;  1VQK A;  1JT8 A;  1HZA A;  4A3D H;  5GAG C;  4JI1 Q;  2VQF Q;  1K8A C;  1H95 A;  3I55 A;  4LF9 L;  4A3I G;  5M3F H;  3E9H A;  4DV7 L;  1IBL Q;  4X64 Q;  5M3M G;  1X56 A;  2RF4 A;  3JC6 6;  4R4C A;  4HID A;  3NEM A;  3PO2 G;  4A3M G;  4LUO A;  4JI4 L;  4DR2 L;  1FJG L;  3CCL A;  5FLM G;  4NXN Q;  4O0A A;  3CCE A;  1U0L A;  1J5E L;  1KHI A;  2IT1 A;  3M7N A;  1JJC B;  4DAM A;  3I4N G;  3PV0 A;  1O7I A;  5IWA Q;  2JA8 H;  2R6G A;  1OXX K;  2CFM A;  4LF7 Q;  4LFA L;  5C4X G;  4JC0 A;  1N36 L;  2R7Z H;  5IE8 A;  2UUA Q;  4A3E H;  1NBW A;  2ZM6 Q;  3PUY A;  1M90 C;  4BBS G;  2Q2I A;  3JAM i;  3RZD H;  2BA1 A;  4X65 Q;  3I7F A;  2QA4 A;  5GAD C;  3K80 C;  4HIK A;  1N8R C;  4DK6 C;  4LFC Q;  2CWP A;  4TVA B;  4DV5 Q;  3HOW G;  1IL2 A;  3T1Y Q;  4HIO A;  4A93 H;  2JJQ A;  2ALY B;  3HOY H;  3KLW A;  3CC7 A;  2ZTE A;  4JI6 L;  5M5Y H;  2NVY H;  4GN4 B;  4JI7 L;  1XNQ L;  4DUY L;  1CKN B;  4OWX B;  1MKH A;  4LF5 L;  1LTL A;  1KL9 A;  1SRO A;  3F8T A;  1I6H H;  4DR7 Q;  5K36 G;  5IP7 G;  1IXR A;  4JI2 Q;  4L5Q A;  4QL5 A;  4DR5 L;  2ZTD A;  4UP9 A;  4EX5 A;  4DR3 L;  2OTL A;  3LGJ A;  4PZ7 A;  2K50 A;  1WYD A;  2NN6 G;  1N32 L;  1V1Q A;  3J81 j;  1G51 A;  4GN5 A;  4P72 A;  4R4O A;  4YCW A;  2HHH Q;  4L5R C;  2R92 G;  2RHQ B;  1AE2 A;  4A3J G;  1XMO Q;  5C3E H;  3HKZ E;  1VQ6 A;  1X54 A;  3WWV A;  1IBK Q;  4B3T L;  3I56 A;  2KHI A;  1PA6 A;  4GKJ Q;  5IYD H;  3H3V H;  2PQA B;  3PIO A;  1A0I A;  2JA7 G;  4QGU A;  2VQE L;  4ALP A;  4JV5 Q;  4DV6 Q;  1G6P A;  4GLX A;  1N33 L;  3U4V A;  1DGS A;  2HT1 A;  5LMN Q;  2E5L L;  4LF8 Q;  2UXD Q;  3I2Z A;  4YWL A;  4LF4 L;  1VQ4 A;  2Q2T A;  1UEB A;  1L1O C;  4A76 A;  1XNR L;  1E22 A;  2I5H A;  2Y0S E;  4LUV A;  3S14 H;  3CAM A;  3S24 A;  1QZH A;  1I5F A;  2UUC L;  4B3M Q;  3HFZ B;  3HOV G;  3MEF A;  2OQ0 A;  4JYA Q;  1X65 A;  5C4J H;  1CKO A;  1VS0 A;  2YTY A;  3KJO A;  1YIT A;  2Q2U A;  3H0G H;  1XPU A;  1J6Q A;  3GTO H;  3S1N H;  3TS2 A;  3RLF A;  4L5S A;  4A3F G;  4BXX H;  1XPO A;  4LUZ A;  1QUQ A;  3Q8D A;  3K0X A;  1WCM H;  1PHJ A;  4RG1 A;  1E1T A;  5AJ3 Q;  4BA2 I;  1ASY A;  4OO1 G;  1Y1W G;  4DR4 L;  3BZC A;  4YWK A;  4MNO A;  4QIW E;  3GTG H;  4GKK L;  1V9P A;  4JI0 Q;  1HZC A;  4JI5 L;  3UE0 A;  3CXC A;  4LF6 Q;  4B3R Q;  5BR8 L;  1HZ9 A;  3W5O A;  2B63 G;  4HJ8 A;  3VDY A;  2UU9 Q;  2UXB L;  2F4V L;  4C3H H;  2Z6K C;  1PYB A;  2QGQ A;  1P8L A;  4LF9 Q;  1E3P A;  2CWA A;  4DV0 Q;  1X55 A;  2JK8 A;  5JEA J;  4IOA A;  2RHS B;  2VW9 A;  1RL2 A;  4JI4 Q;  4H02 A;  1EOV A;  5DLQ E;  4DR2 Q;  4BBR G;  1FJG Q;  2XGT A;  4QY7 A;  3KJP A;  1JJG A;  2JA5 G;  1L2F A;  1KQS A;  5IYC H;  3W1B A;  1JB7 A;  3PCO B;  1X3F A;  4JI3 Q;  4X62 L;  2E2I H;  5GAE C;  1J5E Q;  4BY1 G;  3G4S A;  3FP9 A;  3CCU A;  1OXS C;  4DV2 L;  2YTV A;  2KBN A;  1WI5 A;  4LFB L;  3M85 A;  4A3L H;  3PIP A;  4FDB A;  2VUM H;  2WAQ E;  1BVS A;  2BH8 A;  1HZB A;  3A74 A;  3MXN B;  4YY3 L;  2JEB I;  4JBK A;  2VS1 A;  2EXD A;  5IP9 H;  3HOZ H;  1VQB A;  1Y14 B;  4RMF A;  1NJI C;  2R93 G;  3PO3 H;  5IYB G;  4DV4 L;  3CCQ A;  4IFD G;  1A8V A;  1LUZ A;  2KHJ A;  4AQY Q;  3UDX A;  4JI7 Q;  4DUY Q;  1XNQ Q;  3I4M H;  4ME3 A;  1NMF A;  3S1M H;  3FKI H;  2XTI A;  1T9H A;  4NXM L;  4A3D G;  1YHB A;  4JBM A;  1NMG A;  4YHH Q;  2AHO B;  3STB C;  4DKA C;  1CSP A;  2UXC Q;  1FGU A;  5M3F G;  2PI2 A;  4DR5 Q;  1C0A A;  1HNX Q;  4JOI A;  1VQJ A;  2UUB L;  4DR3 Q;  2K14 A;  4TQU S;  1EYG A;  1N32 Q;  1NY4 A;  1HNZ Q;  3M9B A;  2JE6 I;  4R4Q A;  1VQP A;  3J81 c;  1B8A A;  4JBW A;  3J7A 5;  1XMQ L;  1P16 A;  1VQE A;  3AQQ A;  4A4I A;  1FVI A;  4HJA A;  1Q8K A;  1X3E A;  1YI2 A;  4B3S Q;  2ZTC A;  1QVF A;  3AFQ A;  2JA8 G;  4OWT B;  4HJ5 A;  2BH2 A;  5GQO A;  1Y1V H;  2JQO A;  1L1O B;  1SFO H;  2R7Z G;  1BBW A;  3T1H L;  2ES2 A;  1B70 B;  1I3Q H;  4A3E G;  1IYJ B;  1N33 Q;  4K0K L;  3UDF A;  3ULJ A;  2E5L Q;  5FJ8 H;  2MQH A;  3ULP A;  1LYL A;  4LW1 A;  1IBM L;  4LF4 Q;  4PG3 A;  1WOC A;  5JJL A;  1Q46 A;  3RLO A;  3KF6 A;  1CSQ A;  3CME A;  4A93 G;  1YNX A;  3HOY G;  1KRS A;  4DPG A;  3J7Z C;  4J15 A;  1RIP A;  3A0J A;  4C2M H;  3NEL A;  3K7U C;  2V1C C;  1QVG A;  4Y52 H;  1K9M C;  4UP8 A;  4JI1 L;  2E8G A;  2VQF L;  2Q2H A;  1VQO A;  2A8V A;  3KYH C;  2MFI A;  4KI0 A;  4JG2 A;  4X64 L;  4HJ7 A;  2NN6 I;  1IZ6 A;  3AYH B;  4IPC A;  1Q82 C;  4IJH A;  4YWM A;  4NXN L;  5C0X G;  2K75 A;  1I94 Q;  1JJ2 A;  1BKB A;  2IX0 A;  4GKK Q;  1SN8 A;  5C3E G;  2JA6 H;  3GTM H;  5IYD G;  4L5T A;  2KEN A;  1EIF A;  3GTQ H;  5BR8 Q;  2AWO A;  2OCE A;  4AIM A;  3CCJ A;  4DR1 L;  4LF7 L;  5J3B A;  2N78 A;  5C0X I;  4DAY B;  2UUA L;  3KDF A;  2ZM6 L;  1EQQ A;  2LXK A;  1EIY B;  5GRO A;  2VNU D;  3PUX A;  2H5X A;  2K4K A;  1K83 H;  3E0E A;  3EN2 A;  4P71 A;  4DNI A;  4X65 L;  1MIU A;  4DV3 Q;  2N49 A;  3OTO L;  1TXY A;  1XJV A;  1XPR A;  3H15 A;  1PH9 A;  2F3I A;  2MO1 A;  2LXJ A;  3K81 C;  4DV5 L;  2MO0 A;  1PH6 A;  3EBE A;  1TWG H;  3KFU A;  3T1Y L;  3S1R H;  2FXQ A;  1YEZ A;  5HGQ A;  1KRT A;  5FLX c;  2WB1 G;  1W2B A;  1KC8 C;  1KD1 C;  3S17 H;  4A3C H;  1MJC A;  4DK3 C;  4X62 Q;  4GLA C;  2VY3 A;  4A3K H;  2A19 A;  4KLK A;  4A3G H;  1OXU A;  2D0P A;  4DV2 Q;  3K7A H;  4DR7 L;  3D0F A;  4OWW B;  1YHA A;  1YHQ A;  3H0G G;  4JI2 L;  3UDI A;  2JEA I;  1NE3 A;  3DLL A;  3A5Z B;  2ZJR A;  4BXX G;  4PZ8 A;  2GN5 A;  3BU2 A;  4BY7 H;  3SGI A;  1WCM G;  1R9T H;  4UY8 C;  1OXT A;  1E24 A;  1K0R A;  3ERS X;  4IPG A;  4X66 Q;  5C44 H;  5LMU Q;  4IO9 A;  3CPF A;  3HOU H;  4OO1 I;  1PVO A;  5EAY A;  3GD7 A;  4X6A H;  1TWH H;  1Z47 A;  4YY3 Q;  3CPW A;  1VQ9 A;  1D7Q A;  2OWO A;  2IY5 B;  4JCV E;  1EQR A;  1TWC H;  1XMO L;  1CKN A;  4DV7 Q;  4DV4 Q;  1YZ6 A;  4A3B H;  4OX9 L;  3GTL H;  4O2D A;  2CCZ A;  1JMC A;  1VQF A;  2Z0S A;  4NB3 A;  3IRB A;  2E2J H;  1GVP A;  2B3G A;  2WP8 J;  2R7F A;  3G48 A;  3F2C A;  1K3R A;  3KF8 B;  4LWC A;  4NXM Q;  4JV5 L;  2IHE A;  2C35 B;  2D0O A;  3FHW A;  2YTX A;  4OXP A;  4GNX C;  3W1G A;  4DR6 L;  4R1J A;  5LMN L;  2UXD L;  4LF8 L;  1KIX A;  2UUB Q;  1GO3 E;  3ER0 A;  4GNX A;  4R4T A;  3HOX H;  3J81 i;  2QEX A;  1HNW L;  1GKH A;  4LFA Q;  1N36 Q;  4POF A;  4IFD J;  5IYC G;  4IJL A;  1WJJ A;  3J80 c;  1GM5 A;  2AKW B;  1Q81 C;  2NVT H;  1S40 A;  4P74 A;  3KF6 B;  2IX1 A;  2NZO A;  5ELO A;  3B6Y A;  3K8A A;  4JBJ A;  3TRE A;  4B3M L;  3RN5 A;  1SE8 A;  4P73 A;  1PYS B;  1VQI A;  2E2H H;  4A3L G;  1Q12 A;  4IPH A;  4DUZ L;  3GTP H;  1VQ5 A;  2I5L X;  3OYY A;  5HY6 A;  1A62 A;  2N8N A;  3PUV A;  3T1H Q;  1YJW A;  5LMN W;  2VUM G;  2ASB A;  4WJ3 M;  1QVC A;  4HJ9 A;  4JI6 Q;  5AJ3 L;  3PGZ A;  4YCU A;  5M5W H;  1X9N A;  4LF5 Q;  5H1S E;  2PMZ E;  4JOI C;  5IP9 G;  3HOZ G;  1U5K A;  4HIM A;  2K5N A;  2EQS A;  2LSS A;  2MNA A;  1KAW A;  3PO3 G;  1K8G A;  4KHZ A;  4A3I H;  4IFD I;  1D8L A;  1GD7 A;  1JE5 A;  3UDG A;  5M3M H;  3ICE A;  2KCM A;  1Q1B A;  3PO2 H;  1X6O A;  4B3R L;  5JJI A;  3I4M G;  4A3M H;  2VZA A;  2UU9 L;  2JA9 A;  3FKI G;  1YJN A;  4KHP L;  1UE7 A;  4AYB E;  5FLM H;  3CMA A;  2ID0 A;  2YYZ A;  1M1K C;  2AMC B;  4JI8 L;  3PSI A;  3G71 A;  4DV0 L;  4C3J H;  3F2D A;  1VQ7 A;  2NVX H;  2K5V A;  2PNH A;  4POG A;  4P75 A;  4B3T Q;  3F2B A;  3KDF B;  2PI2 E;  3I4N H;  1VCI A;  1HR0 L;  1Q1E A;  2A1A A;  2ZJP A;  4NPS A;  5C4X H;  1CKM A;  3CF5 A;  2VQE Q;  3PUW A;  4Y7N H;  3GDE A;  3I4O A;  4JI3 L;  4GLV B;  4DV1 L;  3CW2 C;  4BBS H;  2N3S A;  1EUJ A;  3F1Z A;  4BA1 I;  4GOP C;  1V43 A;  2YV5 A;  4WJ4 A;  1MJE A;  1N34 L;  1TWA H;  3D31 A;  3UE1 A;  1QUQ B;  1Y1V G;  4DR1 Q;  2NVQ H;  4GOP A;  3BZK A;  1W3S A;  3L0O A;  2CKZ B;  4EQ5 A;  1XNR Q;  3HOW H;  3HKZ G;  2NZH A;  4XTC S;  1L0W A;  1Q86 C;  4MTN A;  2UUC Q;  2B29 A;  1UE6 A;  4XIG S;  1YIJ A;  1HR0 W;  1OTC A;  1A63 A;  5FJ8 G;  2HQL A;  3OTO Q;  5C0X J;  3RLN A;  3PF4 A;  1YJ9 A;  1UE1 A;  2DGY A;  3S1Q H;  5IP7 H;  3RNU A;  3M3Y H;  2AWN A;  1IBL L;  2YU9 H;  1SRU A;  1XTD A;  1AE3 A;  2RCN A;  3AFP A;  4AQY L;  1Z9F A;  5GAH C;  1PH2 A;  1CUK A;  1VQN A;  2CQO A;  4YHH L;  2R92 H;  3NEN A;  2Y0S G;  3BJU A;  1VQM A;  4DR4 Q;  2UXC L;  4A3J H;  2I5M X;  1LM0 A;  1HNX L;  4JI5 Q;  1QZG A;  1E1O A;  4R4I A;  3U58 A;  1SR3 A;  2ATW A;  2UXB Q;  5IWA L;  1HNZ L;  4IPD A;  1VQL A;  4C3I H;  1OXV A;  2JA7 H;  4QQB X;  2GVA A;  2F4V Q;  4GNX B;  3AEV A;  4PZ6 A;  3RZO H;  4B3S L;  4GS3 A;  5JJK A;  3JAM c;  2KCT A;  4OX9 Q;  2I0Q A;  3H3V I;  2D62 A;  1VQG A;  2OQK A;  1C7Y A;  4LFC L;  4YCV A;  3U50 C;  1YVC A;  1FL0 A;  2IHF A;  2OTJ A;  1G29 1;  2K5H A;  5ELN A;  1ASZ A;  3KOJ A;  2JA6 G;  2DUD A;  4DR6 Q;  1AH9 A;  3HOV H;  3CCV A;  1B7Y B;  4LFB Q;  4IOC A;  3CCR A;  3RR5 A;  3RN2 A;  3J80 i;  1HNW Q;  2R7D A;  3HKS A;  4MZ9 A;  4A3C G;  4A3F H;  3PUZ A;  1PH3 A;  1VQD A;  5IT9 c;  4A3K G;  1VQ8 A;  1L1O A;  1EWI A;  3ZJY C;  4A3G G;  1PH1 A;  3NBH B;  1SMX A;  4GN3 B;  1Y1W H;  1E7Z A;  2HHH L;  1PH7 A;  2VL6 A;  4DUZ Q;  1PV4 A;  5E7N A;  1PFS A;  4OON A;  2L15 A;  1IBK L;  3CC4 A;  4A75 A;  3TS0 A;  4BY7 G;  4GKJ L;  3STB D;  1C9O A;  5C44 G;  3HOU G;  3CCS A;  5M5X H;  2ZJQ A;  4QJF A;  2WFW A;  2B63 H;  2HIV A;  3M4P A;  3S2D H;  3S15 H;  3GTK H;  1I94 L;  2F52 A;  4DV6 L;  3CP0 A;  2WAQ G;  1NTG A;  4AH6 A;  1KXL A;  2WB1 E;  4A3B G;  1Q7Y C;  3M4Q A;  1VQA A;  5IY0 A;  1X3G A;  3EIV A;  1BBU A;  4KHP Q;  1VQH A;  1WFQ A;  4BBR H;  3GTJ H;  3CC2 A;  3GO5 A;  2JA5 H;  1XMQ Q;  3OW2 A;  2PQA A;  4JI8 Q;  2BA0 A;  3S2H H;  3ULL A;  4DV3 L;  4GOP B;  2K52 A;  4BY1 H;  1UWV A;  1S3O A;  2Z6K A;  4APV A;  4JYA L;  4UP7 A;  3HOX G;  1HR0 Q;  3L7Z C;  3S16 H;  2EIF A;  3TRZ A;  1PH5 A;  1VQC A;  1UE5 A;  1N9W A;  4DV1 Q;  3DM3 A;  4K0K Q;  3U4Z A;  3CCM A;  4LNQ A;  1SLJ A;  1PH4 A;  1YBY A;  3G6E A;  5JEA G;  1N34 Q;  1IBM Q;  4AYB G;  3PF5 A;  3M4O H;  2HIX A;  3TEH B;  1S72 A;  1PH8 A;  3CD6 A;  1HJP A;  4JI0 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...