1SLQA

Crystal structure of the trimeric state of the rhesus rotavirus vp4 membrane interaction domain, vp5ct
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
270
structure length
270
Chain Sequence
DIVVSKTSLWKEMQYNRDITIRFKFASSIVKSGGLGYKWSEISFKPANYQYTYTRDGEEVTAHTTCSVNGMNDFNFNGGSLPTDFVISRYEVIKENSYVYVDYWDDSQAFRNMVYVRSLAANLNSVICTGGDYSFALPVGQWPVMTGGAVSLHSAGVTLSTQFTDFVSLNSLRFRFRLTVEEPSFSITRTRVSRLYGLPAANPNNGKEYYEVAGRFSLISLVPSNDDYQTPITNSVTVRQDLERQLGELREEFNALSQEIAMSQLIDLAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural rearrangements in the membrane penetration protein of a non-enveloped virus.
pubmed doi rcsb
source organism Rhesus rotavirus
molecule tags Viral protein
molecule keywords VP4
total genus 52
structure length 270
sequence length 270
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2004-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17477 Rota_VP4_MID Rotavirus VP4 membrane interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1slqA02
3TNUA 1X8YA 1GZLA 3L36A 2YO3A 1T2KD 3M9HA 3HE5A 5APWA 2WPQA 2JJLA 1FAVA 2P2UA 2XU6A 3HE4B 3T97A 2WWWA 2XZRA 4KHXA 4C7NA 1GU5A 4EOTA 3A3YB 3M06A 5AVWB 3L37A 3VYIA 1MUUA 1MV8A 1OWAA 2R5DA 5AVQB 5AVZB 5AW8B 1DH3A 4DZOA 3KQGA 2W27A 3NMDA 1FOSF 4JYCA 3MGNA 3TYYA 5CMZA 5AW2B 1YYCA 5APSA 4M3LA 3L35A 1JNMA 4JYBA 2WT7B 2VRSA 3MD0A 1J2JB 1GK4A 3HTKA 1OXZA 3KDPB 3NFQA 1IO4A 5AW9B 4GKGA 1CSBA 1KQLA 3V4QA 4RESB 1SP4A 2P67A 2ZXEB 4C46A 3A2AA 3IR9A 2N9BA 5AW0B 3HE4A 2Z5HA 4AUWA 1GD2E 2Q3IA 3M9BA 1HBWA 3M91A 1H88A 2IPPA 3O8ZA 2C9LY 2ZFCA 3A7OA 5AW7B 3TNUB 1H8AA 1HWTC 2C9NY 5AVXB 3NXSA 4XE5B 5AVUB 5AW4B 3V4WA 1T2KC 2KP8A 5APVA 5AVRB 2YNYA 1HUCA 2Z5IA 2Q5UA 1FOSE 5AVTB 3P8MC 2WT7A 2QM8A 2QM7A 5APUA 1GU4A 1A02F 3OAKA 3VMXA 2E43A 2P7JA 5APXA 1CZQA 3P32A 2WPRA 1MFZA 3TK1A 4C7NB 1S9KE 2WPSA 1H89A 2XV5A 4I6MC 3M0AA 2BASA 3VMZA 4HYTB 5AVSB 3HE5B 3V5BA 3LIDA 1HJBA 3M0DA 4AQRD 1SLQA 5AW5B 2R5BA 1GTWA 3SWFA 5AVVB 3I5CA 5AW3B 2R3CA 2E42A 4B86A 2R32A 2H7HA 5AW1B 3VTPC 3VN0A 3B8EB 1A02J 1JUNA 4LC1A 5AVYB 5APQA 4I2LC 5AW6B 1NWQA 1CI6B 1CI6A 3VMYA 2WTYA 3P7KA 5APYA 1GK6A 4AYCA 3UIAA 3LIEA 1NAFA 4GT1A 2W6AA 2YO2A 1G2CB 3A5TA 5APTA 1S9KD 2Q7CA 3NTNA
chains in the Genus database with same CATH superfamily
3RK3D 1X8YA 3L73G 1AFOA 3L36A 1L4AD 1BDCA 3L72E 1KQFB 3PRJA 2IFNA 1LJ2A 1PPJD 2WPQA 2B9BA 2YIUB 2H8PD 2JJLA 3CWBD 1BGYE 1N7SA 1N7SB 1YBKA 1DEBA 3OA7A 2E5TA 1LWUC 2WWWA 4HJGH 4ASWA 2QIWA 2YIUC 3A3YB 2O01N 3L75D 1LTTC 1GL2C 1SQBG 5B66H 1LWUB 3CC4P 1NHLA 5TJHA 5B66E 1Q82Q 2Q9IA 3CWBJ 4W80A 2FYUE 1HVVA 1OWAA 2GM4A 3MZWB 1DH3A 2WSFH 3MUDC 2AXTH 1GL2D 2W27A 1LT9B 3H1JD 1H0TB 1VPCA 3AE4C 1JOCA 4BRYB 3P8CE 1OVUA 1H0TA 1RY3A 1KD1Q 2KLVA 2PGDA 2R3SA 1NTMJ 2QE7H 5AW2B 3A0HH 1BSNA 1ZRTD 1YIJP 1PGOA 1YQ4C 1LTGC 2GUVA 2O3JA 1JNMA 2A06E 2IZ0A 1HJ0A 1Y47A 3PTZA 4D6TG 1VQMP 3AE1C 1YJ9P 3TGUJ 1J2JB 4C7RA 4WBAA 1OXZA 5CJ4A 4OWFA 5DJUB 1R8EA 1RF1C 1PPJE 1NAYA 3II6A 1NJIQ 2WT7A 2QJPC 2NPSB 2V4HA 1M56D 5EFWB 3TGUD 1BGYD 2HODB 1FZAA 3IFMA 3F89A 1EZVG 2GUSA 1SQBD 1JB0J 4RESB 3D6YA 1DX7A 1JCCA 2P67A 2HG5D 3AE2C 3U59A 2HODA 1GDTA 1JO5A 1YHQP 5BU8B 1IFNA 2N9BA 3CWBG 1FZCC 1ZR2A 3G71P 1NTZD 2WSCH 4QMAA 2QJKB 5KLIC 4D6TJ 4EYYQ 1SQXK 3AECC 4I7ZC 1KC8Q 2C0XA 3M91A 3BRVB 4JF7A 2JEEA 2PFXA 1NTZJ 3I55P 1L0LD 1N7LA 2IPPA 1LTJC 2KB7P 2A45I 1RH5B 2IBZG 1L0ND 5CHXA 3VOPA 2AEMA 1BCCD 4D6TD 2Z4EA 2C9NY 1K73Q 2WSSH 1RF1A 1D7MA 2IYPA 2NPSA 3L73J 2ZXXA 3PH0A 2M3BA 3V4WA 1KILD 1LT9A 4O9BA 1VF5B 1LP1B 2KP8A 1FJKA 5AVRB 1NKNA 1VQ6P 3AE8C 1PV3A 2OYIB 1U57A 1FOSE 1VQNP 1GU4A 4EDFA 4IL6H 2IZ1A 2JWDA 1URQB 4GODA 2P7JA 2KLUA 1CZQA 1Y8AA 1FZCA 3P8CD 4DCKA 3LW5H 1H89A 1NTMK 4U7JA 3WUVA 4BRYA 3JC22 2K1AA 1Q81Q 2E76D 3AE9C 3V5BA 4JBZA 4L74A 1VQLP 1EC5A 4L76A 1X0TA 1YI2P 1YJWP 1RE4C 3H1LE 2Q3EA 3AEBC 1FDOA 1XTCC 3RBZA 2R5BA 1YJNP 3CXHH 3SWFA 1SQPJ 1NTKE 2JP3A 3CWBE 4Y99C 2ZYDA 2Y0CA 2HPCA 2WZ7A 2R32A 1KZUB 2K9JA 3S9OA 3Q5RA 3B8EB 4GOEA 4Y99B 3H1KG 3H1JJ 2E76B 4JPZB 1URQA 1SQPK 2L5GB 1ZOYC 3CD6P 1CI6A 2WSCJ 2B89A 2OYIA 3TGUG 1K05A 3IN6A 3RK2B 4AYCA 1KFMA 3UIAA 1KILB 2M0BA 3L75J 3S1KA 4MN4C 2KK7A 3KHUA 1VQPP 2KS1A 2N1TD 2OYOA 3CCMP 1OW7A 4PV1D 2M8RA 2PAJA 1MFTA 2QEXP 1VF5D 3G3ZA 2A06G 2HR3A 2KYVA 2YO3A 3RL0D 2IYOA 4ASVA 5GTHE 2QVAA 3M9HA 1Q7YQ 3RK2D 1URQD 1SQBJ 3V2QA 1S72P 4K3AA 2P2UA 2KXPB 2WSEH 4N6JA 3L70J 2FKWB 1KB9E 1M1JC 1YTZI 2FXMA 3H1HJ 3HE4B 4C7NA 4UB8H 4R4LA 1SQVJ 1GU5A 1RF0C 1RQUA 3RK2C 4WY4C 4PJ0H 2FXPA 3G6EP 3Q3DA 4H0LC 1AV1A 3F5HA 3AEDC 4OGQD 3M06A 3RL0B 1QGKB 4ZNCA 5AVWB 5CCHD 1EDKA 4RJTA 2G8YA 1MUUA 2R5DA 2ZJSE 3H32B 3CXHE 3MUDA 1SQVD 2I8DA 3KQGA 5CJ0A 4DZOA 2RH0A 3CMAP 1SQVK 3MIWA 4OGQC 2ZYGA 1M7LA 1BGYG 4H44B 5CCHC 4JYCA 1P84I 4HB1A 1EZVI 1KYOE 3Q5SA 3CMEP 2KZJA 3MGNA 4Z1MH 3H1KE 1KB9I 5KLVK 1N86A 5KLVD 1FZGA 5CMZA 1YYCA 5APSA 1ZXGA 1SVFA 2WITA 3L73D 4M3LA 3ZDMA 4IFDK 1BE3J 1GMJA 1X79B 2HLOA 5B5EH 5C39A 2WT7B 3MD0A 1TU3F 1VQ8P 1IK7A 4KT0J 5E79H 3U1AA 3W68A 1S2EA 1YQ3C 1WMKA 1T3JA 5KAIH 1CW5A 2AXTE 1JY3O 3W67A 1FJPA 1BCCJ 1LTAC 2NPSD 2LKMA 1MKMA 2MJZA 4ZMDA 3V4QA 3BASA 1GL2A 1NYHA 2XNXA 1IZNB 3OJAB 4H44C 1LWUA 2O01J 4YTPC 1QVGO 1P84D 3CC2P 2ZXEB 3V2RA 1IK9A 1KB9D 3CCEP 1WT6A 1OFCX 1R5LA 4OVNF 2Z5HA 2V7QJ 1FE6A 1L0NG 3B5NC 1SQPD 3IF4A 2Q3IA 3GLMA 3M9BA 3QWOC 5KJ7C 3L70G 1HBWA 2KSJA 3RBXA 1N8RQ 1W5CE 3CCVP 1PL5A 3O8ZA 3H1JE 2BCCJ 1EDLA 2FBWC 2WSEJ 1K9MQ 2ZVNB 1NTKG 1SQXE 1Q90D 1SQQE 1KFNA 2Q6QA 2YMYA 3NXSA 3BVHA 1SQBK 2H89C 1LTJB 4TT3H 3VP8A 3L75E 3SFDC 4NPDA 5H2FE 3RK3B 1NTZG 1KQSO 2Z5IA 4IOIH 1EZVD 3FX0A 4CPGA 1M1JA 1JM0A 1A02F 1NTKK 1Q2NA 2QJKC 2Y9YA 3H1HG 3K5BA 3H6PA 3OAKA 3VMXA 3AE3C 1NTMD 3B71A 4PD4E 4UB6H 3P32A 2K37A 2M5AB 1VQKP 2L91A 1MFZA 3TK1A 1RE3A 5BU5A 4I6MC 1RQVA 3M0AA 2BASA 3O6QB 2KNCA 3VMZA 3CCUP 5H2FH 3B5NA 1SQBE 5GTIE 3GG2A 1QL1A 3HE5B 2FYNB 2QA4P 3L71E 4Y28J 1HJBA 1IFMA 1VQ9P 1S4XA 1NU1G 1LGHB 1OZHA 2LXBA 4AQRD 1OVVA 3ITKA 5AW5B 1ZMEC 1L4AB 3HUSC 3BCCE 4EI2A 1K8AQ 1SFCA 3HRNA 3HD7B 1KTMA 2E42A 2K9YA 3MP7B 4XA4A 4I1LA 4B86A 3TF5A 1G2CA 5BVZA 1SQQD 3B4SA 3VTPC 1Q86Q 3KZIH 1L0LK 3JSVC 3WU2E 3HTKB 5TISH 1M8OB 2OYHC 1A02J 1JUNA 1ZV8A 1X22A 1DIPA 3JCUH 1P84E 3H1KJ 1VQ5P 2H43A 2BEQD 3VMYA 1LT9C 1SQQJ 2J5UA 4PD4I 4WVZA 3H1HD 1HTLC 5APYA 3CX5E 1SQXG 1KN7A 1PGPA 1JTHA 1T8ZA 2FYNC 2YXRB 4NPFX 1NAFA 1K04A 1KYOD 3L74D 4GT1A 2IFMA 4PD4D 4H44D 2I1JA 2RMZA 4DT0A 3KZIE 4N3YB 1DEEG 1G2CB 3WU2H 5APTA 3D70A 1SFCD 4L73A 3NTNA 1PP9G 1GW3A 4EIJA 5GTIH 5K5GB 2FFDB 1L0LE 2FYUJ 3KPEA 4R4MA 1Y9BA 1EDIA 3L74J 3MHVA 4ZKPA 2D2CB 1BCCE 1IFIA 1OVRA 2AEFA 1LT1A 1N7SC 1J1EC 1SFCC 1S5LX 1SQQK 1VL2A 2IX7C 5KJ7D 5KJ7A 1T2KD 1USEA 3GW6A 2OYHB 1QEXA 5APWA 5E79E 2UWJE 2XU6A 1N7SD 1NKZB 1BE3D 5M1BA 3T97A 4NPEA 2XZRA 3FWNA 1HGZA 1RF0A 3SFEC 1J1DC 4EOTA 2FYUG 2QG4A 1M1JB 3BCCG 1JY2N 2D2CD 2HYNA 2Y0EA 1IJDB 1MV8A 1J1DB 4U3FJ 5AVQB 5AVZB 5AW8B 2FFDC 3R2PA 1XTGB 3C1LA 3NMDA 4K35A 1FOSF 1SQXJ 2BCCD 2D2CC 2LXCB 3RGUA 2ZVOB 2RKLA 4W7YA 3TYYA 2KIKA 1HGVA 1M57D 3CLQA 2IDBA 3H1LD 3L70E 2FY8A 2E75D 1UIXA 1VQ7P 3H1LG 4H13B 1QLED 4JYBA 3H25A 3N4XA 1ZLLA 4LLHA 1OW6A 3H1IJ 2W6BA 1NU1D 2W6JH 3GHGA 4IL6E 2E75C 3T97B 2C0WA 3FXEA 2K88A 5CBOA 3KDPB 5CCGC 3EQ2A 3NFQA 1USDA 3CI9A 2QRXA 1EZVE 2R44A 1NTZE 2RN0A 4JQ0D 3V6IA 2OYHA 1NU1J 4WY4A 2V7QH 2QJPB 3N7NA 3CPWO 4OGQB 1PIXA 1NTME 2OTKE 1SP4A 2ZT9C 2BEZF 3A0BE 4KJMA 4H0LB 4BWNA 4IL6X 1BE3E 3IR9A 4PV1C 1IFDA 3BCCJ 5B5EE 3V2PA 2OQQA 3B5NB 1EQ7A 3M0DC 5AW0B 2ZT9D 3AE6C 1W2BO 3D6ZA 3CC7P 4AUWA 1JTHB 2P1JA 1BDDA 2E74C 1H88A 1QX8A 1NTZK 2B87A 4UB6E 3BRTB 3L70D 3RK3E 2P10A 4BXLA 3G4SP 2ZFCA 3A7OA 1N73B 3TNUB 1OX3A 2AXCA 2B88A 2OTJP 3RK3C 1NU1K 4XE5B 4WY4D 3G9RA 1W2EA 2SPZA 3KYQA 5AVUB 3L74G 4U3FG 5AW4B 2O01H 1LTJA 2Y0DA 4RKUJ 1N73A 1U7JA 1T2KC 1N73C 1PGQA 5APVA 1JEKA 4ZKUA 4PV1B 2YNYA 1FS0E 1HUCA 4D6TE 3CX5H 1UIIA 2Q5UA 1P84H 3CX5D 2QM8A 1IC2A 1KILC 5KKZB 1NH4A 1FZBA 2XNDH 3TSIA 3Q1MA 1EXJA 2W90A 5APXA 1SQQG 2E76C 2BCCE 2FYUD 2WPRA 3E1RA 3EFGA 3LW5J 4W7ZA 4C7NB 5KAFH 1S9KE 3H1KD 2J58A 5AVSB 1QVFO 1WRGA 2G3AA 3L73E 2J59M 1L0LG 2N1TB 2Q1KA 5KLIB 1MZ9A 3L72G 2NZ2A 1PP9J 3PJSK 4I7ZB 1BCCG 4DOJA 1L4AA 1ZRTE 2PRRA 1LTIC 2HFED 2IBZD 4GIFA 5KLVG 3D71A 2N1TA 1GTWA 1KORA 5AVVB 3GF3A 2R3CA 3GHGC 2W8ZA 3QH9A 3L71D 1PP9D 3GHGB 3CL3D 2CPBA 2M5AA 4OH8B 5APQA 4I2LC 1SQXD 1RE3C 1KQGB 3L71J 5CCGD 3P7KA 2WTYA 1RHZB 2DW3A 1AQTA 1GK6A 1NVOA 1L0NK 2ZYAA 1BGYJ 3EFFK 3H1LJ 3LIEA 2QSIA 2YO2A 3EWKA 1SQPE 2OGUA 1YTZT 1S9KD 2W83C 4TLFA 1M90Q 1EXIA 4WWIA 3H1ID 4U3FD 3SWKA 3CCSP 1LNQA 1JCDA 3TNUA 2WQYC 3AEAC 1GZLA 2B87B 3E1IA 3VP9A 2N1TC 1NU1E 3TDKA 1DD3A 1OW8A 2H88C 1ZW0A 3AEFC 3AEGC 2PP6A 1FZEA 1S3JA 1VDFA 2BCCG 3CX5I 3HE5A 1FAVA 1J1EB 4HKZH 5DJTB 4YXDC 1PZQA 3A0HE 3RL0C 3CCQP 5TISE 3IAOA 4KHXA 2A45H 1PP9E 1L0NJ 2GA1A 3SSUA 1R5SA 2A45G 2IBZI 1KILE 2JR8A 2YKQA 3A0BH 3BCCD 3JCUE 3CCJP 3CCLP 3PHLA 1HF9A 2FYZA 3GMAA 3V2NA 2QJYC 5CCHA 5KLVE 1SS1A 1DD4A 4WY4B 3L37A 1GL2B 3VYIA 2XKMA 4L75A 1T6AA 1FC2C 2AEJA 4LGDE 2FFDA 2K3RA 2POHA 1JY3P 1M1KQ 1N2DC 1NO4A 1LP1A 3L75G 1G1JA 2KS1B 4H0LD 1KMIZ 1NOHA 2QJYB 3O6QA 1PPJG 2E74B 1JMMA 3CXHI 3PLNA 4UB8E 1VQ4P 3L71G 3U1CA 3H1HE 2IBZE 3CXHD 3L35A 1KYOI 1SQVE 2JO1A 4IFMA 3I56P 2VRSA 2E5YA 2JKVA 1U7MA 3S4RA 2KI7B 4DJGA 1EDJA 1ZN5A 1FU1A 1GK4A 3HTKA 2NPSC 3L72D 3OW2O 1Z56A 4U3FE 4YPCA 1SQPG 2ZAEB 1JY2O 1KYOH 4PD4H 2ZT9B 3RL0g 1IO4A 2E75B 5AW9B 3HD7A 1OIPA 4GKGA 1CSBA 1KQLA 3FXDA 3L72J 1PFIA 1GW4A 3L4FA 1HH0A 1S1CX 2KZIA 1ZR4A 3E7KA 4C46A 1KV4A 2KUBA 3A2AA 1AVOA 2MKVA 3ABVC 2KNCB 2KSEA 1L0NE 2CPSA 3HE4A 1PGJA 3H1IE 4WB4A 4H13C 4A7PA 1E79H 1GD2E 2FXOA 1FZFA 1YITP 3R4YA 3CCRP 1NGMB 1X9VA 4H13D 1JY3N 1QL2A 2C9LY 3B5ND 2WVRA 5AW7B 5KTBA 1H8AA 1HWTC 1S5LE 1E5WA 5AVXB 1FBMA 1VF5C 2K9JB 2YKOA 1JMBA 1RE4A 1FDIA 3MTUE 5KAIE 2YMKA 4IFFA 1RF1B 2YXQB 2NRGA 1G1IA 1IFPA 1URQC 1JY2P 2CK3H 4GOFA 4N78E 3TGUE 1SQVG 3C8VA 3FGAD 5AVTB 3P8MC 5CCGA 1NTKJ 2QM7A 2N9YB 3AE5C 3C9IA 3PP5A 5APUA 1VQOP 2E43A 2WMMA 2FYUK 4RO0A 2JDIH 2WPSA 2XV5A 3M9QA 4HYTB 1NTKD 3AEEC 3WMM0 1FZCB 2HPCB 2WPVB 5GTHH 1SFCB 2LR2A 3LIDA 5CBNA 3M0DA 2Y9ZA 2M3EA 1SLQA 2YKPA 3VMAA 4GDOA 1T3UA 2A06D 1LTBC 3GF7A 3I5CA 3HD7D 1AA0A 2WSFJ 5AW3B 1S5LH 5KLVJ 1BSHA 2H7HA 1LTSC 2O1KA 2KOGA 3H1IG 3HUSA 5AW1B 1L0LJ 1OMIA 5L8RJ 1KILA 1KB9H 3VN0A 1ZP0C 3L74E 2O1JA 3HD7C 4HH2A 4LC1A 5AVYB 3H1JG 3BATA 4PJ0E 5AW6B 2ITAA 3Q2YA 1NWQA 1CI6B 1NTMG 5KAFE 4YXWH 3KXDA 2XDJA 2JWAA 4N78D 2OTLP 1AJYA 2OYIC 1IFJA 3FWLA 1BE3G 1AVYA 2I1KA 2OARA 3WUTA 2P58A 2E74D 3WUUA 5KKZC 2W6AA 1AQ5A 1FDMA 3USSA 3SWYA 3AE7C 1L4AC 1L2PA 3HUSB 3A5TA 3Q5PA 2Q7CA 4XFJA 3H32A
chains in the Genus database with same CATH topology
3RK3D 1X8YA 1AFOA 3L36A 1L4AD 2IFNA 2WPQA 2H8PD 2JJLA 1N7SA 1N7SB 1DEBA 3OA7A 1LWUC 2WWWA 3A3YB 1LTTC 1GL2C 1LWUB 1NHLA 2Q9IA 4W80A 1HVVA 1OWAA 2GM4A 1DH3A 2WSFH 1GL2D 2W27A 1LT9B 1VPCA 1JOCA 3P8CE 1RY3A 2KLVA 5AW2B 1LTGC 2GUVA 1JNMA 1J2JB 4C7RA 4WBAA 1OXZA 5CJ4A 1RF1C 3II6A 2NPSB 2HODB 1FZAA 3IFMA 2GUSA 4RESB 1DX7A 1JCCA 2P67A 2HG5D 3U59A 1GDTA 2HODA 1JO5A 5BU8B 1IFNA 2N9BA 1FZCC 1ZR2A 2WSCH 1SQXK 2C0XA 3M91A 3BRVB 4JF7A 2JEEA 2IPPA 1N7LA 1LTJC 2KB7P 2A45I 5CHXA 2Z4EA 3VOPA 2C9NY 1RF1A 2NPSA 2M3BA 3V4WA 1KILD 1LT9A 4O9BA 2KP8A 1FJKA 5AVRB 1NKNA 2OYIB 1FOSE 1GU4A 1URQB 2P7JA 1CZQA 1FZCA 3P8CD 3LW5H 1H89A 1NTMK 3V5BA 1RE4C 1XTCC 2R5BA 3SWFA 4Y99C 2HPCA 2WZ7A 2R32A 1KZUB 3B8EB 4Y99B 1URQA 1SQPK 2L5GB 1CI6A 2OYIA 3RK2B 4AYCA 1KFMA 3UIAA 1KILB 2N1TD 2M8RA 2PAJA 3G3ZA 2KYVA 2YO3A 3RL0D 3M9HA 3RK2D 1URQD 3V2QA 2P2UA 2WSEH 4N6JA 2FKWB 1M1JC 1YTZI 2FXMA 3HE4B 4C7NA 1GU5A 1RF0C 3RK2C 4WY4C 3M06A 3RL0B 5CCHD 5AVWB 1MUUA 2R5DA 5CJ0A 3MUDA 3H32B 4DZOA 3KQGA 1SQVK 3MIWA 1M7LA 5CCHC 4JYCA 5KLVK 3MGNA 1FZGA 1N86A 5CMZA 1YYCA 5APSA 1SVFA 2WITA 4M3LA 4IFDK 1X79B 2HLOA 2WT7B 3MD0A 3U1AA 1T3JA 1CW5A 1JY3O 1FJPA 1LTAC 2NPSD 2LKMA 2MJZA 3V4QA 3BASA 1GL2A 2XNXA 3OJAB 1LWUA 2ZXEB 3V2RA 1IK9A 1WT6A 2Z5HA 5KJ7C 3B5NC 2Q3IA 3M9BA 1HBWA 2KSJA 3O8ZA 2YMYA 3NXSA 1KFNA 3BVHA 1SQBK 1LTJB 3RK3B 2Z5IA 1M1JA 1A02F 1NTKK 3WMM0 3OAKA 3VMXA 3H6PA 3P32A 1MFZA 3TK1A 1RE3A 5BU5A 4I6MC 3M0AA 2BASA 3VMZA 3B5NA 1QL1A 3HE5B 1HJBA 1IFMA 1LGHB 4AQRD 5AW5B 1L4AB 3HUSC 1SFCA 3HRNA 3HD7B 2E42A 4XA4A 4I1LA 4B86A 1G2CA 5BVZA 3VTPC 1L0LK 3HTKB 1A02J 2OYHC 1JUNA 1ZV8A 2H43A 3VMYA 1LT9C 5APYA 1HTLC 1JTHA 1T8ZA 1NAFA 4GT1A 2IFMA 2I1JA 4N3YB 1G2CB 5APTA 1SFCD 3NTNA 1GW3A 4EIJA 2FFDB 3KPEA 4ZKPA 1IFIA 1N73A 3VP8A 1N7SC 1SFCC 1J1EC 1SQQK 2IX7C 5KJ7D 5KJ7A 1T2KD 2OYHB 5APWA 2XU6A 1N7SD 1NKZB 3T97A 2XZRA 1HGZA 1RF0A 1J1DC 4EOTA 1M1JB 1JY2N 2HYNA 1IJDB 1MV8A 1J1DB 5AVQB 5AVZB 5AW8B 2FFDC 3R2PA 1XTGB 3NMDA 1FOSF 4W7YA 3TYYA 1HGVA 3CLQA 4JYBA 3N4XA 1ZLLA 4LLHA 2W6BA 3GHGA 2C0WA 3KDPB 5CCGC 3EQ2A 3NFQA 3CI9A 2OYHA 4WY4A 3N7NA 1SP4A 3IR9A 1IFDA 3V2PA 3B5NB 1EQ7A 3M0DC 5AW0B 4AUWA 1JTHB 2P1JA 1H88A 1NTZK 3BRTB 1N73B 2ZFCA 3A7OA 3TNUB 3RK3C 1NU1K 4XE5B 4WY4D 1W2EA 5AVUB 3KYQA 5AW4B 1N73C 2O01H 1LTJA 1T2KC 5APVA 4ZKUA 2YNYA 1HUCA 2Q5UA 2QM8A 1IC2A 1KILC 1NH4A 1FZBA 3TSIA 5APXA 3EFGA 2WPRA 4W7ZA 4C7NB 1S9KE 2J58A 5AVSB 1WRGA 2J59M 2N1TB 1MZ9A 4DOJA 1L4AA 4GIFA 1LTIC 2HFED 2N1TA 1GTWA 5AVVB 2R3CA 3GHGC 3GHGB 3CL3D 2CPBA 4OH8B 5APQA 4I2LC 1RE3C 5CCGD 2WTYA 3P7KA 1GK6A 1L0NK 3LIEA 2YO2A 1YTZT 1S9KD 1JCDA 3TNUA 3VP9A 1GZLA 3E1IA 2N1TC 3HE5A 2PP6A 1FZEA 1VDFA 1FAVA 1J1EB 3RL0C 4KHXA 2A45H 2A45G 2YKQA 2FYZA 3V2NA 5CCHA 4WY4B 3L37A 1GL2B 3VYIA 2XKMA 2FFDA 4LGDE 2POHA 1JY3P 1N2DC 1NO4A 1G1JA 1NOHA 1JMMA 3U1CA 3L35A 4IFMA 2VRSA 1ZN5A 1FU1A 1GK4A 3HTKA 2NPSC 1Z56A 1JY2O 1IO4A 5AW9B 3HD7A 4GKGA 1CSBA 1KQLA 1PFIA 1GW4A 3L4FA 1HH0A 1ZR4A 4C46A 3A2AA 2CPSA 3HE4A 4WB4A 1GD2E 1FZFA 1X9VA 1JY3N 1QL2A 2C9LY 3B5ND 5AW7B 5KTBA 1H8AA 1HWTC 1E5WA 5AVXB 1FBMA 2YKOA 1RE4A 3MTUE 4IFFA 1RF1B 1G1IA 1URQC 1JY2P 4N78E 5AVTB 3P8MC 5CCGA 5APUA 2QM7A 3C9IA 3PP5A 2WT7A 2E43A 2FYUK 2WPSA 2XV5A 3M9QA 4HYTB 1FZCB 2HPCB 1SFCB 3LIDA 3M0DA 1SLQA 2YKPA 1T3UA 1LTBC 3I5CA 5AW3B 3HD7D 2H7HA 1LTSC 2O1KA 2KOGA 3HUSA 5AW1B 3VN0A 1KILA 2O1JA 3HD7C 4HH2A 4LC1A 5AVYB 3BATA 1NWQA 5AW6B 1CI6B 2XDJA 4N78D 2OYIC 1IFJA 2I1KA 2OARA 1AQ5A 2W6AA 1FDMA 3SWYA 1L4AC 3HUSB 3A5TA 2Q7CA 3H32A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TNU A;  1X8Y A;  1GZL A;  3L36 A;  2YO3 A;  1T2K D;  3M9H A;  3HE5 A;  5APW A;  2WPQ A;  2JJL A;  1FAV A;  2P2U A;  2XU6 A;  3HE4 B;  3T97 A;  2WWW A;  2XZR A;  4KHX A;  4C7N A;  1GU5 A;  4EOT A;  3A3Y B;  3M06 A;  5AVW B;  3L37 A;  3VYI A;  1MUU A;  1MV8 A;  1OWA A;  2R5D A;  5AVQ B;  5AVZ B;  5AW8 B;  1DH3 A;  4DZO A;  3KQG A;  2W27 A;  3NMD A;  1FOS F;  4JYC A;  3MGN A;  3TYY A;  5CMZ A;  5AW2 B;  1YYC A;  5APS A;  4M3L A;  3L35 A;  1JNM A;  4JYB A;  2WT7 B;  2VRS A;  3MD0 A;  1J2J B;  1GK4 A;  3HTK A;  1OXZ A;  3KDP B;  3NFQ A;  1IO4 A;  5AW9 B;  4GKG A;  1CSB A;  1KQL A;  3V4Q A;  4RES B;  1SP4 A;  2P67 A;  2ZXE B;  4C46 A;  3A2A A;  3IR9 A;  2N9B A;  5AW0 B;  3HE4 A;  2Z5H A;  4AUW A;  1GD2 E;  2Q3I A;  3M9B A;  1HBW A;  3M91 A;  1H88 A;  2IPP A;  3O8Z A;  2C9L Y;  2ZFC A;  3A7O A;  5AW7 B;  3TNU B;  1H8A A;  1HWT C;  2C9N Y;  5AVX B;  3NXS A;  4XE5 B;  5AVU B;  5AW4 B;  3V4W A;  1T2K C;  2KP8 A;  5APV A;  5AVR B;  2YNY A;  1HUC A;  2Z5I A;  2Q5U A;  1FOS E;  5AVT B;  3P8M C;  2WT7 A;  2QM8 A;  2QM7 A;  5APU A;  1GU4 A;  1A02 F;  3OAK A;  3VMX A;  2E43 A;  2P7J A;  5APX A;  1CZQ A;  3P32 A;  2WPR A;  1MFZ A;  3TK1 A;  4C7N B;  1S9K E;  2WPS A;  1H89 A;  2XV5 A;  4I6M C;  3M0A A;  2BAS A;  3VMZ A;  4HYT B;  5AVS B;  3HE5 B;  3V5B A;  3LID A;  1HJB A;  3M0D A;  4AQR D;  1SLQ A;  5AW5 B;  2R5B A;  1GTW A;  3SWF A;  5AVV B;  3I5C A;  5AW3 B;  2R3C A;  2E42 A;  4B86 A;  2R32 A;  2H7H A;  5AW1 B;  3VTP C;  3VN0 A;  3B8E B;  1A02 J;  1JUN A;  4LC1 A;  5AVY B;  5APQ A;  4I2L C;  5AW6 B;  1NWQ A;  1CI6 B;  1CI6 A;  3VMY A;  2WTY A;  3P7K A;  5APY A;  1GK6 A;  4AYC A;  3UIA A;  3LIE A;  1NAF A;  4GT1 A;  2W6A A;  2YO2 A;  1G2C B;  3A5T A;  5APT A;  1S9K D;  2Q7C A;  3NTN A; 
#chains in the Genus database with same CATH topology
 3RK3 D;  1X8Y A;  3L73 G;  1AFO A;  3L36 A;  1L4A D;  1BDC A;  3L72 E;  1KQF B;  3PRJ A;  2IFN A;  1LJ2 A;  1PPJ D;  2WPQ A;  2B9B A;  2YIU B;  2H8P D;  2JJL A;  3CWB D;  1BGY E;  1N7S A;  1N7S B;  1YBK A;  1DEB A;  3OA7 A;  2E5T A;  1LWU C;  2WWW A;  4HJG H;  4ASW A;  2QIW A;  2YIU C;  3A3Y B;  2O01 N;  3L75 D;  1LTT C;  1GL2 C;  1SQB G;  5B66 H;  1LWU B;  3CC4 P;  1NHL A;  5TJH A;  5B66 E;  1Q82 Q;  2Q9I A;  3CWB J;  4W80 A;  2FYU E;  1HVV A;  1OWA A;  2GM4 A;  3MZW B;  1DH3 A;  2WSF H;  3MUD C;  2AXT H;  1GL2 D;  2W27 A;  1LT9 B;  3H1J D;  1H0T B;  1VPC A;  3AE4 C;  1JOC A;  4BRY B;  3P8C E;  1OVU A;  1H0T A;  1RY3 A;  1KD1 Q;  2KLV A;  2PGD A;  2R3S A;  1NTM J;  2QE7 H;  5AW2 B;  3A0H H;  1BSN A;  1ZRT D;  1YIJ P;  1PGO A;  1YQ4 C;  1LTG C;  2GUV A;  2O3J A;  1JNM A;  2A06 E;  2IZ0 A;  1HJ0 A;  1Y47 A;  3PTZ A;  4D6T G;  1VQM P;  3AE1 C;  1YJ9 P;  3TGU J;  1J2J B;  4C7R A;  4WBA A;  1OXZ A;  5CJ4 A;  4OWF A;  5DJU B;  1R8E A;  1RF1 C;  1PPJ E;  1NAY A;  3II6 A;  1NJI Q;  2WT7 A;  2QJP C;  2NPS B;  2V4H A;  1M56 D;  5EFW B;  3TGU D;  1BGY D;  2HOD B;  1FZA A;  3IFM A;  3F89 A;  1EZV G;  2GUS A;  1SQB D;  1JB0 J;  4RES B;  3D6Y A;  1DX7 A;  1JCC A;  2P67 A;  2HG5 D;  3AE2 C;  3U59 A;  2HOD A;  1GDT A;  1JO5 A;  1YHQ P;  5BU8 B;  1IFN A;  2N9B A;  3CWB G;  1FZC C;  1ZR2 A;  3G71 P;  1NTZ D;  2WSC H;  4QMA A;  2QJK B;  5KLI C;  4D6T J;  4EYY Q;  1SQX K;  3AEC C;  4I7Z C;  1KC8 Q;  2C0X A;  3M91 A;  3BRV B;  4JF7 A;  2JEE A;  2PFX A;  1NTZ J;  3I55 P;  1L0L D;  1N7L A;  2IPP A;  1LTJ C;  2KB7 P;  2A45 I;  1RH5 B;  2IBZ G;  1L0N D;  5CHX A;  3VOP A;  2AEM A;  1BCC D;  4D6T D;  2Z4E A;  2C9N Y;  1K73 Q;  2WSS H;  1RF1 A;  1D7M A;  2IYP A;  2NPS A;  3L73 J;  2ZXX A;  3PH0 A;  2M3B A;  3V4W A;  1KIL D;  1LT9 A;  4O9B A;  1VF5 B;  1LP1 B;  2KP8 A;  1FJK A;  5AVR B;  1NKN A;  1VQ6 P;  3AE8 C;  1PV3 A;  2OYI B;  1U57 A;  1FOS E;  1VQN P;  1GU4 A;  4EDF A;  4IL6 H;  2IZ1 A;  2JWD A;  1URQ B;  4GOD A;  2P7J A;  2KLU A;  1CZQ A;  1Y8A A;  1FZC A;  3P8C D;  4DCK A;  3LW5 H;  1H89 A;  1NTM K;  4U7J A;  3WUV A;  4BRY A;  3JC2 2;  2K1A A;  1Q81 Q;  2E76 D;  3AE9 C;  3V5B A;  4JBZ A;  4L74 A;  1VQL P;  1EC5 A;  4L76 A;  1X0T A;  1YI2 P;  1YJW P;  1RE4 C;  3H1L E;  2Q3E A;  3AEB C;  1FDO A;  1XTC C;  3RBZ A;  2R5B A;  1YJN P;  3CXH H;  3SWF A;  1SQP J;  1NTK E;  2JP3 A;  3CWB E;  4Y99 C;  2ZYD A;  2Y0C A;  2HPC A;  2WZ7 A;  2R32 A;  1KZU B;  2K9J A;  3S9O A;  3Q5R A;  3B8E B;  4GOE A;  4Y99 B;  3H1K G;  3H1J J;  2E76 B;  4JPZ B;  1URQ A;  1SQP K;  2L5G B;  1ZOY C;  3CD6 P;  1CI6 A;  2WSC J;  2B89 A;  2OYI A;  3TGU G;  1K05 A;  3IN6 A;  3RK2 B;  4AYC A;  1KFM A;  3UIA A;  1KIL B;  2M0B A;  3L75 J;  3S1K A;  4MN4 C;  2KK7 A;  3KHU A;  1VQP P;  2KS1 A;  2N1T D;  2OYO A;  3CCM P;  1OW7 A;  4PV1 D;  2M8R A;  2PAJ A;  1MFT A;  2QEX P;  1VF5 D;  3G3Z A;  2A06 G;  2HR3 A;  2KYV A;  2YO3 A;  3RL0 D;  2IYO A;  4ASV A;  5GTH E;  2QVA A;  3M9H A;  1Q7Y Q;  3RK2 D;  1URQ D;  1SQB J;  3V2Q A;  1S72 P;  4K3A A;  2P2U A;  2KXP B;  2WSE H;  4N6J A;  3L70 J;  2FKW B;  1KB9 E;  1M1J C;  1YTZ I;  2FXM A;  3H1H J;  3HE4 B;  4C7N A;  4UB8 H;  4R4L A;  1SQV J;  1GU5 A;  1RF0 C;  1RQU A;  3RK2 C;  4WY4 C;  4PJ0 H;  2FXP A;  3G6E P;  3Q3D A;  4H0L C;  1AV1 A;  3F5H A;  3AED C;  4OGQ D;  3M06 A;  3RL0 B;  1QGK B;  4ZNC A;  5AVW B;  5CCH D;  1EDK A;  4RJT A;  2G8Y A;  1MUU A;  2R5D A;  2ZJS E;  3H32 B;  3CXH E;  3MUD A;  1SQV D;  2I8D A;  3KQG A;  5CJ0 A;  4DZO A;  2RH0 A;  3CMA P;  1SQV K;  3MIW A;  4OGQ C;  2ZYG A;  1M7L A;  1BGY G;  4H44 B;  5CCH C;  4JYC A;  1P84 I;  4HB1 A;  1EZV I;  1KYO E;  3Q5S A;  3CME P;  2KZJ A;  3MGN A;  4Z1M H;  3H1K E;  1KB9 I;  5KLV K;  1N86 A;  5KLV D;  1FZG A;  5CMZ A;  1YYC A;  5APS A;  1ZXG A;  1SVF A;  2WIT A;  3L73 D;  4M3L A;  3ZDM A;  4IFD K;  1BE3 J;  1GMJ A;  1X79 B;  2HLO A;  5B5E H;  5C39 A;  2WT7 B;  3MD0 A;  1TU3 F;  1VQ8 P;  1IK7 A;  4KT0 J;  5E79 H;  3U1A A;  3W68 A;  1S2E A;  1YQ3 C;  1WMK A;  1T3J A;  5KAI H;  1CW5 A;  2AXT E;  1JY3 O;  3W67 A;  1FJP A;  1BCC J;  1LTA C;  2NPS D;  2LKM A;  1MKM A;  2MJZ A;  4ZMD A;  3V4Q A;  3BAS A;  1GL2 A;  1NYH A;  2XNX A;  1IZN B;  3OJA B;  4H44 C;  1LWU A;  2O01 J;  4YTP C;  1QVG O;  1P84 D;  3CC2 P;  2ZXE B;  3V2R A;  1IK9 A;  1KB9 D;  3CCE P;  1WT6 A;  1OFC X;  1R5L A;  4OVN F;  2Z5H A;  2V7Q J;  1FE6 A;  1L0N G;  3B5N C;  1SQP D;  3IF4 A;  2Q3I A;  3GLM A;  3M9B A;  3QWO C;  5KJ7 C;  3L70 G;  1HBW A;  2KSJ A;  3RBX A;  1N8R Q;  1W5C E;  3CCV P;  1PL5 A;  3O8Z A;  3H1J E;  2BCC J;  1EDL A;  2FBW C;  2WSE J;  1K9M Q;  2ZVN B;  1NTK G;  1SQX E;  1Q90 D;  1SQQ E;  1KFN A;  2Q6Q A;  2YMY A;  3NXS A;  3BVH A;  1SQB K;  2H89 C;  1LTJ B;  4TT3 H;  3VP8 A;  3L75 E;  3SFD C;  4NPD A;  5H2F E;  3RK3 B;  1NTZ G;  1KQS O;  2Z5I A;  4IOI H;  1EZV D;  3FX0 A;  4CPG A;  1M1J A;  1JM0 A;  1A02 F;  1NTK K;  1Q2N A;  2QJK C;  2Y9Y A;  3H1H G;  3K5B A;  3H6P A;  3OAK A;  3VMX A;  3AE3 C;  1NTM D;  3B71 A;  4PD4 E;  4UB6 H;  3P32 A;  2K37 A;  2M5A B;  1VQK P;  2L91 A;  1MFZ A;  3TK1 A;  1RE3 A;  5BU5 A;  4I6M C;  1RQV A;  3M0A A;  2BAS A;  3O6Q B;  2KNC A;  3VMZ A;  3CCU P;  5H2F H;  3B5N A;  1SQB E;  5GTI E;  3GG2 A;  1QL1 A;  3HE5 B;  2FYN B;  2QA4 P;  3L71 E;  4Y28 J;  1HJB A;  1IFM A;  1VQ9 P;  1S4X A;  1NU1 G;  1LGH B;  1OZH A;  2LXB A;  4AQR D;  1OVV A;  3ITK A;  5AW5 B;  1ZME C;  1L4A B;  3HUS C;  3BCC E;  4EI2 A;  1K8A Q;  1SFC A;  3HRN A;  3HD7 B;  1KTM A;  2E42 A;  2K9Y A;  3MP7 B;  4XA4 A;  4I1L A;  4B86 A;  3TF5 A;  1G2C A;  5BVZ A;  1SQQ D;  3B4S A;  3VTP C;  1Q86 Q;  3KZI H;  1L0L K;  3JSV C;  3WU2 E;  3HTK B;  5TIS H;  1M8O B;  2OYH C;  1A02 J;  1JUN A;  1ZV8 A;  1X22 A;  1DIP A;  3JCU H;  1P84 E;  3H1K J;  1VQ5 P;  2H43 A;  2BEQ D;  3VMY A;  1LT9 C;  1SQQ J;  2J5U A;  4PD4 I;  4WVZ A;  3H1H D;  1HTL C;  5APY A;  3CX5 E;  1SQX G;  1KN7 A;  1PGP A;  1JTH A;  1T8Z A;  2FYN C;  2YXR B;  4NPF X;  1NAF A;  1K04 A;  1KYO D;  3L74 D;  4GT1 A;  2IFM A;  4PD4 D;  4H44 D;  2I1J A;  2RMZ A;  4DT0 A;  3KZI E;  4N3Y B;  1DEE G;  1G2C B;  3WU2 H;  5APT A;  3D70 A;  1SFC D;  4L73 A;  3NTN A;  1PP9 G;  1GW3 A;  4EIJ A;  5GTI H;  5K5G B;  2FFD B;  1L0L E;  2FYU J;  3KPE A;  4R4M A;  1Y9B A;  1EDI A;  3L74 J;  3MHV A;  4ZKP A;  2D2C B;  1BCC E;  1IFI A;  1OVR A;  2AEF A;  1LT1 A;  1N7S C;  1J1E C;  1SFC C;  1S5L X;  1SQQ K;  1VL2 A;  2IX7 C;  5KJ7 D;  5KJ7 A;  1T2K D;  1USE A;  3GW6 A;  2OYH B;  1QEX A;  5APW A;  5E79 E;  2UWJ E;  2XU6 A;  1N7S D;  1NKZ B;  1BE3 D;  5M1B A;  3T97 A;  4NPE A;  2XZR A;  3FWN A;  1HGZ A;  1RF0 A;  3SFE C;  1J1D C;  4EOT A;  2FYU G;  2QG4 A;  1M1J B;  3BCC G;  1JY2 N;  2D2C D;  2HYN A;  2Y0E A;  1IJD B;  1MV8 A;  1J1D B;  4U3F J;  5AVQ B;  5AVZ B;  5AW8 B;  2FFD C;  3R2P A;  1XTG B;  3C1L A;  3NMD A;  4K35 A;  1FOS F;  1SQX J;  2BCC D;  2D2C C;  2LXC B;  3RGU A;  2ZVO B;  2RKL A;  4W7Y A;  3TYY A;  2KIK A;  1HGV A;  1M57 D;  3CLQ A;  2IDB A;  3H1L D;  3L70 E;  2FY8 A;  2E75 D;  1UIX A;  1VQ7 P;  3H1L G;  4H13 B;  1QLE D;  4JYB A;  3H25 A;  3N4X A;  1ZLL A;  4LLH A;  1OW6 A;  3H1I J;  2W6B A;  1NU1 D;  2W6J H;  3GHG A;  4IL6 E;  2E75 C;  3T97 B;  2C0W A;  3FXE A;  2K88 A;  5CBO A;  3KDP B;  5CCG C;  3EQ2 A;  3NFQ A;  1USD A;  3CI9 A;  2QRX A;  1EZV E;  2R44 A;  1NTZ E;  2RN0 A;  4JQ0 D;  3V6I A;  2OYH A;  1NU1 J;  4WY4 A;  2V7Q H;  2QJP B;  3N7N A;  3CPW O;  4OGQ B;  1PIX A;  1NTM E;  2OTK E;  1SP4 A;  2ZT9 C;  2BEZ F;  3A0B E;  4KJM A;  4H0L B;  4BWN A;  4IL6 X;  1BE3 E;  3IR9 A;  4PV1 C;  1IFD A;  3BCC J;  5B5E E;  3V2P A;  2OQQ A;  3B5N B;  1EQ7 A;  3M0D C;  5AW0 B;  2ZT9 D;  3AE6 C;  1W2B O;  3D6Z A;  3CC7 P;  4AUW A;  1JTH B;  2P1J A;  1BDD A;  2E74 C;  1H88 A;  1QX8 A;  1NTZ K;  2B87 A;  4UB6 E;  3BRT B;  3L70 D;  3RK3 E;  2P10 A;  4BXL A;  3G4S P;  2ZFC A;  3A7O A;  1N73 B;  3TNU B;  1OX3 A;  2AXC A;  2B88 A;  2OTJ P;  3RK3 C;  1NU1 K;  4XE5 B;  4WY4 D;  3G9R A;  1W2E A;  2SPZ A;  3KYQ A;  5AVU B;  3L74 G;  4U3F G;  5AW4 B;  2O01 H;  1LTJ A;  2Y0D A;  4RKU J;  1N73 A;  1U7J A;  1T2K C;  1N73 C;  1PGQ A;  5APV A;  1JEK A;  4ZKU A;  4PV1 B;  2YNY A;  1FS0 E;  1HUC A;  4D6T E;  3CX5 H;  1UII A;  2Q5U A;  1P84 H;  3CX5 D;  2QM8 A;  1IC2 A;  1KIL C;  5KKZ B;  1NH4 A;  1FZB A;  2XND H;  3TSI A;  3Q1M A;  1EXJ A;  2W90 A;  5APX A;  1SQQ G;  2E76 C;  2BCC E;  2FYU D;  2WPR A;  3E1R A;  3EFG A;  3LW5 J;  4W7Z A;  4C7N B;  5KAF H;  1S9K E;  3H1K D;  2J58 A;  5AVS B;  1QVF O;  1WRG A;  2G3A A;  3L73 E;  2J59 M;  1L0L G;  2N1T B;  2Q1K A;  5KLI B;  1MZ9 A;  3L72 G;  2NZ2 A;  1PP9 J;  3PJS K;  4I7Z B;  1BCC G;  4DOJ A;  1L4A A;  1ZRT E;  2PRR A;  1LTI C;  2HFE D;  2IBZ D;  4GIF A;  5KLV G;  3D71 A;  2N1T A;  1GTW A;  1KOR A;  5AVV B;  3GF3 A;  2R3C A;  3GHG C;  2W8Z A;  3QH9 A;  3L71 D;  1PP9 D;  3GHG B;  3CL3 D;  2CPB A;  2M5A A;  4OH8 B;  5APQ A;  4I2L C;  1SQX D;  1RE3 C;  1KQG B;  3L71 J;  5CCG D;  3P7K A;  2WTY A;  1RHZ B;  2DW3 A;  1AQT A;  1GK6 A;  1NVO A;  1L0N K;  2ZYA A;  1BGY J;  3EFF K;  3H1L J;  3LIE A;  2QSI A;  2YO2 A;  3EWK A;  1SQP E;  2OGU A;  1YTZ T;  1S9K D;  2W83 C;  4TLF A;  1M90 Q;  1EXI A;  4WWI A;  3H1I D;  4U3F D;  3SWK A;  3CCS P;  1LNQ A;  1JCD A;  3TNU A;  2WQY C;  3AEA C;  1GZL A;  2B87 B;  3E1I A;  3VP9 A;  2N1T C;  1NU1 E;  3TDK A;  1DD3 A;  1OW8 A;  2H88 C;  1ZW0 A;  3AEF C;  3AEG C;  2PP6 A;  1FZE A;  1S3J A;  1VDF A;  2BCC G;  3CX5 I;  3HE5 A;  1FAV A;  1J1E B;  4HKZ H;  5DJT B;  4YXD C;  1PZQ A;  3A0H E;  3RL0 C;  3CCQ P;  5TIS E;  3IAO A;  4KHX A;  2A45 H;  1PP9 E;  1L0N J;  2GA1 A;  3SSU A;  1R5S A;  2A45 G;  2IBZ I;  1KIL E;  2JR8 A;  2YKQ A;  3A0B H;  3BCC D;  3JCU E;  3CCJ P;  3CCL P;  3PHL A;  1HF9 A;  2FYZ A;  3GMA A;  3V2N A;  2QJY C;  5CCH A;  5KLV E;  1SS1 A;  1DD4 A;  4WY4 B;  3L37 A;  1GL2 B;  3VYI A;  2XKM A;  4L75 A;  1T6A A;  1FC2 C;  2AEJ A;  4LGD E;  2FFD A;  2K3R A;  2POH A;  1JY3 P;  1M1K Q;  1N2D C;  1NO4 A;  1LP1 A;  3L75 G;  1G1J A;  2KS1 B;  4H0L D;  1KMI Z;  1NOH A;  2QJY B;  3O6Q A;  1PPJ G;  2E74 B;  1JMM A;  3CXH I;  3PLN A;  4UB8 E;  1VQ4 P;  3L71 G;  3U1C A;  3H1H E;  2IBZ E;  3CXH D;  3L35 A;  1KYO I;  1SQV E;  2JO1 A;  4IFM A;  3I56 P;  2VRS A;  2E5Y A;  2JKV A;  1U7M A;  3S4R A;  2KI7 B;  4DJG A;  1EDJ A;  1ZN5 A;  1FU1 A;  1GK4 A;  3HTK A;  2NPS C;  3L72 D;  3OW2 O;  1Z56 A;  4U3F E;  4YPC A;  1SQP G;  2ZAE B;  1JY2 O;  1KYO H;  4PD4 H;  2ZT9 B;  3RL0 g;  1IO4 A;  2E75 B;  5AW9 B;  3HD7 A;  1OIP A;  4GKG A;  1CSB A;  1KQL A;  3FXD A;  3L72 J;  1PFI A;  1GW4 A;  3L4F A;  1HH0 A;  1S1C X;  2KZI A;  1ZR4 A;  3E7K A;  4C46 A;  1KV4 A;  2KUB A;  3A2A A;  1AVO A;  2MKV A;  3ABV C;  2KNC B;  2KSE A;  1L0N E;  2CPS A;  3HE4 A;  1PGJ A;  3H1I E;  4WB4 A;  4H13 C;  4A7P A;  1E79 H;  1GD2 E;  2FXO A;  1FZF A;  1YIT P;  3R4Y A;  3CCR P;  1NGM B;  1X9V A;  4H13 D;  1JY3 N;  1QL2 A;  2C9L Y;  3B5N D;  2WVR A;  5AW7 B;  5KTB A;  1H8A A;  1HWT C;  1S5L E;  1E5W A;  5AVX B;  1FBM A;  1VF5 C;  2K9J B;  2YKO A;  1JMB A;  1RE4 A;  1FDI A;  3MTU E;  5KAI E;  2YMK A;  4IFF A;  1RF1 B;  2YXQ B;  2NRG A;  1G1I A;  1IFP A;  1URQ C;  1JY2 P;  2CK3 H;  4GOF A;  4N78 E;  3TGU E;  1SQV G;  3C8V A;  3FGA D;  5AVT B;  3P8M C;  5CCG A;  1NTK J;  2QM7 A;  2N9Y B;  3AE5 C;  3C9I A;  3PP5 A;  5APU A;  1VQO P;  2E43 A;  2WMM A;  2FYU K;  4RO0 A;  2JDI H;  2WPS A;  2XV5 A;  3M9Q A;  4HYT B;  1NTK D;  3AEE C;  3WMM 0;  1FZC B;  2HPC B;  2WPV B;  5GTH H;  1SFC B;  2LR2 A;  3LID A;  5CBN A;  3M0D A;  2Y9Z A;  2M3E A;  1SLQ A;  2YKP A;  3VMA A;  4GDO A;  1T3U A;  2A06 D;  1LTB C;  3GF7 A;  3I5C A;  3HD7 D;  1AA0 A;  2WSF J;  5AW3 B;  1S5L H;  5KLV J;  1BSH A;  2H7H A;  1LTS C;  2O1K A;  2KOG A;  3H1I G;  3HUS A;  5AW1 B;  1L0L J;  1OMI A;  5L8R J;  1KIL A;  1KB9 H;  3VN0 A;  1ZP0 C;  3L74 E;  2O1J A;  3HD7 C;  4HH2 A;  4LC1 A;  5AVY B;  3H1J G;  3BAT A;  4PJ0 E;  5AW6 B;  2ITA A;  3Q2Y A;  1NWQ A;  1CI6 B;  1NTM G;  5KAF E;  4YXW H;  3KXD A;  2XDJ A;  2JWA A;  4N78 D;  2OTL P;  1AJY A;  2OYI C;  1IFJ A;  3FWL A;  1BE3 G;  1AVY A;  2I1K A;  2OAR A;  3WUT A;  2P58 A;  2E74 D;  3WUU A;  5KKZ C;  2W6A A;  1AQ5 A;  1FDM A;  3USS A;  3SWY A;  3AE7 C;  1L4A C;  1L2P A;  3HUS B;  3A5T A;  3Q5P A;  2Q7C A;  4XFJ A;  3H32 A; 
#chains in the Genus database with same CATH homology
 3RK3 D;  1X8Y A;  1AFO A;  3L36 A;  1L4A D;  2IFN A;  2WPQ A;  2H8P D;  2JJL A;  1N7S A;  1N7S B;  1DEB A;  3OA7 A;  1LWU C;  2WWW A;  3A3Y B;  1LTT C;  1GL2 C;  1LWU B;  1NHL A;  2Q9I A;  4W80 A;  1HVV A;  1OWA A;  2GM4 A;  1DH3 A;  2WSF H;  1GL2 D;  2W27 A;  1LT9 B;  1VPC A;  1JOC A;  3P8C E;  1RY3 A;  2KLV A;  5AW2 B;  1LTG C;  2GUV A;  1JNM A;  1J2J B;  4C7R A;  4WBA A;  1OXZ A;  5CJ4 A;  1RF1 C;  3II6 A;  2NPS B;  2HOD B;  1FZA A;  3IFM A;  2GUS A;  4RES B;  1DX7 A;  1JCC A;  2P67 A;  2HG5 D;  3U59 A;  1GDT A;  2HOD A;  1JO5 A;  5BU8 B;  1IFN A;  2N9B A;  1FZC C;  1ZR2 A;  2WSC H;  1SQX K;  2C0X A;  3M91 A;  3BRV B;  4JF7 A;  2JEE A;  2IPP A;  1N7L A;  1LTJ C;  2KB7 P;  2A45 I;  5CHX A;  2Z4E A;  3VOP A;  2C9N Y;  1RF1 A;  2NPS A;  2M3B A;  3V4W A;  1KIL D;  1LT9 A;  4O9B A;  2KP8 A;  1FJK A;  5AVR B;  1NKN A;  2OYI B;  1FOS E;  1GU4 A;  1URQ B;  2P7J A;  1CZQ A;  1FZC A;  3P8C D;  3LW5 H;  1H89 A;  1NTM K;  3V5B A;  1RE4 C;  1XTC C;  2R5B A;  3SWF A;  4Y99 C;  2HPC A;  2WZ7 A;  2R32 A;  1KZU B;  3B8E B;  4Y99 B;  1URQ A;  1SQP K;  2L5G B;  1CI6 A;  2OYI A;  3RK2 B;  4AYC A;  1KFM A;  3UIA A;  1KIL B;  2N1T D;  2M8R A;  2PAJ A;  3G3Z A;  2KYV A;  2YO3 A;  3RL0 D;  3M9H A;  3RK2 D;  1URQ D;  3V2Q A;  2P2U A;  2WSE H;  4N6J A;  2FKW B;  1M1J C;  1YTZ I;  2FXM A;  3HE4 B;  4C7N A;  1GU5 A;  1RF0 C;  3RK2 C;  4WY4 C;  3M06 A;  3RL0 B;  5CCH D;  5AVW B;  1MUU A;  2R5D A;  5CJ0 A;  3MUD A;  3H32 B;  4DZO A;  3KQG A;  1SQV K;  3MIW A;  1M7L A;  5CCH C;  4JYC A;  5KLV K;  3MGN A;  1FZG A;  1N86 A;  5CMZ A;  1YYC A;  5APS A;  1SVF A;  2WIT A;  4M3L A;  4IFD K;  1X79 B;  2HLO A;  2WT7 B;  3MD0 A;  3U1A A;  1T3J A;  1CW5 A;  1JY3 O;  1FJP A;  1LTA C;  2NPS D;  2LKM A;  2MJZ A;  3V4Q A;  3BAS A;  1GL2 A;  2XNX A;  3OJA B;  1LWU A;  2ZXE B;  3V2R A;  1IK9 A;  1WT6 A;  2Z5H A;  5KJ7 C;  3B5N C;  2Q3I A;  3M9B A;  1HBW A;  2KSJ A;  3O8Z A;  2YMY A;  3NXS A;  1KFN A;  3BVH A;  1SQB K;  1LTJ B;  3RK3 B;  2Z5I A;  1M1J A;  1A02 F;  1NTK K;  3WMM 0;  3OAK A;  3VMX A;  3H6P A;  3P32 A;  1MFZ A;  3TK1 A;  1RE3 A;  5BU5 A;  4I6M C;  3M0A A;  2BAS A;  3VMZ A;  3B5N A;  1QL1 A;  3HE5 B;  1HJB A;  1IFM A;  1LGH B;  4AQR D;  5AW5 B;  1L4A B;  3HUS C;  1SFC A;  3HRN A;  3HD7 B;  2E42 A;  4XA4 A;  4I1L A;  4B86 A;  1G2C A;  5BVZ A;  3VTP C;  1L0L K;  3HTK B;  1A02 J;  2OYH C;  1JUN A;  1ZV8 A;  2H43 A;  3VMY A;  1LT9 C;  5APY A;  1HTL C;  1JTH A;  1T8Z A;  1NAF A;  4GT1 A;  2IFM A;  2I1J A;  4N3Y B;  1G2C B;  5APT A;  1SFC D;  3NTN A;  1GW3 A;  4EIJ A;  2FFD B;  3KPE A;  4ZKP A;  1IFI A;  1N73 A;  3VP8 A;  1N7S C;  1SFC C;  1J1E C;  1SQQ K;  2IX7 C;  5KJ7 D;  5KJ7 A;  1T2K D;  2OYH B;  5APW A;  2XU6 A;  1N7S D;  1NKZ B;  3T97 A;  2XZR A;  1HGZ A;  1RF0 A;  1J1D C;  4EOT A;  1M1J B;  1JY2 N;  2HYN A;  1IJD B;  1MV8 A;  1J1D B;  5AVQ B;  5AVZ B;  5AW8 B;  2FFD C;  3R2P A;  1XTG B;  3NMD A;  1FOS F;  4W7Y A;  3TYY A;  1HGV A;  3CLQ A;  4JYB A;  3N4X A;  1ZLL A;  4LLH A;  2W6B A;  3GHG A;  2C0W A;  3KDP B;  5CCG C;  3EQ2 A;  3NFQ A;  3CI9 A;  2OYH A;  4WY4 A;  3N7N A;  1SP4 A;  3IR9 A;  1IFD A;  3V2P A;  3B5N B;  1EQ7 A;  3M0D C;  5AW0 B;  4AUW A;  1JTH B;  2P1J A;  1H88 A;  1NTZ K;  3BRT B;  1N73 B;  2ZFC A;  3A7O A;  3TNU B;  3RK3 C;  1NU1 K;  4XE5 B;  4WY4 D;  1W2E A;  5AVU B;  3KYQ A;  5AW4 B;  1N73 C;  2O01 H;  1LTJ A;  1T2K C;  5APV A;  4ZKU A;  2YNY A;  1HUC A;  2Q5U A;  2QM8 A;  1IC2 A;  1KIL C;  1NH4 A;  1FZB A;  3TSI A;  5APX A;  3EFG A;  2WPR A;  4W7Z A;  4C7N B;  1S9K E;  2J58 A;  5AVS B;  1WRG A;  2J59 M;  2N1T B;  1MZ9 A;  4DOJ A;  1L4A A;  4GIF A;  1LTI C;  2HFE D;  2N1T A;  1GTW A;  5AVV B;  2R3C A;  3GHG C;  3GHG B;  3CL3 D;  2CPB A;  4OH8 B;  5APQ A;  4I2L C;  1RE3 C;  5CCG D;  2WTY A;  3P7K A;  1GK6 A;  1L0N K;  3LIE A;  2YO2 A;  1YTZ T;  1S9K D;  1JCD A;  3TNU A;  3VP9 A;  1GZL A;  3E1I A;  2N1T C;  3HE5 A;  2PP6 A;  1FZE A;  1VDF A;  1FAV A;  1J1E B;  3RL0 C;  4KHX A;  2A45 H;  2A45 G;  2YKQ A;  2FYZ A;  3V2N A;  5CCH A;  4WY4 B;  3L37 A;  1GL2 B;  3VYI A;  2XKM A;  2FFD A;  4LGD E;  2POH A;  1JY3 P;  1N2D C;  1NO4 A;  1G1J A;  1NOH A;  1JMM A;  3U1C A;  3L35 A;  4IFM A;  2VRS A;  1ZN5 A;  1FU1 A;  1GK4 A;  3HTK A;  2NPS C;  1Z56 A;  1JY2 O;  1IO4 A;  5AW9 B;  3HD7 A;  4GKG A;  1CSB A;  1KQL A;  1PFI A;  1GW4 A;  3L4F A;  1HH0 A;  1ZR4 A;  4C46 A;  3A2A A;  2CPS A;  3HE4 A;  4WB4 A;  1GD2 E;  1FZF A;  1X9V A;  1JY3 N;  1QL2 A;  2C9L Y;  3B5N D;  5AW7 B;  5KTB A;  1H8A A;  1HWT C;  1E5W A;  5AVX B;  1FBM A;  2YKO A;  1RE4 A;  3MTU E;  4IFF A;  1RF1 B;  1G1I A;  1URQ C;  1JY2 P;  4N78 E;  5AVT B;  3P8M C;  5CCG A;  5APU A;  2QM7 A;  3C9I A;  3PP5 A;  2WT7 A;  2E43 A;  2FYU K;  2WPS A;  2XV5 A;  3M9Q A;  4HYT B;  1FZC B;  2HPC B;  1SFC B;  3LID A;  3M0D A;  1SLQ A;  2YKP A;  1T3U A;  1LTB C;  3I5C A;  5AW3 B;  3HD7 D;  2H7H A;  1LTS C;  2O1K A;  2KOG A;  3HUS A;  5AW1 B;  3VN0 A;  1KIL A;  2O1J A;  3HD7 C;  4HH2 A;  4LC1 A;  5AVY B;  3BAT A;  1NWQ A;  5AW6 B;  1CI6 B;  2XDJ A;  4N78 D;  2OYI C;  1IFJ A;  2I1K A;  2OAR A;  1AQ5 A;  2W6A A;  1FDM A;  3SWY A;  1L4A C;  3HUS B;  3A5T A;  2Q7C A;  3H32 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...