1SLQA

Crystal structure of the trimeric state of the rhesus rotavirus vp4 membrane interaction domain, vp5ct
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
270
structure length
270
Chain Sequence
DIVVSKTSLWKEMQYNRDITIRFKFASSIVKSGGLGYKWSEISFKPANYQYTYTRDGEEVTAHTTCSVNGMNDFNFNGGSLPTDFVISRYEVIKENSYVYVDYWDDSQAFRNMVYVRSLAANLNSVICTGGDYSFALPVGQWPVMTGGAVSLHSAGVTLSTQFTDFVSLNSLRFRFRLTVEEPSFSITRTRVSRLYGLPAANPNNGKEYYEVAGRFSLISLVPSNDDYQTPITNSVTVRQDLERQLGELREEFNALSQEIAMSQLIDLAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP4
publication title Structural rearrangements in the membrane penetration protein of a non-enveloped virus.
pubmed doi rcsb
source organism Rhesus rotavirus
molecule tags Viral protein
total genus 52
structure length 270
sequence length 270
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2004-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17477 Rota_VP4_MID Rotavirus VP4 membrane interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1slqA02
4JYBA 2R5BA 3I5CA 3MD0A 2XZRA 5AW3B 2N9BA 1MUUA 1NWQA 5AVVB 1HBWA 2E43A 1IO4A 3HE5A 1S9KD 3V4WA 4AYCA 1OXZA 3M0DA 2JJLA 1HWTC 1SP4A 4JYCA 4GKGA 1H88A 3KDPB 3OAKA 1A02F 3L36A 2WWWA 3L35A 1T2KC 2P67A 1GD2E 3MGNA 5AW2B 5APYA 3HE5B 3NTNA 3M91A 2KP8A 1MV8A 3NXSA 5AVZB 2QM7A 4LC1A 3TNUA 1CSBA 2P2UA 5AW8B 5APQA 3VYIA 2R5DA 4M3LA 5AVQB 1H89A 5CMZA 3A2AA 2P7JA 4XE5B 1T2KD 1JNMA 3M06A 1GK4A 2YNYA 1H8AA 1A02J 1OWAA 5AVTB 3TNUB 3VTPC 3O8ZA 1GU5A 1JUNA 3P7KA 3T97A 3V5BA 5AVUB 3LIDA 2YO3A 5APUA 3TYYA 2WPSA 3SWFA 3VMYA 3A5TA 4AUWA 1SLQA 2QM8A 3M0AA 5AW1B 2W27A 1FOSF 2WPRA 5AVYB 1NAFA 2WPQA 3B8EB 5APVA 2Q7CA 1FOSE 1G2CB 5APXA 3P8MC 5AW9B 1KQLA 4DZOA 2E42A 2XU6A 2R32A 1GTWA 3VMXA 2Q3IA 2Q5UA 5AVWB 3HTKA 3LIEA 4C46A 2WT7B 2XV5A 3L37A 2Z5IA 4RESB 1YYCA 1CI6A 1J2JB 2ZFCA 1X8YA 2ZXEB 4HYTB 5AVXB 3UIAA 2H7HA 2VRSA 3NMDA 3IR9A 2WTYA 3VMZA 5AW6B 3M9BA 5AW5B 5AW4B 5APWA 2IPPA 4GT1A 4AQRD 2WT7A 4C7NA 1HJBA 3A3YB 1CI6B 3V4QA 4KHXA 5AVRB 1GZLA 3M9HA 1HUCA 4EOTA 3KQGA 3HE4B 5AW0B 4I6MC 4B86A 2C9LY 2C9NY 3P32A 1FAVA 1GK6A 2YO2A 4C7NB 1CZQA 2Z5HA 3NFQA 1DH3A 2R3CA 2W6AA 1MFZA 1S9KE 2BASA 5APTA 3VN0A 5APSA 5AVSB 5AW7B 4I2LC 3A7OA 1GU4A 3TK1A 3HE4A
chains in the Genus database with same CATH superfamily
2AEJA 3L70E 3HD7B 2G3AA 1JOCA 5KJ7D 3V2NA 4WWIA 3CCVP 1OXZA 3TGUJ 3GHGC 3TGUE 2HYNA 1GD2E 3CXHI 3HE5B 3KPEA 3KXDA 2C0XA 2FBWC 2KP8A 3CCEP 3AE9C 4L74A 5CMZA 1IJDB 1Q90D 4LGDE 2XKMA 1IFNA 1AQTA 4ZNCA 1FZCB 2RKLA 1YBKA 1DD4A 3T97A 1S72P 4K35A 3VMYA 5KKZB 2KB7P 1NJIQ 4GIFA 1QL1A 3CMEP 1D7MA 1NTZJ 2Q7CA 5APXA 1E5WA 1OW7A 3A0HH 1SQPD 1NTZE 5KAFH 3BASA 3HTKA 3BATA 2Z5IA 3L37A 1PPJD 1CI6A 3CCMP 5CCGA 5B5EE 1G2CA 3CC2P 2WTYA 2BEZF 3CC7P 4PD4E 3D70A 1KQFB 1X9VA 2N9YB 2I1KA 2KIKA 2YXRB 3EFFK 3PJSK 2XNDH 1GL2A 3F5HA 3PTZA 3Q3DA 2KS1A 2P1JA 1ZW0A 1LT9C 1Y9BA 4U3FE 3H1HJ 3MUDA 5AW3B 5AVVB 3H1HE 3CWBJ 3CX5D 4NPDA 1IO4A 3CWBE 1QEXA 3W67A 1PGQA 2ZVOB 1Y47A 2WWWA 2ZT9C 3L35A 1T2KC 1J1DC 2G8YA 1DEBA 3L4FA 1LTJB 1OIPA 1ZR4A 2QM7A 1IFDA 2M0BA 4M3LA 3CD6P 2P7JA 2B89A 2A06E 2N1TD 1VQKP 2B87B 3H1LG 3B5NB 1KYOD 3H32B 2QJKC 3HRNA 2YO3A 3BCCJ 2BEQD 4UB8E 1NKNA 4H44C 5KLVE 3BCCE 4DZOA 1SFCB 3H1KJ 2NPSD 2E76D 4GDOA 1U57A 3H1KE 3CXHD 3OA7A 5AW5B 3RBXA 4GT1A 4AQRD 4DCKA 4D6TJ 3KQGA 1M90Q 5AW0B 4IL6E 2PGDA 2AEMA 1MFTA 1CZQA 1Q86Q 1SQBG 2E75B 3HD7A 1DH3A 1JY3P 3E7KA 2FYUG 1EZVG 4OGQC 3HE5A 1YITP 3KYQA 1BSHA 1IZNB 2BCCG 3AEEC 5B5EH 3EQ2A 4PD4H 3MGNA 2OQQA 1X22A 3SFDC 2DW3A 2I8DA 1CSBA 2P2UA 5CJ0A 3L72D 3C8VA 4XFJA 5CBOA 1BDCA 2WPVB 4PD4I 3L74D 5KLIC 1KTMA 1P84E 3V5BA 1JMBA 1GW4A 1N86A 2QM8A 4GOFA 2JR8A 2YIUC 1YQ4C 3S4RA 3AE7C 3RBZA 4CPGA 1VF5C 1LWUA 2QSIA 1L0LK 2IZ0A 1GTWA 2K88A 3LIEA 3L73E 1SQPJ 2JO1A 3H25A 1YI2P 2FYUD 2KLVA 3O6QB 2FYZA 4A7PA 4WY4C 5H2FE 2K1AA 4KHXA 3CCJP 2JP3A 3RK2B 2QEXP 1H0TB 1QLED 2YMYA 1OFCX 2IBZE 1L4AD 3HE4B 5L8RJ 3G3ZA 2C0WA 3VMAA 3RK3D 1FAVA 1NTME 1NH4A 1JY2P 2JWDA 4UB8H 3PLNA 2ZYDA 4ASVA 1GU4A 2D2CB 1GMJA 2XZRA 1MUUA 2HLOA 2POHA 4QMAA 1NTZG 1LTJA 3PP5A 1URQD 3V4WA 3JC22 1M57D 4GKGA 1NHLA 1A02F 1FU1A 2CK3H 1EDLA 4UB6E 1RHZB 2PP6A 2B87A 2OYIB 3RL0g 4IL6H 1M1JB 4TT3H 1N7LA 3TGUD 1N7SD 1SQVG 1DEEG 2FXPA 2YKOA 4U3FG 5APUA 2N1TC 3A5TA 1SFCA 2WZ7A 5M1BA 1Q2NA 4IFMA 2KLUA 2PFXA 2OARA 4W80A 1AVYA 2WT7B 4L75A 2QJPC 1X8YA 2FFDB 3MTUE 2LKMA 1VQ6P 1NTZD 1BSNA 4IFFA 5APWA 2O1KA 1HVVA 1HGZA 3V4QA 1PGJA 2A06G 1CW5A 1NU1K 2LXBA 1G1JA 1P84H 1W2EA 4PD4D 3II6A 1N73C 2E74C 1RF0A 1LGHB 4MN4C 2KNCB 1GL2C 5KLVG 3BCCG 5E79E 1P84I 1PGPA 1SQXK 2W6BA 4U3FD 4BWNA 3H1LJ 3L36A 3CI9A 2QJYC 1FZAA 3FWLA 3H1LE 4O9BA 2NPSB 2E76B 3H1HD 5H2FH 1MV8A 2ZYGA 3CWBD 1PL5A 3FWNA 1H89A 5CJ4A 2ZT9D 1T2KD 1KFMA 3N4XA 2YNYA 1SS1A 4PJ0E 3O8ZA 1M56D 3TYYA 1L2PA 1SLQA 2A06D 2WPQA 1EQ7A 5AW9B 3AE2C 1EXIA 2IYPA 4UB6H 3AE3C 1SQBJ 3S1KA 5KLVD 3TSIA 4H44D 3BCCD 1LT1A 2Y0CA 1OVRA 1SQBE 2B9BA 3E1IA 5TJHA 2FYUJ 1FZGA 2FYUE 2GUVA 2O01J 3H1KD 2OGUA 3PRJA 1EZVE 2FYNC 2BCCJ 1G1IA 3NFQA 2BCCE 3CPWO 3L71J 2BASA 1L4AC 3AEDC 3EFGA 1RQVA 1LNQA 3L71E 3Q5RA 4N78E 2K9JA 2ZAEB 1KILB 1Y8AA 3L73G 2OYHC 2OYIA 3BRVB 1URQC 1M1JA 5APYA 1KYOI 4W7YA 3NTNA 1YJNP 2Y9ZA 3NXSA 4OGQD 1IK7A 3CL3D 1LTIC 3ZDMA 3I55P 2IBZG 5AVQB 1NTMG 1VQLP 1S1CX 1K8AQ 2L5GB 3WUTA 3TNUB 1N7SC 1RQUA 3RK3B 5E79H 3B8EB 4HH2A 1P84D 3U1AA 2E42A 2R32A 3PH0A 2H43A 4C46A 2KSJA 4DJGA 3V2PA 3UIAA 1LWUC 4BRYB 1M8OB 1VF5D 1HJBA 3A3YB 3L73D 1KN7A 1VQNP 1HUCA 4ZKPA 2AXCA 2KNCA 1YHQP 4H0LD 3GHGB 4ASWA 1L0LJ 3QH9A 4WY4D 5APTA 1L0LE 4I2LC 5AW7B 2IBZD 4Y99B 1NTMD 1LP1B 1BE3G 1SQQK 1SQVJ 3HUSC 4AYCA 1BCCG 1SQVE 1GW3A 3L75E 4U3FJ 2P67A 5AW2B 4W7ZA 1YIJP 4LC1A 4WB4A 1JCCA 1LTAC 2O01H 2O1JA 1L0NK 1NKZB 2M5AA 1FDMA 1JTHA 2WMMA 1KQGB 1KQSO 3M0AA 1EZVI 1R5SA 1YQ3C 1NAFA 1AA0A 1KD1Q 3VMXA 2Q3IA 1SFCC 2IX7C 2J5UA 5CBNA 3CCRP 3ABVC 2H8PD 3MHVA 2I1JA 3FX0A 1LT9B 2RN0A 4JBZA 3Q2YA 5KLVJ 4XA4A 2LR2A 4YXWH 3I56P 1BCCD 3KZIE 2Y0EA 2ZT9B 1KILA 3D71A 1J1DB 1ZN5A 4YTPC 1L0NG 2AXTE 5CCGD 1VQ5P 1ZXGA 3I5CA 2QA4P 2N9BA 5BVZA 4PV1D 1HJ0A 1RF0C 3ITKA 4OVNF 1OVUA 3KHUA 1PP9G 1U7JA 2E74D 2P10A 3M0DA 2JJLA 4OH8B 1M7LA 1GL2D 2M3EA 1JM0A 1MZ9A 2QJKB 1PIXA 4I1LA 2CPSA 2XNXA 1NU1E 2IFNA 4H44B 3SFEC 3TNUA 1JCDA 4RJTA 1E79H 1MKMA 1HGVA 3H1LD 3M06A 1GK4A 2QVAA 1BGYG 1NTKK 1JY3O 1SQXJ 1GU5A 3L71G 1SQXE 1FOSF 5AW1B 1ZRTE 1R8EA 3GW6A 4YXDC 2O3JA 2CPBA 1FZCA 4I7ZC 5K5GB 2XU6A 4BRYA 2A45G 5C39A 4DOJA 5B66E 3IR9A 1YJ9P 1ZV8A 4DT0A 4WBAA 3RK2C 1LTGC 1Q7YQ 3L73J 1FC2C 1SQBD 1T3UA 3G71P 1LP1A 3W68A 4H0LC 3RL0C 3AE5C 1YTZI 1EZVD 2BCCD 4EIJA 1XTGB 1NTMJ 1SP4A 5KLIB 3L71D 4N78D 4HKZH 4L73A 3HD7D 1VQ4P 3CCSP 2YIUB 4EYYQ 2OYIC 1J1EB 4R4LA 3KZIH 1RF1C 2ZJSE 2KYVA 1VF5B 1WT6A 2AEFA 4XE5B 1JNMA 2KI7B 3GLMA 1FDIA 2AXTH 3PHLA 1L0LG 5DJTB 3LIDA 2QE7H 4WY4B 2XDJA 1K05A 5APVA 4ZMDA 3B5NA 1AQ5A 2V7QJ 1PGOA 1S2EA 1S5LE 3H32A 3GG2A 3L75G 1YYCA 2IFMA 1IFPA 1RE3A 3E1RA 1QVGO 5AVRB 5CCHA 1BE3J 3WUVA 1BCCJ 1BE3E 1GK6A 2E5YA 4GODA 1PZQA 2YMKA 1BCCE 2R3CA 5BU5A 3VN0A 5APSA 2R44A 2WQYC 1NWQA 1EDKA 1HBWA 2E43A 5CCGC 5B66H 5BU8B 4PV1C 1L0LD 1RE4A 1N2DC 3H1IG 3R4YA 1QGKB 2WVRA 2M3BA 2N1TB 5AVZB 1S3JA 3T97B 4IL6X 1SQVD 3VYIA 3AEGC 1ZLLA 3L75D 1HTLC 3C9IA 4IFDK 4YPCA 2WSCJ 2QJPB 3H1JG 3MUDC 1IFIA 2IYOA 2WSSH 5AVUB 1SQQE 1VL2A 4N6JA 1G2CB 1FJPA 3P8MC 2QIWA 2Q5UA 4NPEA 2W6JH 1N73B 2WITA 2W83C 1NGMB 1PV3A 3P8CE 2QG4A 1NU1G 3Q5PA 4GOEA 1VQ7P 3AE6C 1L0NJ 3A0BE 1GL2B 2KS1B 4JPZB 1L0NE 2IBZI 4H13C 5KJ7A 1SFCD 2ITAA 1K04A 1OX3A 2OTKE 3GF7A 1PP9J 2OTLP 3P32A 1K73Q 4C7NB 3O6QA 2WSEH 1PP9E 2GUSA 1SQXG 1S9KE 2QJYB 3TDKA 1H0TA 3HE4A 1OW8A 1S5LH 1SQPK 1KILE 2V7QH 2J59M 2ZXXA 1BGYJ 1W2BO 2KSEA 1BGYE 3M0DC 2Y9YA 2HR3A 3HD7C 1VQ8P 2O01N 2R5DA 1USDA 2IDBA 1NU1D 1X0TA 1USEA 3SWFA 1TU3F 5TISE 3Q1MA 2W27A 1RY3A 2FYNB 1JEKA 1SQXD 2ZFCA 2ZXEB 1ZRTD 1FZCC 2H7HA 1L4AB 1PPJG 1XTCC 1VQ9P 1NTKJ 2PRRA 5KKZC 5AW4B 1S5LX 3CMAP 2WT7A 1NTKE 1GZLA 1VQOP 3FGAD 2FFDA 2B88A 1RH5B 3CCQP 2OTJP 2NZ2A 3TF5A 2OYHB 3VOPA 2WSCH 2RMZA 3CCLP 2YO2A 2K37A 3BVHA 4R4MA 1URQB 3USSA 4EDFA 3RK2D 3JSVC 4JYBA 1QL2A 4Y99C 3MZWB 5KAIE 2N1TA 4PJ0H 2Y0DA 4JYCA 3RL0D 4RKUJ 2D2CD 3A0BH 1N7SB 1R5LA 3M91A 1U7MA 2Q3EA 1EDJA 2FKWB 5AW8B 2NPSA 3L75J 3MIWA 2E5TA 5AVTB 1FZBA 3VTPC 1FBMA 1FJKA 3LW5J 3P7KA 3CCUP 1LWUB 1AV1A 2K3RA 2YKQA 1LTJC 2WPSA 2HFED 3WMM0 3FXEA 4TLFA 5AVYB 1N73A 1T8ZA 1KZUB 3AE4C 1KQLA 5EFWB 3B71A 2W90A 5GTHE 3B4SA 2XV5A 3C1LA 4RESB 1VQMP 3B5NC 2VRSA 5AW6B 2SPZA 3M9BA 1VPCA 4C7NA 4U7JA 5CHXA 3HUSB 2A45H 1RE3C 4B86A 1M1KQ 2Z5HA 1ZP0C 3H1IJ 3WUUA 1SQQG 5CCHC 1FZFA 5TISH 3SWYA 3H1IE 3WU2E 3D6ZA 2KZIA 1LTTC 1BE3D 2A45I 1SQBK 1FS0E 3N7NA 3H1JJ 3KDPB 2FYUK 4L76A 2E75C 3F89A 1LJ2A 3H1JE 2HODB 4JQ0D 1RE4C 4Y28J 2HPCB 5APQA 3L72G 4LLHA 1QVFO 2Q9IA 1HF9A 2JWAA 3L74G 1LTBC 1NU1J 3AEAC 1FDOA 3VP8A 4AUWA 5KAIH 1L4AA 2UWJE 1FE6A 1KB9E 4D6TE 5DJUB 1SQQD 1NOHA 1DD3A 3D6YA 3FXDA 4KT0J 2FXMA 2OYHA 1HH0A 2IPPA 2M8RA 4WVZA 5GTIE 1Q82Q 2MKVA 1URQA 3IFMA 3OJAB 3P8CD 1IK9A 1EDIA 5KJ7C 1L0ND 3LW5H 1MFZA 4H13D 1JB0J 1OZHA 1OMIA 1IFJA 2R5BA 2KUBA 3GHGA 5GTHH 1N7SA 1PP9D 4JF7A 4OGQB 1W5CE 1S9KD 3BRTB 1GDTA 2WSFJ 3IN6A 4C7RA 1NTZK 1KILD 3L70G 2YKPA 3G6EP 1JMMA 1NTKG 2D2CC 1J1EC 4I7ZB 4K3AA 1BGYD 3TGUG 4ZKUA 1H8AA 1EC5A 1OWAA 3WU2H 1SQPE 1Q81Q 4NPFX 2JEEA 2H88C 1PPJE 1SQVK 1Z56A 3GF3A 2YXQB 1FOSE 3V2RA 1NAYA 1M1JC 3V2QA 1S4XA 1JY2O 2LXCB 2K9YA 1T6AA 2WSEJ 1SVFA 1J2JB 3NMDA 1NYHA 3HUSA 4H0LB 3VMZA 3RL0B 1AFOA 1KC8Q 3AE1C 3G9RA 4RO0A 3M9HA 4OWFA 1LT9A 4EOTA 2HG5D 3JCUE 2C9NY 3K5BA 2K9JB 3L70D 3CX5E 1ZR2A 1NTKD 1OVVA 2KOGA 2FFDC 1ZMEC 2ZYAA 1X79B 1OW6A 1RF1B 1KB9H 1AJYA 2HODA 3EWKA 5KLVK 1NVOA 3AEBC 2HPCA 4Z1MH 3U1CA 2W8ZA 3AECC 5GTIH 3S9OA 3H1HG 1KB9I 1KYOE 3MP7B 3CWBG 1UIIA 2QRXA 1A02J 3V6IA 2OYOA 1JUNA 1NO4A 1K9MQ 2FXOA 2NPSC 2E76C 1UIXA 2KXPB 2WPRA 4EI2A 3CXHE 1KORA 2FY8A 3R2PA 2WSFH 5AVXB 4HYTB 1SQQJ 1ZOYC 3HTKB 1CI6B 3B5ND 1PFIA 2C9LY 4PV1B 3H1KG 2KZJA 3GMAA 4BXLA 2JKVA 2E74B 2H89C 1N8RQ 3MD0A 2Q1KA 1JY3N 4HB1A 4D6TG 3VP9A 1FZEA 3AE8C 5CCHD 3L72J 3OW2O 1DIPA 3RGUA 1VDFA 3AEFC 4KJMA 3QWOC 3H1ID 1HWTC 1H88A 3A0HE 3SWKA 2PAJA 3OAKA 1EXJA 3L72E 1LTSC 5KAFE 2KK7A 3L74J 1QX8A 5KTBA 3CLQA 3L74E 2M5AB 1T3JA 2J58A 1JTHB 1KILC 3SSUA 1DX7A 3JCUH 3CC4P 3H6PA 3A2AA 1IFMA 1KMIZ 2E75D 3IF4A 3H1JD 3G4SP 2Z4EA 3CX5H 1AVOA 3IAOA 4N3YB 3M9QA 2MJZA 3Q5SA 1KV4A 2V4HA 4H13B 1NTMK 4HJGH 2R3SA 3CX5I 2P58A 5AVWB 2GM4A 1BDDA 2IZ1A 4WY4A 3RK3C 3RK3E 1KYOH 1KFNA 1KB9D 4D6TD 2RH0A 2ZVNB 2GA1A 1WRGA 1YTZT 3U59A 1WMKA 2L91A 2Q6QA 4I6MC 1YJWP 1IC2A 1SQPG 1JO5A 2JDIH 1RF1A 1VQPP 2W6AA 2NRGA 4IOIH 3L70J 1JY2N 5AVSB 3CXHH 3A7OA 3TK1A
chains in the Genus database with same CATH topology
3HD7B 2A45I 1SQBK 1JOCA 5KJ7D 3V2NA 1SQXK 4EIJA 1XTGB 3N7NA 1OXZA 2W6BA 1SP4A 3KDPB 3GHGC 3L36A 2FYUK 2HYNA 4N78D 1GD2E 3CI9A 4O9BA 1FZAA 3HD7D 3HE5B 2NPSB 3KPEA 2HODB 2C0XA 2KP8A 1MV8A 1RE4C 2HPCB 2OYIC 1J1EB 1RF1C 5APQA 2KYVA 1H89A 1WT6A 5CMZA 5CJ4A 1IJDB 4XE5B 1T2KD 4LGDE 1KFMA 3N4XA 1JNMA 4LLHA 2YNYA 2Q9IA 2XKMA 1IFNA 1FZCB 3O8ZA 1LTBC 3T97A 3LIDA 3VP8A 3TYYA 3VMYA 2KB7P 4AUWA 1SLQA 4GIFA 1QL1A 4WY4B 2WPQA 2XDJA 1EQ7A 5APVA 2Q7CA 3B5NA 5APXA 1L4AA 5AW9B 1AQ5A 1E5WA 3H32A 3BASA 3HTKA 3BATA 2Z5IA 3L37A 1NOHA 1YYCA 1CI6A 3TSIA 2IFMA 5CCGA 1G2CA 2WTYA 2FXMA 3E1IA 1RE3A 2OYHA 1HH0A 1X9VA 2IPPA 2I1KA 2M8RA 5AVRB 1FZGA 1URQA 2GUVA 5CCHA 3IFMA 3OJAB 3P8CD 1IK9A 1GL2A 1G1IA 2P1JA 1GK6A 5KJ7C 3NFQA 2R3CA 3LW5H 1MFZA 2BASA 1L4AC 1LT9C 3EFGA 5BU5A 3VN0A 5APSA 1IFJA 2R5BA 3MUDA 5AW3B 4N78E 3GHGA 1NWQA 1KILB 1N7SA 5AVVB 1HBWA 2E43A 5CCGC 1IO4A 4JF7A 1S9KD 3BRTB 5BU8B 2OYHC 1RE4A 1N2DC 1GDTA 2OYIA 2WWWA 3BRVB 3L35A 1T2KC 1J1DC 1DEBA 1URQC 3L4FA 1M1JA 4C7RA 5APYA 1NTZK 1KILD 2M3BA 1LTJB 2N1TB 2YKPA 4W7YA 3NTNA 1JMMA 1ZR4A 3NXSA 5AVZB 2QM7A 3CL3D 1IFDA 1LTIC 1J1EC 3VYIA 4M3LA 5AVQB 1ZLLA 4IFDK 1HTLC 2P7JA 3C9IA 4ZKUA 2N1TD 1H8AA 1OWAA 2L5GB 1IFIA 3B5NB 3TNUB 1N7SC 3RK3B 5AVUB 3H32B 3HRNA 2YO3A 2JEEA 4N6JA 1SQVK 1NKNA 1Z56A 3B8EB 3V2RA 1FOSE 1G2CB 4HH2A 3P8MC 1FJPA 3U1AA 4DZOA 1M1JC 2E42A 2R32A 2Q5UA 3V2QA 2H43A 1JY2O 1SFCB 4C46A 2KSJA 2NPSD 1N73B 1SVFA 2WITA 1J2JB 3V2PA 3UIAA 3P8CE 3NMDA 1LWUC 3OA7A 3HUSA 3VMZA 1GL2B 3RL0B 5AW5B 1AFOA 4AQRD 4GT1A 1HJBA 3A3YB 5KJ7A 1SFCD 3M9HA 1HUCA 1LT9A 4EOTA 4ZKPA 3KQGA 2HG5D 5AW0B 2C9NY 3P32A 3GHGB 4C7NB 2WSEH 1CZQA 3HD7A 1ZR2A 1DH3A 2GUSA 1S9KE 4WY4D 5APTA 2KOGA 2FFDC 5AW7B 4I2LC 1JY3P 3HE4A 1X79B 4Y99B 1SQPK 1RF1B 1SQQK 3HE5A 3HUSC 3KYQA 2J59M 4AYCA 2HODA 5KLVK 1GW3A 3EQ2A 2HPCA 3U1CA 2P67A 3MGNA 5AW2B 4W7ZA 3M0DC 4LC1A 3HD7C 1CSBA 2P2UA 4WB4A 1JCCA 1LTAC 5CJ0A 2R5DA 2O01H 2O1JA 1L0NK 1NKZB 1A02J 1FDMA 1JUNA 1JTHA 3V5BA 1NO4A 1GW4A 2NPSC 3SWFA 1N86A 2QM8A 3M0AA 2W27A 2WPRA 1RY3A 1NAFA 1LWUA 1GTWA 1L0LK 3VMXA 2Q3IA 3LIEA 1SFCC 2IX7C 3R2PA 2H8PD 2WSFH 2I1JA 2ZFCA 2ZXEB 4HYTB 5AVXB 1FZCC 2H7HA 1L4AB 1LT9B 1XTCC 3HTKB 4XA4A 5AW4B 2KLVA 2FYZA 2WT7A 4WY4C 1CI6B 4KHXA 3RK2B 1GZLA 2YMYA 2FFDA 3B5ND 1L4AD 3HE4B 3G3ZA 1PFIA 2C0WA 3RK3D 2C9LY 2OYHB 3VOPA 2WSCH 1FAVA 2YO2A 3BVHA 1KILA 1J1DB 1NH4A 1JY2P 1URQB 1ZN5A 3RK2D 5CCGD 1GU4A 4JYBA 3I5CA 3MD0A 2XZRA 2N9BA 5BVZA 1MUUA 1JY3N 2HLOA 1QL2A 4Y99C 2POHA 1RF0C 3VP9A 1FZEA 1LTJA 2N1TA 3PP5A 1URQD 3V4WA 5CCHD 1VDFA 3M0DA 2JJLA 1HWTC 4OH8B 4JYCA 4GKGA 1H88A 1M7LA 1NHLA 2PAJA 3OAKA 1FU1A 1GL2D 3RL0D 1A02F 1LTSC 1MZ9A 1N7SB 5KTBA 2PP6A 4I1LA 3CLQA 2CPSA 2XNXA 2IFNA 3M91A 1T3JA 2J58A 2FKWB 2OYIB 3TNUA 1JCDA 1JTHB 1KILC 1DX7A 5AW8B 1M1JB 3H6PA 1N7LA 3A2AA 1IFMA 1N7SD 2NPSA 1HGVA 3M06A 2Z4EA 1GK4A 3MIWA 1NTKK 1JY3O 5AVTB 1FZBA 3VTPC 1FBMA 1FJKA 2YKOA 4N3YB 1GU5A 3P7KA 1LWUB 2YKQA 5APUA 1LTJC 2N1TC 2WPSA 3M9QA 3A5TA 2MJZA 2HFED 1SFCA 3WMM0 1FOSF 5AW1B 1NTMK 5AVYB 1N73A 1T8ZA 1KZUB 2CPBA 2WZ7A 1FZCA 1KQLA 4IFMA 2XU6A 2A45G 2OARA 5AVWB 2GM4A 4W80A 2WT7B 2XV5A 4RESB 4WY4A 4DOJA 1X8YA 3B5NC 2VRSA 3IR9A 2FFDB 3RK3C 3MTUE 5AW6B 1ZV8A 2LKMA 3M9BA 1VPCA 4IFFA 1KFNA 4WBAA 5APWA 4C7NA 2O1KA 1HVVA 1HGZA 3V4QA 3RK2C 1LTGC 5CHXA 1WRGA 1CW5A 1YTZT 3U59A 3HUSB 1NU1K 1G1JA 2A45H 1RE3C 1W2EA 4I6MC 4B86A 1T3UA 1IC2A 2Z5HA 3II6A 1N73C 1JO5A 1RF1A 2W6AA 5CCHC 1FZFA 1RF0A 3SWYA 1LGHB 1JY2N 1GL2C 5AVSB 3RL0C 3A7OA 3TK1A 1YTZI 1LTTC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JYB A;  2R5B A;  3I5C A;  3MD0 A;  2XZR A;  5AW3 B;  2N9B A;  1MUU A;  1NWQ A;  5AVV B;  1HBW A;  2E43 A;  1IO4 A;  3HE5 A;  1S9K D;  3V4W A;  4AYC A;  1OXZ A;  3M0D A;  2JJL A;  1HWT C;  1SP4 A;  4JYC A;  4GKG A;  1H88 A;  3KDP B;  3OAK A;  1A02 F;  3L36 A;  2WWW A;  3L35 A;  1T2K C;  2P67 A;  1GD2 E;  3MGN A;  5AW2 B;  5APY A;  3HE5 B;  3NTN A;  3M91 A;  2KP8 A;  1MV8 A;  3NXS A;  5AVZ B;  2QM7 A;  4LC1 A;  3TNU A;  1CSB A;  2P2U A;  5AW8 B;  5APQ A;  3VYI A;  2R5D A;  4M3L A;  5AVQ B;  1H89 A;  5CMZ A;  3A2A A;  2P7J A;  4XE5 B;  1T2K D;  1JNM A;  3M06 A;  1GK4 A;  2YNY A;  1H8A A;  1A02 J;  1OWA A;  5AVT B;  3TNU B;  3VTP C;  3O8Z A;  1GU5 A;  1JUN A;  3P7K A;  3T97 A;  3V5B A;  5AVU B;  3LID A;  2YO3 A;  5APU A;  3TYY A;  2WPS A;  3SWF A;  3VMY A;  3A5T A;  4AUW A;  1SLQ A;  2QM8 A;  3M0A A;  5AW1 B;  2W27 A;  1FOS F;  2WPR A;  5AVY B;  1NAF A;  2WPQ A;  3B8E B;  5APV A;  2Q7C A;  1FOS E;  1G2C B;  5APX A;  3P8M C;  5AW9 B;  1KQL A;  4DZO A;  2E42 A;  2XU6 A;  2R32 A;  1GTW A;  3VMX A;  2Q3I A;  2Q5U A;  5AVW B;  3HTK A;  3LIE A;  4C46 A;  2WT7 B;  2XV5 A;  3L37 A;  2Z5I A;  4RES B;  1YYC A;  1CI6 A;  1J2J B;  2ZFC A;  1X8Y A;  2ZXE B;  4HYT B;  5AVX B;  3UIA A;  2H7H A;  2VRS A;  3NMD A;  3IR9 A;  2WTY A;  3VMZ A;  5AW6 B;  3M9B A;  5AW5 B;  5AW4 B;  5APW A;  2IPP A;  4GT1 A;  4AQR D;  2WT7 A;  4C7N A;  1HJB A;  3A3Y B;  1CI6 B;  3V4Q A;  4KHX A;  5AVR B;  1GZL A;  3M9H A;  1HUC A;  4EOT A;  3KQG A;  3HE4 B;  5AW0 B;  4I6M C;  4B86 A;  2C9L Y;  2C9N Y;  3P32 A;  1FAV A;  1GK6 A;  2YO2 A;  4C7N B;  1CZQ A;  2Z5H A;  3NFQ A;  1DH3 A;  2R3C A;  2W6A A;  1MFZ A;  1S9K E;  2BAS A;  5APT A;  3VN0 A;  5APS A;  5AVS B;  5AW7 B;  4I2L C;  3A7O A;  1GU4 A;  3TK1 A;  3HE4 A; 
#chains in the Genus database with same CATH topology
 2AEJ A;  3L70 E;  3HD7 B;  2G3A A;  1JOC A;  5KJ7 D;  3V2N A;  4WWI A;  3CCV P;  1OXZ A;  3TGU J;  3GHG C;  3TGU E;  2HYN A;  1GD2 E;  3CXH I;  3HE5 B;  3KPE A;  3KXD A;  2C0X A;  2FBW C;  2KP8 A;  3CCE P;  3AE9 C;  4L74 A;  5CMZ A;  1IJD B;  1Q90 D;  4LGD E;  2XKM A;  1IFN A;  1AQT A;  4ZNC A;  1FZC B;  2RKL A;  1YBK A;  1DD4 A;  3T97 A;  1S72 P;  4K35 A;  3VMY A;  5KKZ B;  2KB7 P;  1NJI Q;  4GIF A;  1QL1 A;  3CME P;  1D7M A;  1NTZ J;  2Q7C A;  5APX A;  1E5W A;  1OW7 A;  3A0H H;  1SQP D;  1NTZ E;  5KAF H;  3BAS A;  3HTK A;  3BAT A;  2Z5I A;  3L37 A;  1PPJ D;  1CI6 A;  3CCM P;  5CCG A;  5B5E E;  1G2C A;  3CC2 P;  2WTY A;  2BEZ F;  3CC7 P;  4PD4 E;  3D70 A;  1KQF B;  1X9V A;  2N9Y B;  2I1K A;  2KIK A;  2YXR B;  3EFF K;  3PJS K;  2XND H;  1GL2 A;  3F5H A;  3PTZ A;  3Q3D A;  2KS1 A;  2P1J A;  1ZW0 A;  1LT9 C;  1Y9B A;  4U3F E;  3H1H J;  3MUD A;  5AW3 B;  5AVV B;  3H1H E;  3CWB J;  3CX5 D;  4NPD A;  1IO4 A;  3CWB E;  1QEX A;  3W67 A;  1PGQ A;  2ZVO B;  1Y47 A;  2WWW A;  2ZT9 C;  3L35 A;  1T2K C;  1J1D C;  2G8Y A;  1DEB A;  3L4F A;  1LTJ B;  1OIP A;  1ZR4 A;  2QM7 A;  1IFD A;  2M0B A;  4M3L A;  3CD6 P;  2P7J A;  2B89 A;  2A06 E;  2N1T D;  1VQK P;  2B87 B;  3H1L G;  3B5N B;  1KYO D;  3H32 B;  2QJK C;  3HRN A;  2YO3 A;  3BCC J;  2BEQ D;  4UB8 E;  1NKN A;  4H44 C;  5KLV E;  3BCC E;  4DZO A;  1SFC B;  3H1K J;  2NPS D;  2E76 D;  4GDO A;  1U57 A;  3H1K E;  3CXH D;  3OA7 A;  5AW5 B;  3RBX A;  4GT1 A;  4AQR D;  4DCK A;  4D6T J;  3KQG A;  1M90 Q;  5AW0 B;  4IL6 E;  2PGD A;  2AEM A;  1MFT A;  1CZQ A;  1Q86 Q;  1SQB G;  2E75 B;  3HD7 A;  1DH3 A;  1JY3 P;  3E7K A;  2FYU G;  1EZV G;  4OGQ C;  3HE5 A;  1YIT P;  3KYQ A;  1BSH A;  1IZN B;  2BCC G;  3AEE C;  5B5E H;  3EQ2 A;  4PD4 H;  3MGN A;  2OQQ A;  1X22 A;  3SFD C;  2DW3 A;  2I8D A;  1CSB A;  2P2U A;  5CJ0 A;  3L72 D;  3C8V A;  4XFJ A;  5CBO A;  1BDC A;  2WPV B;  4PD4 I;  3L74 D;  5KLI C;  1KTM A;  1P84 E;  3V5B A;  1JMB A;  1GW4 A;  1N86 A;  2QM8 A;  4GOF A;  2JR8 A;  2YIU C;  1YQ4 C;  3S4R A;  3AE7 C;  3RBZ A;  4CPG A;  1VF5 C;  1LWU A;  2QSI A;  1L0L K;  2IZ0 A;  1GTW A;  2K88 A;  3LIE A;  3L73 E;  1SQP J;  2JO1 A;  3H25 A;  1YI2 P;  2FYU D;  2KLV A;  3O6Q B;  2FYZ A;  4A7P A;  4WY4 C;  5H2F E;  2K1A A;  4KHX A;  3CCJ P;  2JP3 A;  3RK2 B;  2QEX P;  1H0T B;  1QLE D;  2YMY A;  1OFC X;  2IBZ E;  1L4A D;  3HE4 B;  5L8R J;  3G3Z A;  2C0W A;  3VMA A;  3RK3 D;  1FAV A;  1NTM E;  1NH4 A;  1JY2 P;  2JWD A;  4UB8 H;  3PLN A;  2ZYD A;  4ASV A;  1GU4 A;  2D2C B;  1GMJ A;  2XZR A;  1MUU A;  2HLO A;  2POH A;  4QMA A;  1NTZ G;  1LTJ A;  3PP5 A;  1URQ D;  3V4W A;  3JC2 2;  1M57 D;  4GKG A;  1NHL A;  1A02 F;  1FU1 A;  2CK3 H;  1EDL A;  4UB6 E;  1RHZ B;  2PP6 A;  2B87 A;  2OYI B;  3RL0 g;  4IL6 H;  1M1J B;  4TT3 H;  1N7L A;  3TGU D;  1N7S D;  1SQV G;  1DEE G;  2FXP A;  2YKO A;  4U3F G;  5APU A;  2N1T C;  3A5T A;  1SFC A;  2WZ7 A;  5M1B A;  1Q2N A;  4IFM A;  2KLU A;  2PFX A;  2OAR A;  4W80 A;  1AVY A;  2WT7 B;  4L75 A;  2QJP C;  1X8Y A;  2FFD B;  3MTU E;  2LKM A;  1VQ6 P;  1NTZ D;  1BSN A;  4IFF A;  5APW A;  2O1K A;  1HVV A;  1HGZ A;  3V4Q A;  1PGJ A;  2A06 G;  1CW5 A;  1NU1 K;  2LXB A;  1G1J A;  1P84 H;  1W2E A;  4PD4 D;  3II6 A;  1N73 C;  2E74 C;  1RF0 A;  1LGH B;  4MN4 C;  2KNC B;  1GL2 C;  5KLV G;  3BCC G;  5E79 E;  1P84 I;  1PGP A;  1SQX K;  2W6B A;  4U3F D;  4BWN A;  3H1L J;  3L36 A;  3CI9 A;  2QJY C;  1FZA A;  3FWL A;  3H1L E;  4O9B A;  2NPS B;  2E76 B;  3H1H D;  5H2F H;  1MV8 A;  2ZYG A;  3CWB D;  1PL5 A;  3FWN A;  1H89 A;  5CJ4 A;  2ZT9 D;  1T2K D;  1KFM A;  3N4X A;  2YNY A;  1SS1 A;  4PJ0 E;  3O8Z A;  1M56 D;  3TYY A;  1L2P A;  1SLQ A;  2A06 D;  2WPQ A;  1EQ7 A;  5AW9 B;  3AE2 C;  1EXI A;  2IYP A;  4UB6 H;  3AE3 C;  1SQB J;  3S1K A;  5KLV D;  3TSI A;  4H44 D;  3BCC D;  1LT1 A;  2Y0C A;  1OVR A;  1SQB E;  2B9B A;  3E1I A;  5TJH A;  2FYU J;  1FZG A;  2FYU E;  2GUV A;  2O01 J;  3H1K D;  2OGU A;  3PRJ A;  1EZV E;  2FYN C;  2BCC J;  1G1I A;  3NFQ A;  2BCC E;  3CPW O;  3L71 J;  2BAS A;  1L4A C;  3AED C;  3EFG A;  1RQV A;  1LNQ A;  3L71 E;  3Q5R A;  4N78 E;  2K9J A;  2ZAE B;  1KIL B;  1Y8A A;  3L73 G;  2OYH C;  2OYI A;  3BRV B;  1URQ C;  1M1J A;  5APY A;  1KYO I;  4W7Y A;  3NTN A;  1YJN P;  2Y9Z A;  3NXS A;  4OGQ D;  1IK7 A;  3CL3 D;  1LTI C;  3ZDM A;  3I55 P;  2IBZ G;  5AVQ B;  1NTM G;  1VQL P;  1S1C X;  1K8A Q;  2L5G B;  3WUT A;  3TNU B;  1N7S C;  1RQU A;  3RK3 B;  5E79 H;  3B8E B;  4HH2 A;  1P84 D;  3U1A A;  2E42 A;  2R32 A;  3PH0 A;  2H43 A;  4C46 A;  2KSJ A;  4DJG A;  3V2P A;  3UIA A;  1LWU C;  4BRY B;  1M8O B;  1VF5 D;  1HJB A;  3A3Y B;  3L73 D;  1KN7 A;  1VQN P;  1HUC A;  4ZKP A;  2AXC A;  2KNC A;  1YHQ P;  4H0L D;  3GHG B;  4ASW A;  1L0L J;  3QH9 A;  4WY4 D;  5APT A;  1L0L E;  4I2L C;  5AW7 B;  2IBZ D;  4Y99 B;  1NTM D;  1LP1 B;  1BE3 G;  1SQQ K;  1SQV J;  3HUS C;  4AYC A;  1BCC G;  1SQV E;  1GW3 A;  3L75 E;  4U3F J;  2P67 A;  5AW2 B;  4W7Z A;  1YIJ P;  4LC1 A;  4WB4 A;  1JCC A;  1LTA C;  2O01 H;  2O1J A;  1L0N K;  1NKZ B;  2M5A A;  1FDM A;  1JTH A;  2WMM A;  1KQG B;  1KQS O;  3M0A A;  1EZV I;  1R5S A;  1YQ3 C;  1NAF A;  1AA0 A;  1KD1 Q;  3VMX A;  2Q3I A;  1SFC C;  2IX7 C;  2J5U A;  5CBN A;  3CCR P;  3ABV C;  2H8P D;  3MHV A;  2I1J A;  3FX0 A;  1LT9 B;  2RN0 A;  4JBZ A;  3Q2Y A;  5KLV J;  4XA4 A;  2LR2 A;  4YXW H;  3I56 P;  1BCC D;  3KZI E;  2Y0E A;  2ZT9 B;  1KIL A;  3D71 A;  1J1D B;  1ZN5 A;  4YTP C;  1L0N G;  2AXT E;  5CCG D;  1VQ5 P;  1ZXG A;  3I5C A;  2QA4 P;  2N9B A;  5BVZ A;  4PV1 D;  1HJ0 A;  1RF0 C;  3ITK A;  4OVN F;  1OVU A;  3KHU A;  1PP9 G;  1U7J A;  2E74 D;  2P10 A;  3M0D A;  2JJL A;  4OH8 B;  1M7L A;  1GL2 D;  2M3E A;  1JM0 A;  1MZ9 A;  2QJK B;  1PIX A;  4I1L A;  2CPS A;  2XNX A;  1NU1 E;  2IFN A;  4H44 B;  3SFE C;  3TNU A;  1JCD A;  4RJT A;  1E79 H;  1MKM A;  1HGV A;  3H1L D;  3M06 A;  1GK4 A;  2QVA A;  1BGY G;  1NTK K;  1JY3 O;  1SQX J;  1GU5 A;  3L71 G;  1SQX E;  1FOS F;  5AW1 B;  1ZRT E;  1R8E A;  3GW6 A;  4YXD C;  2O3J A;  2CPB A;  1FZC A;  4I7Z C;  5K5G B;  2XU6 A;  4BRY A;  2A45 G;  5C39 A;  4DOJ A;  5B66 E;  3IR9 A;  1YJ9 P;  1ZV8 A;  4DT0 A;  4WBA A;  3RK2 C;  1LTG C;  1Q7Y Q;  3L73 J;  1FC2 C;  1SQB D;  1T3U A;  3G71 P;  1LP1 A;  3W68 A;  4H0L C;  3RL0 C;  3AE5 C;  1YTZ I;  1EZV D;  2BCC D;  4EIJ A;  1XTG B;  1NTM J;  1SP4 A;  5KLI B;  3L71 D;  4N78 D;  4HKZ H;  4L73 A;  3HD7 D;  1VQ4 P;  3CCS P;  2YIU B;  4EYY Q;  2OYI C;  1J1E B;  4R4L A;  3KZI H;  1RF1 C;  2ZJS E;  2KYV A;  1VF5 B;  1WT6 A;  2AEF A;  4XE5 B;  1JNM A;  2KI7 B;  3GLM A;  1FDI A;  2AXT H;  3PHL A;  1L0L G;  5DJT B;  3LID A;  2QE7 H;  4WY4 B;  2XDJ A;  1K05 A;  5APV A;  4ZMD A;  3B5N A;  1AQ5 A;  2V7Q J;  1PGO A;  1S2E A;  1S5L E;  3H32 A;  3GG2 A;  3L75 G;  1YYC A;  2IFM A;  1IFP A;  1RE3 A;  3E1R A;  1QVG O;  5AVR B;  5CCH A;  1BE3 J;  3WUV A;  1BCC J;  1BE3 E;  1GK6 A;  2E5Y A;  4GOD A;  1PZQ A;  2YMK A;  1BCC E;  2R3C A;  5BU5 A;  3VN0 A;  5APS A;  2R44 A;  2WQY C;  1NWQ A;  1EDK A;  1HBW A;  2E43 A;  5CCG C;  5B66 H;  5BU8 B;  4PV1 C;  1L0L D;  1RE4 A;  1N2D C;  3H1I G;  3R4Y A;  1QGK B;  2WVR A;  2M3B A;  2N1T B;  5AVZ B;  1S3J A;  3T97 B;  4IL6 X;  1SQV D;  3VYI A;  3AEG C;  1ZLL A;  3L75 D;  1HTL C;  3C9I A;  4IFD K;  4YPC A;  2WSC J;  2QJP B;  3H1J G;  3MUD C;  1IFI A;  2IYO A;  2WSS H;  5AVU B;  1SQQ E;  1VL2 A;  4N6J A;  1G2C B;  1FJP A;  3P8M C;  2QIW A;  2Q5U A;  4NPE A;  2W6J H;  1N73 B;  2WIT A;  2W83 C;  1NGM B;  1PV3 A;  3P8C E;  2QG4 A;  1NU1 G;  3Q5P A;  4GOE A;  1VQ7 P;  3AE6 C;  1L0N J;  3A0B E;  1GL2 B;  2KS1 B;  4JPZ B;  1L0N E;  2IBZ I;  4H13 C;  5KJ7 A;  1SFC D;  2ITA A;  1K04 A;  1OX3 A;  2OTK E;  3GF7 A;  1PP9 J;  2OTL P;  3P32 A;  1K73 Q;  4C7N B;  3O6Q A;  2WSE H;  1PP9 E;  2GUS A;  1SQX G;  1S9K E;  2QJY B;  3TDK A;  1H0T A;  3HE4 A;  1OW8 A;  1S5L H;  1SQP K;  1KIL E;  2V7Q H;  2J59 M;  2ZXX A;  1BGY J;  1W2B O;  2KSE A;  1BGY E;  3M0D C;  2Y9Y A;  2HR3 A;  3HD7 C;  1VQ8 P;  2O01 N;  2R5D A;  1USD A;  2IDB A;  1NU1 D;  1X0T A;  1USE A;  3SWF A;  1TU3 F;  5TIS E;  3Q1M A;  2W27 A;  1RY3 A;  2FYN B;  1JEK A;  1SQX D;  2ZFC A;  2ZXE B;  1ZRT D;  1FZC C;  2H7H A;  1L4A B;  1PPJ G;  1XTC C;  1VQ9 P;  1NTK J;  2PRR A;  5KKZ C;  5AW4 B;  1S5L X;  3CMA P;  2WT7 A;  1NTK E;  1GZL A;  1VQO P;  3FGA D;  2FFD A;  2B88 A;  1RH5 B;  3CCQ P;  2OTJ P;  2NZ2 A;  3TF5 A;  2OYH B;  3VOP A;  2WSC H;  2RMZ A;  3CCL P;  2YO2 A;  2K37 A;  3BVH A;  4R4M A;  1URQ B;  3USS A;  4EDF A;  3RK2 D;  3JSV C;  4JYB A;  1QL2 A;  4Y99 C;  3MZW B;  5KAI E;  2N1T A;  4PJ0 H;  2Y0D A;  4JYC A;  3RL0 D;  4RKU J;  2D2C D;  3A0B H;  1N7S B;  1R5L A;  3M91 A;  1U7M A;  2Q3E A;  1EDJ A;  2FKW B;  5AW8 B;  2NPS A;  3L75 J;  3MIW A;  2E5T A;  5AVT B;  1FZB A;  3VTP C;  1FBM A;  1FJK A;  3LW5 J;  3P7K A;  3CCU P;  1LWU B;  1AV1 A;  2K3R A;  2YKQ A;  1LTJ C;  2WPS A;  2HFE D;  3WMM 0;  3FXE A;  4TLF A;  5AVY B;  1N73 A;  1T8Z A;  1KZU B;  3AE4 C;  1KQL A;  5EFW B;  3B71 A;  2W90 A;  5GTH E;  3B4S A;  2XV5 A;  3C1L A;  4RES B;  1VQM P;  3B5N C;  2VRS A;  5AW6 B;  2SPZ A;  3M9B A;  1VPC A;  4C7N A;  4U7J A;  5CHX A;  3HUS B;  2A45 H;  1RE3 C;  4B86 A;  1M1K Q;  2Z5H A;  1ZP0 C;  3H1I J;  3WUU A;  1SQQ G;  5CCH C;  1FZF A;  5TIS H;  3SWY A;  3H1I E;  3WU2 E;  3D6Z A;  2KZI A;  1LTT C;  1BE3 D;  2A45 I;  1SQB K;  1FS0 E;  3N7N A;  3H1J J;  3KDP B;  2FYU K;  4L76 A;  2E75 C;  3F89 A;  1LJ2 A;  3H1J E;  2HOD B;  4JQ0 D;  1RE4 C;  4Y28 J;  2HPC B;  5APQ A;  3L72 G;  4LLH A;  1QVF O;  2Q9I A;  1HF9 A;  2JWA A;  3L74 G;  1LTB C;  1NU1 J;  3AEA C;  1FDO A;  3VP8 A;  4AUW A;  5KAI H;  1L4A A;  2UWJ E;  1FE6 A;  1KB9 E;  4D6T E;  5DJU B;  1SQQ D;  1NOH A;  1DD3 A;  3D6Y A;  3FXD A;  4KT0 J;  2FXM A;  2OYH A;  1HH0 A;  2IPP A;  2M8R A;  4WVZ A;  5GTI E;  1Q82 Q;  2MKV A;  1URQ A;  3IFM A;  3OJA B;  3P8C D;  1IK9 A;  1EDI A;  5KJ7 C;  1L0N D;  3LW5 H;  1MFZ A;  4H13 D;  1JB0 J;  1OZH A;  1OMI A;  1IFJ A;  2R5B A;  2KUB A;  3GHG A;  5GTH H;  1N7S A;  1PP9 D;  4JF7 A;  4OGQ B;  1W5C E;  1S9K D;  3BRT B;  1GDT A;  2WSF J;  3IN6 A;  4C7R A;  1NTZ K;  1KIL D;  3L70 G;  2YKP A;  3G6E P;  1JMM A;  1NTK G;  2D2C C;  1J1E C;  4I7Z B;  4K3A A;  1BGY D;  3TGU G;  4ZKU A;  1H8A A;  1EC5 A;  1OWA A;  3WU2 H;  1SQP E;  1Q81 Q;  4NPF X;  2JEE A;  2H88 C;  1PPJ E;  1SQV K;  1Z56 A;  3GF3 A;  2YXQ B;  1FOS E;  3V2R A;  1NAY A;  1M1J C;  3V2Q A;  1S4X A;  1JY2 O;  2LXC B;  2K9Y A;  1T6A A;  2WSE J;  1SVF A;  1J2J B;  3NMD A;  1NYH A;  3HUS A;  4H0L B;  3VMZ A;  3RL0 B;  1AFO A;  1KC8 Q;  3AE1 C;  3G9R A;  4RO0 A;  3M9H A;  4OWF A;  1LT9 A;  4EOT A;  2HG5 D;  3JCU E;  2C9N Y;  3K5B A;  2K9J B;  3L70 D;  3CX5 E;  1ZR2 A;  1NTK D;  1OVV A;  2KOG A;  2FFD C;  1ZME C;  2ZYA A;  1X79 B;  1OW6 A;  1RF1 B;  1KB9 H;  1AJY A;  2HOD A;  3EWK A;  5KLV K;  1NVO A;  3AEB C;  2HPC A;  4Z1M H;  3U1C A;  2W8Z A;  3AEC C;  5GTI H;  3S9O A;  3H1H G;  1KB9 I;  1KYO E;  3MP7 B;  3CWB G;  1UII A;  2QRX A;  1A02 J;  3V6I A;  2OYO A;  1JUN A;  1NO4 A;  1K9M Q;  2FXO A;  2NPS C;  2E76 C;  1UIX A;  2KXP B;  2WPR A;  4EI2 A;  3CXH E;  1KOR A;  2FY8 A;  3R2P A;  2WSF H;  5AVX B;  4HYT B;  1SQQ J;  1ZOY C;  3HTK B;  1CI6 B;  3B5N D;  1PFI A;  2C9L Y;  4PV1 B;  3H1K G;  2KZJ A;  3GMA A;  4BXL A;  2JKV A;  2E74 B;  2H89 C;  1N8R Q;  3MD0 A;  2Q1K A;  1JY3 N;  4HB1 A;  4D6T G;  3VP9 A;  1FZE A;  3AE8 C;  5CCH D;  3L72 J;  3OW2 O;  1DIP A;  3RGU A;  1VDF A;  3AEF C;  4KJM A;  3QWO C;  3H1I D;  1HWT C;  1H88 A;  3A0H E;  3SWK A;  2PAJ A;  3OAK A;  1EXJ A;  3L72 E;  1LTS C;  5KAF E;  2KK7 A;  3L74 J;  1QX8 A;  5KTB A;  3CLQ A;  3L74 E;  2M5A B;  1T3J A;  2J58 A;  1JTH B;  1KIL C;  3SSU A;  1DX7 A;  3JCU H;  3CC4 P;  3H6P A;  3A2A A;  1IFM A;  1KMI Z;  2E75 D;  3IF4 A;  3H1J D;  3G4S P;  2Z4E A;  3CX5 H;  1AVO A;  3IAO A;  4N3Y B;  3M9Q A;  2MJZ A;  3Q5S A;  1KV4 A;  2V4H A;  4H13 B;  1NTM K;  4HJG H;  2R3S A;  3CX5 I;  2P58 A;  5AVW B;  2GM4 A;  1BDD A;  2IZ1 A;  4WY4 A;  3RK3 C;  3RK3 E;  1KYO H;  1KFN A;  1KB9 D;  4D6T D;  2RH0 A;  2ZVN B;  2GA1 A;  1WRG A;  1YTZ T;  3U59 A;  1WMK A;  2L91 A;  2Q6Q A;  4I6M C;  1YJW P;  1IC2 A;  1SQP G;  1JO5 A;  2JDI H;  1RF1 A;  1VQP P;  2W6A A;  2NRG A;  4IOI H;  3L70 J;  1JY2 N;  5AVS B;  3CXH H;  3A7O A;  3TK1 A; 
#chains in the Genus database with same CATH homology
 3HD7 B;  2A45 I;  1SQB K;  1JOC A;  5KJ7 D;  3V2N A;  1SQX K;  4EIJ A;  1XTG B;  3N7N A;  1OXZ A;  2W6B A;  1SP4 A;  3KDP B;  3GHG C;  3L36 A;  2FYU K;  2HYN A;  4N78 D;  1GD2 E;  3CI9 A;  4O9B A;  1FZA A;  3HD7 D;  3HE5 B;  2NPS B;  3KPE A;  2HOD B;  2C0X A;  2KP8 A;  1MV8 A;  1RE4 C;  2HPC B;  2OYI C;  1J1E B;  1RF1 C;  5APQ A;  2KYV A;  1H89 A;  1WT6 A;  5CMZ A;  5CJ4 A;  1IJD B;  4XE5 B;  1T2K D;  4LGD E;  1KFM A;  3N4X A;  1JNM A;  4LLH A;  2YNY A;  2Q9I A;  2XKM A;  1IFN A;  1FZC B;  3O8Z A;  1LTB C;  3T97 A;  3LID A;  3VP8 A;  3TYY A;  3VMY A;  2KB7 P;  4AUW A;  1SLQ A;  4GIF A;  1QL1 A;  4WY4 B;  2WPQ A;  2XDJ A;  1EQ7 A;  5APV A;  2Q7C A;  3B5N A;  5APX A;  1L4A A;  5AW9 B;  1AQ5 A;  1E5W A;  3H32 A;  3BAS A;  3HTK A;  3BAT A;  2Z5I A;  3L37 A;  1NOH A;  1YYC A;  1CI6 A;  3TSI A;  2IFM A;  5CCG A;  1G2C A;  2WTY A;  2FXM A;  3E1I A;  1RE3 A;  2OYH A;  1HH0 A;  1X9V A;  2IPP A;  2I1K A;  2M8R A;  5AVR B;  1FZG A;  1URQ A;  2GUV A;  5CCH A;  3IFM A;  3OJA B;  3P8C D;  1IK9 A;  1GL2 A;  1G1I A;  2P1J A;  1GK6 A;  5KJ7 C;  3NFQ A;  2R3C A;  3LW5 H;  1MFZ A;  2BAS A;  1L4A C;  1LT9 C;  3EFG A;  5BU5 A;  3VN0 A;  5APS A;  1IFJ A;  2R5B A;  3MUD A;  5AW3 B;  4N78 E;  3GHG A;  1NWQ A;  1KIL B;  1N7S A;  5AVV B;  1HBW A;  2E43 A;  5CCG C;  1IO4 A;  4JF7 A;  1S9K D;  3BRT B;  5BU8 B;  2OYH C;  1RE4 A;  1N2D C;  1GDT A;  2OYI A;  2WWW A;  3BRV B;  3L35 A;  1T2K C;  1J1D C;  1DEB A;  1URQ C;  3L4F A;  1M1J A;  4C7R A;  5APY A;  1NTZ K;  1KIL D;  2M3B A;  1LTJ B;  2N1T B;  2YKP A;  4W7Y A;  3NTN A;  1JMM A;  1ZR4 A;  3NXS A;  5AVZ B;  2QM7 A;  3CL3 D;  1IFD A;  1LTI C;  1J1E C;  3VYI A;  4M3L A;  5AVQ B;  1ZLL A;  4IFD K;  1HTL C;  2P7J A;  3C9I A;  4ZKU A;  2N1T D;  1H8A A;  1OWA A;  2L5G B;  1IFI A;  3B5N B;  3TNU B;  1N7S C;  3RK3 B;  5AVU B;  3H32 B;  3HRN A;  2YO3 A;  2JEE A;  4N6J A;  1SQV K;  1NKN A;  1Z56 A;  3B8E B;  3V2R A;  1FOS E;  1G2C B;  4HH2 A;  3P8M C;  1FJP A;  3U1A A;  4DZO A;  1M1J C;  2E42 A;  2R32 A;  2Q5U A;  3V2Q A;  2H43 A;  1JY2 O;  1SFC B;  4C46 A;  2KSJ A;  2NPS D;  1N73 B;  1SVF A;  2WIT A;  1J2J B;  3V2P A;  3UIA A;  3P8C E;  3NMD A;  1LWU C;  3OA7 A;  3HUS A;  3VMZ A;  1GL2 B;  3RL0 B;  5AW5 B;  1AFO A;  4AQR D;  4GT1 A;  1HJB A;  3A3Y B;  5KJ7 A;  1SFC D;  3M9H A;  1HUC A;  1LT9 A;  4EOT A;  4ZKP A;  3KQG A;  2HG5 D;  5AW0 B;  2C9N Y;  3P32 A;  3GHG B;  4C7N B;  2WSE H;  1CZQ A;  3HD7 A;  1ZR2 A;  1DH3 A;  2GUS A;  1S9K E;  4WY4 D;  5APT A;  2KOG A;  2FFD C;  5AW7 B;  4I2L C;  1JY3 P;  3HE4 A;  1X79 B;  4Y99 B;  1SQP K;  1RF1 B;  1SQQ K;  3HE5 A;  3HUS C;  3KYQ A;  2J59 M;  4AYC A;  2HOD A;  5KLV K;  1GW3 A;  3EQ2 A;  2HPC A;  3U1C A;  2P67 A;  3MGN A;  5AW2 B;  4W7Z A;  3M0D C;  4LC1 A;  3HD7 C;  1CSB A;  2P2U A;  4WB4 A;  1JCC A;  1LTA C;  5CJ0 A;  2R5D A;  2O01 H;  2O1J A;  1L0N K;  1NKZ B;  1A02 J;  1FDM A;  1JUN A;  1JTH A;  3V5B A;  1NO4 A;  1GW4 A;  2NPS C;  3SWF A;  1N86 A;  2QM8 A;  3M0A A;  2W27 A;  2WPR A;  1RY3 A;  1NAF A;  1LWU A;  1GTW A;  1L0L K;  3VMX A;  2Q3I A;  3LIE A;  1SFC C;  2IX7 C;  3R2P A;  2H8P D;  2WSF H;  2I1J A;  2ZFC A;  2ZXE B;  4HYT B;  5AVX B;  1FZC C;  2H7H A;  1L4A B;  1LT9 B;  1XTC C;  3HTK B;  4XA4 A;  5AW4 B;  2KLV A;  2FYZ A;  2WT7 A;  4WY4 C;  1CI6 B;  4KHX A;  3RK2 B;  1GZL A;  2YMY A;  2FFD A;  3B5N D;  1L4A D;  3HE4 B;  3G3Z A;  1PFI A;  2C0W A;  3RK3 D;  2C9L Y;  2OYH B;  3VOP A;  2WSC H;  1FAV A;  2YO2 A;  3BVH A;  1KIL A;  1J1D B;  1NH4 A;  1JY2 P;  1URQ B;  1ZN5 A;  3RK2 D;  5CCG D;  1GU4 A;  4JYB A;  3I5C A;  3MD0 A;  2XZR A;  2N9B A;  5BVZ A;  1MUU A;  1JY3 N;  2HLO A;  1QL2 A;  4Y99 C;  2POH A;  1RF0 C;  3VP9 A;  1FZE A;  1LTJ A;  2N1T A;  3PP5 A;  1URQ D;  3V4W A;  5CCH D;  1VDF A;  3M0D A;  2JJL A;  1HWT C;  4OH8 B;  4JYC A;  4GKG A;  1H88 A;  1M7L A;  1NHL A;  2PAJ A;  3OAK A;  1FU1 A;  1GL2 D;  3RL0 D;  1A02 F;  1LTS C;  1MZ9 A;  1N7S B;  5KTB A;  2PP6 A;  4I1L A;  3CLQ A;  2CPS A;  2XNX A;  2IFN A;  3M91 A;  1T3J A;  2J58 A;  2FKW B;  2OYI B;  3TNU A;  1JCD A;  1JTH B;  1KIL C;  1DX7 A;  5AW8 B;  1M1J B;  3H6P A;  1N7L A;  3A2A A;  1IFM A;  1N7S D;  2NPS A;  1HGV A;  3M06 A;  2Z4E A;  1GK4 A;  3MIW A;  1NTK K;  1JY3 O;  5AVT B;  1FZB A;  3VTP C;  1FBM A;  1FJK A;  2YKO A;  4N3Y B;  1GU5 A;  3P7K A;  1LWU B;  2YKQ A;  5APU A;  1LTJ C;  2N1T C;  2WPS A;  3M9Q A;  3A5T A;  2MJZ A;  2HFE D;  1SFC A;  3WMM 0;  1FOS F;  5AW1 B;  1NTM K;  5AVY B;  1N73 A;  1T8Z A;  1KZU B;  2CPB A;  2WZ7 A;  1FZC A;  1KQL A;  4IFM A;  2XU6 A;  2A45 G;  2OAR A;  5AVW B;  2GM4 A;  4W80 A;  2WT7 B;  2XV5 A;  4RES B;  4WY4 A;  4DOJ A;  1X8Y A;  3B5N C;  2VRS A;  3IR9 A;  2FFD B;  3RK3 C;  3MTU E;  5AW6 B;  1ZV8 A;  2LKM A;  3M9B A;  1VPC A;  4IFF A;  1KFN A;  4WBA A;  5APW A;  4C7N A;  2O1K A;  1HVV A;  1HGZ A;  3V4Q A;  3RK2 C;  1LTG C;  5CHX A;  1WRG A;  1CW5 A;  1YTZ T;  3U59 A;  3HUS B;  1NU1 K;  1G1J A;  2A45 H;  1RE3 C;  1W2E A;  4I6M C;  4B86 A;  1T3U A;  1IC2 A;  2Z5H A;  3II6 A;  1N73 C;  1JO5 A;  1RF1 A;  2W6A A;  5CCH C;  1FZF A;  1RF0 A;  3SWY A;  1LGH B;  1JY2 N;  1GL2 C;  5AVS B;  3RL0 C;  3A7O A;  3TK1 A;  1YTZ I;  1LTT C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...