1SLVB

Rat anionic n143h, e151h trypsin complexed to a86h ecotin; copper-bound
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
215
Chain Sequence
b'IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKVATVALPSSCAPAGTQCLISGWGHTLNHPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECOTIN
molecule tags Complex (serine protease/inhibitor)
source organism Escherichia coli
publication title X-ray structures of a designed binding site in trypsin show metal-dependent geometry.
pubmed doi rcsb
total genus 51
structure length 215
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1996-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1slvB01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1slvB02
1GMCF 3AW0A 2ZFSA 1TWXB 4A1TA 1O5CB 2XBYA 1EZUC 1XXDA 1YPHC 2FDAA 2FIRH 4RSPA 1TIOA 1CA8B 2J9NA 4WXIA 3E90B 4D7GA 3SJ8A 1ACBE 4Y79A 4LXBH 1A0HB 1K1IA 4X6MA 4YT6H 1Z6JH 1O3HA 1GVKB 2FLRH 2P8OB 1P02A 3D49H 1UVPA 1DLEA 2ZHWH 4NIXA 3F6UH 2BY7X 3V12A 2CF8H 4D7FA 1D9IA 1M9UA 1G32B 4CHAB 1Z8JB 1C2MA 1NN6A 5GPIB 1GBHA 2HRVA 3NPSA 1AUTC 1UTQA 3A8AA 4E05H 1MKXH 3RXDA 2GDEH 1O5BB 2NU2E 2ZHDA 4X6PA 2ZDKA 1OWIA 3GCHB 2BD3A 2QF0A 2PGBB 2QC2A 5DK1A 1G36A 3SUEA 1BHXB 3ZVDA 2QF3A 1ESBA 1THPB 2Z3CA 2OINA 4BXWA 3SORA 1UMAH 1W0YH 1VJAU 2EA3A 1PQ7A 2XC5A 4LK4A 2R3UA 2ZIQH 3I78A 1GBIA 2AH4X 1SPJA 2BLWA 2SGEE 2VB0A 3GY4A 1GBCA 4RKOB 5EG4A 1GWAA 1UK2A 3MU1A 3SI3H 3MU5A 4LZ4B 2Z7FE 1HXEH 1O2ZA 3ZZ7A 4NZQA 2BVXH 2V3OH 4FU9A 1O2TA 3PO1B 4MNYA 1LTOA 4MPUA 1FY4A 1DWEH 4GAWA 3I29A 3GDUA 1NO9H 1J16A 4FU7A 3SJ9A 4Y10E 1C2JA 3C27B 5BPEA 5FAHA 3TNSA 5EQQA 1DY9A 3RXIA 1XKAC 3ZZCA 4NZLA 1C1NA 2ZPRA 1OWJA 5DKMA 4A92A 2P16A 1HIAA 1MTWA 3UNQA 3ZVBA 2YNBA 1D3DB 2SGDE 1BCUH 4DJZB 4WMFA 1EATA 4B74A 4D76A 2ZGBH 2CV3A 2GDDA 1F0SA 1BTPA 1P05A 4IN2A 1O2NA 3JZ1B 1EPTA 1JMOH 1TGCA 3MTYA 3B8JA 1GDQA 2GV7A 1B7XB 5I25A 1WQVH 1A0LA 1GJ9B 2FM2A 1CHOG 2NU3E 4WWYA 4NG9H 1Q2WA 1D3QB 2TGPZ 4UDWH 4FUJA 3UUZA 3KCGH 4ZHAA 1XKBC 3MHWU 2QXIA 1GI0A 4OS6A 2ZI2H 2G5VA 1FY3A 3RXVA 3NUMA 1SBWA 4X8VH 4I8JA 2RCEA 1TA2A 1AY6H 3ITIA 4A7IB 2ODYB 4X2WA 1P03A 1V2RT 1HAGE 1ORFA 1C9PA 3A7XA 1PYTC 1UO6A 1GJ8B 3SI4H 1WTGH 1QCPA 3V13A 3MNBA 1UCYK 2IOTA 3M61U 1O35A 5AFZH 1CT0E 5B6OA 1X7AC 2C8ZB 1C5YB 1LHDH 2WYJA 3LDXH 1KXBA 2HPQH 4AGKA 1EASA 1ABIH 1HRTH 1A46H 4DIIH 1BTZA 2P3TB 1H9LB 4XSKU 1MBMA 1O2WA 4Y8XA 4Y0YE 1IHSH 2ZTYA 1NFXA 2PGQB 3RLYH 1NY22 1WAYB 5FXLA 1EJNA 3ZVGA 2H9TH 3A84A 4WMDA 4MNXA 3TGJE 1XM1A 5EODA 1IQIA 2BXUH 3EA7A 3VPKA 1K9OE 2D1JA 1HAYB 1ZTJA 4YO9A 1Y3VA 3UIRA 1AFQC 4ZHMU 4NA7A 4FUGA 1P2QA 2RA3A 1SI5H 2FOGA 3GY2A 3KQCA 1HAOH 5GWZA 4ZAEA 3GCOA 1EZSC 1T7CA 2HPPH 1WTHD 3BTGE 1O33A 2FOCA 1QIXB 4YZUA 3O8RA 4I32A 3HKIB 2G4UA 3LJJA 1E36B 1O2LA 7LPRA 4B2AA 1HLTH 3BTTE 2OBQA 3MO3A 5F03A 4HI3A 5FPTA 1YPJH 3RLWH 2V35A 1G37A 1GHAF 1LPKB 2ZWLH 5E0JA 3QTOH 4A1XA 3ZZ9A 2FOHA 5E2PA 3SU4A 3UY9A 1YGCH 3K2UA 3TU7H 3V3MA 4XDEA 1HNEE 1INCA 1ANDA 4Y8YA 2GD4B 1Y5BT 1A2CH 2AMDA 4TY6A 1QRZA 4XFQA 1QURH 1LHGH 1O3OA 6GCHG 8KME2 4AYYB 1C1RA 2FS8A 3EA8A 5J4QA 4CRFA 1QB1A 2A5IA 2QXGA 4D8NA 3UNRA 3FP8E 2P93A 3E91A 1ETTH 4YOJA 3BTWE 3MOCA 2Z3EA 1BMMH 3RC4A 3E8LA 3UWJH 4SGBE 3BG4B 1P01A 2A1DB 1TLDA 2OXSA 1GJ6A 2FYQA 3ZZ3A 2PTNA 1S0RA 2BVSH 3HK6B 1SGDE 1C5XB 1L4ZA 5T6FA 2GX4A 5JBAS 4X2VA 1GI2A 1C2KA 1ARCA 2A5KA 3LGYA 1CQQA 3AVZA 1TMTH 2G8TA 2IN2A 1CGHA 1XVMA 3QLPH 4O97A 1TNLA 4OS1A 1Z1JA 1RTFB 3E0PB 1PPHE 2ASUB 3GCNA 2H6MA 3QO6A 1V2MT 3RU4E 1XUGA 1NS3A 4CREA 3M5OA 4ABAA 2OQUA 5C2ZA 2ZTZA 4GSOA 1YKTA 3P92A 3VB4A 2FWWA 2GTBA 4JMYA 1V2PT 3ZV9A 1W3CA 1DOJA 1S82A 4Q7ZA 2UWPA 4ABDA 4F49A 2C8WB 2VIVA 1QJ1B 2H9EH 1AI8H 1VCPA 3ZVEA 4NIWA 3IWMA 3BTQE 1KXAA 4BAOB 4RKJB 2OC7A 2PSXA 1P2NA 4ZH8A 2ANKH 1FIWA 2OP9A 1BITA 3TH2H 1RS0A 1O30A 4BAKB 3SUDA 4JK5A 1SGPE 4IS5A 3H5CB 3MFJA 5A8YA 2W3IA 1O38A 1Q31A 4XE4A 5DPAA 1XVOA 1HUTH 5HYOA 2PTCE 3RUOA 1ELAA 3PLBA 5J4SA 1ZPZA 2QXJA 1DWBH 2ZGXH 4U2WA 1VZQH 1TGNA 3RC5A 3BTFE 5ETXA 4H6SB 3SUFA 1SC8U 3DHKH 3O8BA 1EAXA 1FPHH 1MAYA 1GI6A 1SGNE 2UUYA 3SNCA 1FZZA 1TRYA 2ZDNA 3TIUA 3E16B 3AAVA 1W10U 1O2GH 2ZHEH 2ZP0H 4H6TA 1HAVA 1ELVA 2PLXA 2QGRA 2ZHFH 1ZGIA 1GI8B 3RXTA 2PSYA 3IG6B 3RXPA 2VIQA 3M35A 2SNVA 3U69H 1DX5M 1C5PA 1GBAA 1EPTB 1LCYA 1AE5A 1K21H 1DICA 2AIPA 2D8WA 1WUNH 4IMZA 2A32A 2ULLA 3SU3A 1CVWH 1UVUH 1C2GA 5A09A 1YCPK 1K1OA 1W14U 2QY0B 1BMAA 1TX6A 1NM6A 2ALPA 1LMWB 1C1OA 2ODQA 1GBTA 3AAUA 5C5OA 4ISOA 1EJMA 2DUCA 1HAHH 1YPEH 1Z8GA 1GCDA 5FPSA 3DA9B 2BQWB 3LGUA 5A8ZA 1G3CA 2O8UA 1DSUA 1P3EA 3RDZA 2C8XB 1GMHF 4VGCC 1SGFG 4JYTA 3PROA 1TGBA 1EX3A 2BDYA 4IMQA 4R0IA 1WCZA 1ZHRA 2V3HH 4ABIA 4Y71A 1AD8H 5C1UA 1C5QA 2BY8X 2PFEA 3C1KA 1A61H 4I33A 1O39A 1FY5A 2Z9JA 3ZZ8A 4A5TS 2BZ6H 5IDKA 4NWKA 3HK3B 1ELEE 1K1JA 1SHHB 1WSSH 1O2QA 1DANH 1O2IA 2J4IA 3KNXA 2R0LA 1ANBA 2PKAB 3SNDA 4M7GA 1V2UT 5FCKA 1ZPBA 2P3UB 1C1VH 2V6NA 2XNIA 3F1SB 1S81A 7KMEH 3MMGA 1LHEH 4U30A 3GOVB 1NT1A 1GI3A 3SJKA 1GHYH 5IYTA 2WPLS 4ISLA 2FO9A 1O3KA 3EA9A 2BHGA 1H9HE 5GJ4B 1F5KU 4TWWA 5C1XA 2VVVA 2O9QA 1NRQH 2CN0H 4U01A 3TH4H 2BOHB 1C5LH 4ZROA 4B2CA 3LIWA 3ENSB 3VB7A 2PKAA 1J14A 1DWDH 1O2PA 1C2DA 3V7TA 1A1RA 1UHBA 1BJUA 1GGDC 2WYGA 1MTNB 1F0TA 3M5MA 5C1YA 2EEKA 1ZZZA 1C5SA 1Y3UA 4Q80A 1BBRE 2RG3A 1HDTH 3FANA 2VIOA 1OYTH 2IJOB 3SQEE 1F7ZA 1UVTH 1W0ZU 3UOUA 1ELTA 1F0RA 1SGFA 2ZU2A 3ZYDA 1TPOA 1JRTA 1TNIA 1OKXA 2TGDA 5F8ZA 3SHAH 2SGQE 4OGXA 3E0NB 4TY7A 1NPMA 3M5NA 3ATKA 3BTME 3GDVA 1TOMH 2AIQA 2FLBH 1AWHB 1NESE 2ZFQH 9LPRA 2Z94A 2O8MA 1UCYH 3U8RH 3WY8A 4DIHH 2STBE 2EC9H 5JYIA 1P2MA 2ZC9H 1H8DH 1D4PB 2OCVB 2H9HA 3LC5A 3I77A 5K0HA 1O2XA 2BY6X 3GISB 2OBOA 4CRAA 1SSXA 3DT0H 4JCNA 1MU6B 1HFDA 4FVBA 4H4FA 1GHVH 1GDNA 5AFYH 2B5TB 1QGFA 4WMEA 3U8TH 1XUJA 1NU7B 3QK1A 1P04A 1ZTKA 4YT7H 1P0SH 3TJVA 4B73A 2B9LA 2GKVE 1BTYA 5T3HA 4O3TA 4MPWA 3RXEA 2JETC 2P59A 4MDSA 3BTKE 4Y7AA 4X2YA 1HJAC 1GMDG 1BB0B 1SGEE 1FAKH 4B75A 2RA0A 2ZPQA 4NCYA 1EQ9A 1O2OA 1MTVA 1SB1H 1VCQA 2BDCA 2WUBA 3A7VA 1GBMA 1WOFA 7ESTE 5E2OA 2VH0A 1TE0A 1XMNB 3UQOA 1O5EH 5K7RA 1ZRKA 2JETB 2NWNA 5HGGA 2W26A 2G5NA 2FOBA 1AO5A 1V2OT 4GPGA 3PO1C 3ESTA 2YNAA 1HAPH 1GG6B 1GHBF 3GDSA 3A7YA 5HMAA 1V6DA 1OX1A 1ZMJA 1A5GH 1J15A 1EAUA 1T32A 1ID5H 1TNGA 2Q6DA 3QZRA 1P9SA 1E35B 3M3SA 1C5MD 3B9FH 2GV6A 1C5TA 1QB9A 1GVLA 2ALVA 1MBQA 2F9PA 3RM0H 3LC3A 1YCPH 2CGAA 1IAUA 4FUEA 7GCHG 4K5ZA 2VIWA 1PPEE 1EZQA 1KTSB 4SGAE 1AZZA 4DW2U 3TPIZ 1CT4E 5GDSH 3RM2H 5EU8A 1JXPA 1IQFA 2R9PA 1SOZA 3ELAH 4BOHA 1PPBH 1E38B 3UR9A 6CHAC 1QY6A 2P8OC 2BD5A 1CT2E 1HAZB 4K60A 1MQ6A 3P8GA 2Q6GA 4KP0A 2XCFA 1THSH 3QTVH 4K8BA 1GBFA 2HNTE 1TPPA 1XX9A 3BEIB 4CHAC 3RXOA 1IQGA 1O5AB 1UTNA 1Y59T 4HTCH 2Z9LA 3D65E 4ABFA 1MU8B 2Z9IA 1AKSA 4D9QA 4UEHH 1NRRH 2BM2A 3E6PH 3P8NA 5C5NA 1GVZA 8ESTE 1DPOA 3RXLA 1O3GA 2CJIA 2P95A 3BN9A 4K8YA 2CF9H 1NZQH 3GCHC 3RXFA 1LVMA 2FI4E 1C9TA 2DE9A 4NSYA 1G30B 3HATH 1GMHG 1TGTA 1O2YA 4ISIH 3EQ0H 1LVBA 1TRMA 4BAMB 3GY6A 4DT7B 1A3BH 1SLVB 2ILNA 4E7RG 1DWCH 4X8UH 3QUMP 4O03A 2BOKA 1J9CH 2SGFE 2ZQ1A 1V2TT 2FOAA 1C5OH 1AN1E 3A7ZA 4X6OA 1BMNH 4TPYA 3LU9B 5CMXH 3PLKA 1KIGH 3QN7A 1SR5C 2F91A 2ZQ2A 4AX9H 4Y6DA 3H7OA 3T5FH 4CH2B 5EXMA 3EE0B 2PV9B 5E0HA 3PWBA 1L1GA 4ABEA 1PPZA 4I8HA 2UWOA 3F68H 2J38A 1G2LA 2THFB 4DGJA 1SG8B 2ZFPH 2WPIS 5I46H 1HCGA 2FXRA 1N6YA 1THRH 1BBRH 2ZCLP 1KYNA 4NIYA 3LH3A 4CRDA 3TK9A 1IQNA 2VWOA 1FQ3A 3S0NA 1C1PA 4XOJA 2VGCB 1Z8IB 4AYVB 1YLDA 7GCHF 1CHOF 3RMLH 3PV4A 4KTUA 1P3CA 3A8BA 1QHRB 2XTTB 1TONA 1FAXA 4GCHG 2W7UA 3RXHA 3URCA 2QYIA 1Y8TA 1FNIA 2QV1A 1NU9A 1AWFH 1MTNC 3K9XB 3S9BA 3TGKE 3U98H 1W8BH 1DDJA 1UTPA 1DSTA 4DY7B 5FBIA 2R3YA 1DE7H 4B76A 1LVYA 1GI4A 1BA8B 1BTXA 1GBJA 2BD2A 1AZ8A 3QDZB 1GHBG 1AMHA 3ZV8A 3T2NA 4ISHH 2BY5X 1AUJA 1V2VT 3SO3A 3CENA 1F5RA 3GYMA 3GY7A 2FOFA 2JH6D 1T8OA 6LPRA 3KQEA 4BANB 1L0ZA 1GJCB 1K22H 1TMBH 4FUHA 3U8OH 2ZGJA 1O0DH 1EJAA 5E0GA 1OWKA 3SU0A 1A0JA 4JZ1A 4O9VA 1HBTH 3KF2A 2A45B 1QJ7B 3T26A 3U1IB 5C3NA 1Y5UT 2HNTC 1GDUA 4JZFH 2NU1E 4UFDH 2D2DA 3EYDA 3R3GB 3JZ2B 1SGIB 1UK4A 2ZU5A 3PLPA 4X6NA 4IW4E 1K1MA 3SV8A 1B0FA 1C4Y2 5DGJA 2OQ5A 3K6YA 3OY5U 5LH8A 1A5HA 4ESTE 3Q3KA 2CHAB 1YCPM 2A7JA 4QT8C 1O5GH 1DITH 1EPTC 1O32A 3VB6A 2UUJB 1SHYA 3RXQA 1P2IA 2QCYA 3ATWA 4FUDA 4IN1A 1KTTB 1J17T 3TK5A 1V3XA 5HXFA 1GJ7B 8LPRA 4KTSA 1Z8RA 4DVAU 2G55A 3DD2H 1OYQA 2WPKS 1SLUB 2VVCA 4BAQB 4WH8A 1K28D 1SQAA 1T8LA 1DT2A 3SV9A 4WY3A 1H8IH 1W12U 2AEIH 1WQSA 1ZOMA 2A2QH 1BTWA 2ZCKP 4XBCA 3MU4A 4X8SH 1ZLRA 3SU6A 2NU0E 4DG4A 4Z6AH 1MD8A 3K6ZA 2WV5A 1SGRE 3BTHE 5FX6A 1TABE 2Y80A 1RD3B 2BZAA 4UONA 1MUEB 2PUXB 2FESH 1TX8A 1YP9A 4X2XA 2K1QA 3A8CA 3BTDE 2YOLA 2ZCHP 1AU8A 5GCHF 1GMCG 2PUQH 2GCTC 3SQHE 2WPJS 1UTJA 3HPTB 1TAWA 1GJ5H 1ARBA 5FBEA 3GY8A 5T6DA 2GZ8A 1OP2A 2VWNA 1GI5A 4X1SU 2F9OA 1TBZH 1H4WA 2B7DH 1C2LA 3FZZA 3KHVA 5EOKA 1V2LT 2XW9A 1OPHB 1LQDB 1GL1A 2BDBA 1O34A 1JIMA 3BSQA 1LHFH 1OWDA 3OU0A 1GBEA 3TK6A 2XWAA 2FTLE 1GBDA 2PWXA 1O31A 1Y3WA 3KGPA 4GUXA 1O5FH 1RTKA 4KGAA 4FVDA 2G00A 1AVWA 2F83A 2TRMA 3SGBE 4UFFH 1ESTA 1B0EA 1ZTLA 3MI4A 2H1UA 1CBWB 2O8TA 1NTPA 3RC6A 2DE8A 4NWLA 4GLYA 3M37A 1HIAB 1KLIH 3L6PA 2XBXA 3KL6A 3A88A 3DFJA 1DLKB 2BX3A 1BOQA 2PHBA 1IQLA 1ZJDA 1AIXH 1GBKA 5JBTA 4TYDA 4Z0KA 3TLOA 4CR9A 4H42U 3BEFB 1H1BA 2LNCA 2KAIB 1YYY1 2ZGCA 2BQ7B 2GZ9A 2ANWA 1TNKA 3RXBA 1D6WA 1GBLA 1UTKA 3FVFB 1ETRH 2BD7A 3E3TA 3LONA 4MTBA 3RMMH 1PFXC 4INHA 5CHAC 5FCRA 2BD8A 2LPRA 1GCTB 3CP7A 1CSOE 1HAVB 2VU8E 3FP7E 1YPMH 1TPAE 5LGOA 2FP7B 1MQ5A 1KY9A 1WBGB 2FMJA 1AKSB 3D62A 3FFGA 2BDIA 1AHTH 1O3DA 3KIDU 2QA9E 2VIDA 5DG6A 2TGAA 2ZDMA 1QA0A 1QBNA 2KAIA 3QZQA 2OC8A 3AASA 1WU1A 3VB3A 3BG8A 3O8DA 4NFFA 3VXEH 1FY1A 1Y3YA 3P8FA 2BTCE 3QGJA 4KTCA 4AOQA 5JBCS 3RU4T 4NIVA 1EP5A 2R2MB 3A80A 5DP6A 2ZDVH 4X8TH 2B8OH 3ZVAA 1DS2E 3N7OA 2J34A 2GCHF 2F3CE 2P94A 1C4U2 2W5EA 2XXLA 1P9UA 2QIQA 1VR1H 2VGCC 1UTOA 4Q7YA 1NFUA 1GHZA 2FOEA 3L33A 4J2YB 5E8EH 1QB6A 1SOTA 2H2ZA 3PMBB 1JOUB 1QQUA 4UFEH 1RTLA 1V2NT 3STJA 1ZYOA 4J1YA 3A81A 1A3EH 3MU8A 1ZJKA 1MKWH 1O3JA 2B0FA 4MNVA 3TJOA 3NCLA 4BTIB 2C93B 2O8LA 2Z3DA 1O36A 5FHTA 4YLUA 3EDXB 5A2MH 4XBDA 1AGJA 1TFXA 5EXLA 2JKHA 5F6MA 2XRCA 2FZZA 4JYVH 2CMYA 1LPGB 1BQYA 1O2UA 2PR3A 2ZECA 1GGDB 1FDPA 2Y5GA 3MNCA 1BTHH 1TMUH 2XYAA 4FU8A 4MVNA 1GJDB 1GBBA 1NFWA 2A4OA 1GI9B 3BV9B 1PQ5A 4OGYA 1OS8A 2BXTH 3D23A 2TPIZ 4NA8A 1EAWA 1AFEH 1WYKA 3T29A 4TPIZ 3U9AH 2FOMB 4YLQH 2XC0A 1TYNA 1ZRBA 2ZHQH 5GIBA 3V0XA 1MTSA 4NGAH 4YTAA 1FN8A 1ELCA 1O2RA 1HJ9A 5TCAA 1MCVA 3BTEE 3HGNA 1ANEA 2JH0D 2BDGA 3KN2A 4ABBA 1C5RA 3M3VA 2JH5D 4VGCB 2BB4A 1NROH 4NSVA 2ZU4A 4XBBA 4Q2KA 5LPEA 2FYRA 4WH6A 1YPLH 3GCTG 3P8OA 1GCTC 1S5SA 4X1QU 1T4VH 1YLCA 4YM9A 1F2SE 3UQVA 4KELA 1XUKA 4WXVA 5A0AE 1RJXB 2ZDAH 4CH8B 2R0KA 2C4FH 1S0QA 1O2VA 1GI7B 5DP3A 1SQOA 1EKBB 2Y82A 2HGTH 3RXJA 3PYHA 1C5WB 1KXDA 4UFGH 1TOCB 4Y11E 2VJ1A 5G4BA 2SNWA 2SFAA 1IOEA 1P06A 3T28A 4K69A 2XWBI 5F8XA 3RXUA 2BY9X 2G4TA 1QL7A 1O5DH 5PTPA 1KDQA 2TBSA 2AGEX 2GCTB 1PYTD 1ZMNA 5EGMA 1KLJH 3CS0A 2Z9GA 1O3EA 1FPCH 5JBBS 5L2YH 4JZIA 4E7NA 3RXMA 3PMHB 2EI7A 3RP2A 2W7SA 1HYLA 2Y5FA 1BZXE 2HVXA 4R8TB 1QTFA 4K1EA 4UE7H 8GCHF 1O3CA 4AG2A 2C90B 1S85A 1MTUA 5L2ZH 3ZVFA 4JZDH 1F92A 2Y7ZA 3TVJB 2A0QB 3LKWA 1QL8A 4UD9H 4WJG2 5TCCA 1VCWA 1YBWA 1TNHA 3OYPA 2ANMH 2AGGX 2WINI 1KDQB 1FIZA 1TQ0B 1C4V2 1NFYA 3PTNA 4THNH 3SV7A 3MH7A 3NZIA 5AHGH 3K65B 1O3FA 6CHAB 4CRBA 1G2MA 1Z1IA 1CU1A 1PQAA 2VWMA 4IC6A 2FX4A 1DUEA 3SN8A 1SMFE 2UWLA 4X0WU 4CR5A 5A0CA 1T8MA 1Y3XA 2WPMS 3RXGA 4K2YA 1TBRH 2VNTA 4D9RA 4HFPB 4I8KA 3PM3A 4I7YH 1KXEA 2ZFTA 5GXPA 3BG4C 1GJAB 1BRUP 1EB1H 1C1UH 2BVRH 4BAHB 4FUIA 5C67A 2AFQB 9ESTA 3LOXA 3VB5A 4AG1A 2NU4E 1ELDE 2BLVA 1DUAA 5HM2A 1ZR0A 4IGDA 4Y76A 3TGIE 2C8YB 3AW1A 2FI5E 2VH6A 1HGTH 2F9NA 4DURA 5FPYA 2A7CA 3QX5H 1MMJN 3H7TA 2Y5HA 1EOLA 4MNWA 5DP5A 2G51A 1MH0A 1W7GH 1GPZA 1BUIA 2GT8A 4DCDA 5EW2H 1C1WH 2BMGB 3M7TA 1K1NA 2ZTXA 4MPXA 3VFEA 2AMPA 1SL3A 3SV2H 1PPCE 4AORA 1S6FA 1SGCA 3GCTF 4MLFB 4I8GA 1DM4B 4OS7A 2WUCA 1UTMA 3SZNA 3ZYEA 5EPYA 2FTMA 5L30H 1CGJE 3M5LA 2GVFA 1VITH 3NXPA 2Z9KA 1D6RA 2BDHA 2ZZUH 4MPVA 1N8OB 1HB0B 1VITG 1CGIE 1SFQB 1C5VA 4HGCA 1ZHMA 1O3MA 3EGKH 4K1TA 4OS2A 1HJ8A 3MYWA 3MU0A 3VGCC 5AF9H 5EQSA 1KXFA 3BF6H 2FI3E 2SGPE 3A82A 2EI8A 4A6LA 1YC0A 3PB1E 1G3EA 2A4RA 1PJPA 4BTUB 4CBNA 1N6XA 1N8OC 1O3LA 3QWCH 1ZGVA 1V2KT 4ZXYH 4BNRA 1Z7KA 4IC5A 1IQJA 1G9IE 2PW8H 1XUFA 2J94A 2STAE 3EAJA 3P70B 1MAXA 3W95A 1B5GH 4I31A 1PPFE 2ZPSA 3LH1A 5DP9A 4CRGA 1FXYA 5L6NH 1P10A 1YPKH 1GHWH 1S83A 2M5TA 1ELGA 2J95A 1HAXB 3MNSA 3A83A 1IQHA 1SGYE 4GCHF 3ZZ5A 1C1TA 1O3BA 1V2WT 2Y6TA 2FEQH 2W3KA 4FUCA 2UUKB 1SGTA 2Y7XA 2IPHA 1UCYE 2CXVA 2BQ6B 5EW1H 2A4GA 3SJIA 3ZZDA 1JIRA 1NRSH 2GP9B 3SJOA 1T31A 1P2KA 2A2XH 5A0BA 4BXSA 1TA6A 5JB9S 3Q00A 3L3TA 2GCHG 1XUHA 1UHBB 2ESTE 3SGQE 1O3NA 3LPRA 3MH4A 1FUJA 1YF4A 4X1RU 2GGVB 4MQAA 4WF8A 4ZMAH 2EI6A 1RRKA 1D3TB 3P17H 1FJSA 2F9UA 4OS5A 3OX7U 3IITA 3F9EA 1CO7E 1F0UA 3P95A 2Y81A 3RU4D 4AZ2B 1CA0C 3ODDA 3CS7A 3UTUH 5ESTE 1Y5AT 1KXCA 1QR3E 1KSNA 4B1TA 4ZKRU 5FX5A 3LJOA 4JK6A 4ZKNU 4E06H 2WPHS 3PMJA 3STIA 5CE1A 1P8VC 3GICB 3OTJE 1BJVA 3SBKA 4LOYH 1EB2A 3OY6U 1ELFA 2QN5T 1W13U 5JDUB 3U1JB 4AN7A 3UFAA 3FAOA 1LKAA 1S84A 1CA0B 2QXHA 3UWIA 1TQ7B 1SLXB 3TJNA 1C2IA 1AE8H 2Q6FA 1V2ST 1L1NA 4AFZA 1ZMLA 4AGJA 3M3TA 2ZO3H 3SUGA 4WVPE 1UVOA 1ZPCA 3TITA 1OP0A 3BEUA 1QL9A 3SU1A 2BD4A 1SLWB 1SFIA 3S9AA 3RXSA 1HAIH 1LVOA 1P11E 3Q3XA 1C5ZB 1TPSA 1HPGA 4JZEH 1L2EA 1MKWK 3RXRA 3RXCA 3ZZ4A 5HM9A 5F8TA 2GMTC 1W2KH 2H5DA 2V0BA 3OSYA 1MCTA 2ZEBA 1AB9B 2ZA5A 4BTTB 1RXPA 4GVUA 1GHAG 1DXWA 4B2BA 1C2EA 2FODA 1J8AA 4RN6A 1QA7A 1GJ4H 4Y0ZE 1L4DA 3MH6A 2BX4A 1G3BA 2D26C 2P3FH 3NWUA 1HV7A 1ABJH 4U32A 1A5IA 6ESTA 1C1SA 1ZSLA 1RFNA 1GJBB 3TJUA 2AS9A 2GMTB 3MNXA 3T27A 3S69A 2AERH 3Q76A 1DXPA 1LO6A 1OXGA 2J92A 1NRNH 2VVUA 4Q7XA 3GY5A 2ZU3A 3FP6E 8GCHG 1IQEA 2UUFB 1CBWC 1SGQE 5GCHG 3UPEA 4JYUH 2OUAA 1UJ1A 4ZXXH 1RIWC 1VGCB 5ABWA 1ANCA 1EUFA 3T62A 4CBOA 1E37B 3LGWA 1BTUA 1E34B 4FUBA 1ZHPA 3T25A 2CHAC 1D3PB 1OWEA 2AYWA 1NRPH 4YESB 1BMLA 3W94A 1UTLM 1K1PA 2A7HA 1RGQA 3F9GA 1O3PB 1TALA 1W7XH 2O8WA 1BRCE 3B23B 1RIWB 1C5UA 1VGCC 1UK3A 2G52A 1TGSZ 1DY8A 1YPGH 1FONA 4X1NU 3RMNH 1DVAH 1GMDF 2OD3B 1P2JA 2HWLB 2I6SA 4AFSA 1BIOA 5JB8S 3NKKA 3A85A 4INKA 2A31A 1HJAB 4I8LA 3Q3YA 3S7KB 1Q3XA 2ANYA 3TH3H 1BRBE 4K3JA 2HLCA 1ZSJA 3SV6A 4CRCA 3ATMA 4NFEA 2GT7A 5DP7A 5EXNA 1ZSKA 4YOIA 3ODFA 2ZFFH 4NA9H 2ZG0H 3URDA 2BYAX 3F9FA 1CE5A 1EP6A 1V2QT 2OC0A 1C1MA 1LPZB 2OTVA 5DJ7A 4KKDA 1BBRK 3O8CA 2BLOA 3ATLA 3M7UA 1FN6A 4IBLH 1IHTH 3DFLA 5A8XA 1QRXA 1OWHA 1TBQH 1F5LA 1QRWA 4ABJA 4AB9A 1UVSH 1EZXC 1O2KA 2FS9A 1PQ8A 2VWLA 2ZNKH 1MKXK 1O2HA 4GHTA 2VINA 4OS4A 4ZKSU 1QBOA 1WV7H 3PMAB 4AFUA 1TNJA 4ZUHA 1TB6H 3G01A 5T6GA 4ZKOU 1W11U 1LDTT 2PKSB 1AB9C 2HOBA 5AVDA 1A7SA 2XC4A 3SGAE 5DO4H 3UREA 1BDAA 1T4UH 1MD7A 3SOSA 1CHGA 3E1XB 1P12E 2XBVA 1H9IE 1O3IA 4ISNA 1MZDA 4TWYA 3GY3A 1C1QA 4K1SA 1G3DA 1BHXF 5LPFA 1P57B 3Q77A 1TRNA 2R2WU 1QNJA 2F9VA 1QFKH 2WV4A 2J2UA 1FV9A 1K2I1 3LGTA 2HALA 3SNAA 1YPHE 3VXFH 3P6ZB 1XUIA 1YM0A 2FX6A 4O3UA 1PPGE 1U6QA 1TX7A 3RXKA 5JPMH 1JRSA 4AB8A 3SHCH 1JBUH 3SW2B 4X1PU 1FI8A 3UOPA 4DOQA 3ZZBA 1O2JA 3QGNB 1AVGH 2FPZA 1BRAA 2BD9A 5LPRA 3HKJB 2RDLA 1VITF 1N1LA 1FMGA 4FUFA 2ZGHA 4MG3A 4Y7BA 1SVPA 1L1JA 1SQTA 2I6QA 4FXGH 3A87A 2OC1A 2TGTA 1FLEE 3FZDA 3SU2A 3NK8A 4HZHA 1MZAA 3KQDA 3SNBA 1VJ9U 3ATIA 1OSSA 4ABHA 1Z71A 2F9BH 1QQ4A 4B71A 1E0FD 1GL0E 2ZF0H 2OLGA 1LHCH 1LKBA 3RXAA 3GYLB 2BDAA 3KEEA 3A89A 4A1VA 2ODPA 3ZZAA 1O3AA 3A7WA 3M7QA 2SGAA 5C20A 1JWTA 2H5CA 3BIVH 1GHXH 4F4OC 1QBVH 1OOKB 4Y8ZA 2A4QA 2VIPA 5DP8A 3ZZ6A 4AFQA 1XXFA 1V2JT 3A86A 5CHAB 3R0FA 3LGIA 1ETSH 1ELBA 2Q1JA 3MWIU 3DUXH 3KQBA 2GZ7A 2C3SA 4YOGA 5DP4A 3MO6A 3F9HA 2A5AA 3SU5A 2TIOA 1O2MA 2Z6BD 4LZ1H 1AQ7A 1GI1A 4INLA 6GCHF 3S7HB 3SNEA 4ASHA 3VEQB 4ZHLU 3MO9A 2XCNA 2XBWA 4GHQA 1O37A 1OP8A 1AFQB 1C5NH 1K1LA 1QJ6B 3HGPA 3VGCB 3BIUH 1AVXA 2G81E 2ZDLA 1EXFA 3M36A 1S6HA 2ZU1A 5H4IB 5SGAE 2QAAA 4ABGA 3ZVCA 1A4WH 3S9CA 2HNTF 1IQMA 1EOJA 2PKSC 3LGVA 1C2FA 3LT3A 1GG6C 3A8DA 3UR6A 5TJXA 1O2SA 1DFPA 1Z6EA 5EQRA 1EAIA 3A7TA 5ESBA 1KLTA 1T8NA 3PWCA 1IQKA 2ZKSA 2AMQA 1C2HA 2ZFRH 1ESAA 1P09A 3PTBA 5EPNA 3UNSA 3RMOH 1NC6A 3TNTA 1HXFH 2AGIX 1LQEA 1P2OA 2BLQA 3MH5A 1BT7A 1FY8E 5BRRE 4PROA
chains in the Genus database with same CATH superfamily
1GMCF 3AW0A 2ZFSA 1TWXB 4P02A 4A1TA 1O5CB 2XBYA 1EZUC 1XXDA 1YPHC 2FDAA 2FIRH 4RSPA 1TIOA 1CA8B 2J9NA 4WXIA 3E90B 4D7GA 3SJ8A 1ACBE 4Y79A 4LXBH 1A0HB 1K1IA 4X6MA 4YT6H 1Z6JH 4FETA 1O3HA 1GVKB 2FLRH 2P8OB 1P02A 3D49H 1UVPA 1DLEA 2ZHWH 4NIXA 3F6UH 2BY7X 3V12A 2CF8H 4D7FA 1D9IA 1M9UA 4TT3D 1G32B 4CHAB 1Z8JB 4AC9A 1C2MA 1NN6A 5GPIB 1GBHA 1S6LA 2HRVA 3NPSA 1AUTC 1UTQA 3A8AA 4E05H 1MKXH 3RXDA 2GDEH 1O5BB 2NU2E 2ZHDA 4X6PA 2ZDKA 1OWIA 5IK2D 3GCHB 2BD3A 5CDFE 2QF0A 2PGBB 2QC2A 5DK1A 1G36A 3SUEA 1BHXB 3ZVDA 2QF3A 1ESBA 1THPB 2Z3CA 2OINA 4M9FA 4BXWA 3SORA 1UMAH 2V7QD 1W0YH 1VJAU 2EA3A 1PQ7A 2XC5A 2YMSB 4LK4A 2R3UA 2ZIQH 3I78A 1GBIA 2AH4X 1SPJA 2BLWA 2SGEE 2VB0A 3GY4A 1GBCA 4RKOB 5EG4A 1GWAA 1UK2A 3MU1A 3SI3H 3MU5A 4LZ4B 4XD7D 3FKSD 2Z7FE 1HXEH 1O2ZA 3ZZ7A 4NZQA 2LP6A 4Q63A 2BVXH 2V3OH 4FU9A 1O2TA 3PO1B 4MNYA 1LTOA 4MPUA 1FY4A 1DWEH 3DCLA 4GAWA 3I29A 3GDUA 1NO9H 1J16A 4FU7A 3SJ9A 4Y10E 1C2JA 3C27B 5BPEA 5FAHA 3TNSA 5EQQA 1DY9A 4YXWD 3RXIA 1XKAC 3ZZCA 4NZLA 1C1NA 2ZPRA 1OWJA 5DKMA 4A92A 2P16A 2KCPA 1HIAA 1MTWA 3UNQA 3ZVBA 2YNBA 1D3DB 2SGDE 1BCUH 4DJZB 4WMFA 1EATA 4B74A 4D76A 2ZGBH 2CV3A 2GDDA 1F0SA 1BTPA 4F55A 1P05A 4IN2A 1O2NA 3JZ1B 1EPTA 1JMOH 1TGCA 3MTYA 3B8JA 1GDQA 2GV7A 1B7XB 5I25A 1WQVH 1A0LA 1GJ9B 2FM2A 1CHOG 2NU3E 4WWYA 4NG9H 1Q2WA 1D3QB 2TGPZ 4UDWH 3ZIAD 4FUJA 3UUZA 1EFRD 2L6OA 3KCGH 4ZHAA 1XKBC 3MHWU 2QXIA 1GI0A 4OS6A 2ZI2H 2G5VA 1FY3A 3RXVA 3NUMA 1SBWA 4X8VH 4I8JA 2RCEA 1TA2A 1AY6H 3ITIA 4A7IB 2ODYB 4X2WA 1P03A 1V2RT 1HAGE 1ORFA 1C9PA 3A7XA 1PYTC 1UO6A 1GJ8B 3SI4H 1WTGH 1QCPA 3V13A 3MNBA 1UCYK 2IOTA 1YWUA 3M61U 1O35A 3GS9A 5AFZH 1CT0E 1MABB 5B6OA 1X7AC 2C8ZB 1C5YB 1LHDH 2WYJA 3LDXH 1KXBA 2HPQH 3PV2A 4AGKA 1EASA 2QF5A 1ABIH 1HRTH 1A46H 4DIIH 1BTZA 2P3TB 1H9LB 4XSKU 1MBMA 1O2WA 4Y8XA 4Y0YE 1SQRA 1IHSH 2ZTYA 1NFXA 2PGQB 3RLYH 1NY22 1NBMD 1WAYB 5FXLA 1EJNA 3ZVGA 2H9TH 3A84A 4WMDA 4ASUD 4MNXA 3TGJE 1XM1A 5EODA 1IQIA 2BXUH 5EJ1A 3EA7A 3VPKA 1K9OE 2D1JA 1HAYB 1ZTJA 4YO9A 1Y3VA 1W0JD 3UIRA 1AFQC 4ZHMU 4NA7A 4FUGA 1P2QA 2RA3A 3F0OA 1SI5H 2FOGA 3GY2A 3KQCA 3OEHD 4RT0A 1HAOH 5GWZA 4ZAEA 3GCOA 1EZSC 1T7CA 2HPPH 1WTHD 3BTGE 1O33A 2FOCA 1QIXB 4YZUA 3O8RA 4I32A 3HKIB 2G4UA 3LJJA 1E36B 1O2LA 7LPRA 4B2AA 1HLTH 3BTTE 2OBQA 3MO3A 5F03A 4HI3A 5FPTA 1YPJH 3RLWH 5B6LA 2V35A 1G37A 1GHAF 1LPKB 2ZWLH 5E0JA 3QTOH 4TSFD 4A1XA 3ZZ9A 2FOHA 5E2PA 3SU4A 5C0UA 3UY9A 1YGCH 3K2UA 3TU7H 3V3MA 4XDEA 1HNEE 1INCA 3KQ5A 1ANDA 4Y8YA 2GD4B 1Y5BT 1A2CH 2AMDA 4TY6A 1QRZA 4XFQA 1QURH 1LHGH 1O3OA 6GCHG 2AHME 8KME2 4AYYB 1C1RA 2FS8A 3EA8A 5J4QA 4CRFA 1QB1A 2A5IA 2QXGA 4D8NA 3UNRA 3FP8E 2P93A 3E91A 1ETTH 4YOJA 3BTWE 3MOCA 2Z3EA 1BMMH 3RC4A 3E8LA 3UWJH 4B6EA 4SGBE 3BG4B 1P01A 2A1DB 1TLDA 2OXSA 1GJ6A 2FYQA 2KFWA 3ZZ3A 2PTNA 1S0RA 2BVSH 5F53A 3HK6B 1SGDE 1C5XB 1L4ZA 5T6FA 2GX4A 5JBAS 4X2VA 1GI2A 1C2KA 1ARCA 2A5KA 3LGYA 1CQQA 3AVZA 1TMTH 2G8TA 2IN2A 4ACBA 1CGHA 1XVMA 3QLPH 4O97A 1TNLA 4OS1A 1Z1JA 1RTFB 3E0PB 3DSPA 1PPHE 2ASUB 3GCNA 5C94A 2H6MA 3QO6A 1V2MT 3RU4E 1XUGA 1NS3A 4CREA 3M5OA 4ABAA 2OQUA 5C2ZA 2ZTZA 4GSOA 1YKTA 3P92A 3VB4A 2FWWA 2GTBA 4JMYA 1V2PT 3ZV9A 1W3CA 1DOJA 1S82A 4Q7ZA 2UWPA 4ABDA 4F49A 2C8WB 2VIVA 1QJ1B 2H9EH 1AI8H 1VCPA 1W0KD 3ZVEA 4NIWA 3IWMA 3BTQE 1KXAA 4BAOB 4RKJB 2OC7A 2PSXA 1P2NA 4ZH8A 4FOUC 2ANKH 1FIWA 2OP9A 2KM0A 1BITA 3TH2H 1RS0A 1O30A 4BAKB 3SUDA 4JK5A 3H09A 1SGPE 4IS5A 3H5CB 3MFJA 5A8YA 2W3IA 1O38A 1Q31A 4XE4A 5DPAA 1XVOA 1HUTH 5HYOA 2PTCE 5DSFA 3RUOA 5C0TA 1ELAA 3PLBA 5J4SA 1ZPZA 2QXJA 1DWBH 2KZ4A 2ZGXH 4U2WA 1VZQH 1TGNA 3RC5A 3BTFE 5ETXA 4H6SB 3SUFA 1SC8U 3DHKH 3O8BA 1EAXA 1FPHH 1MAYA 1GI6A 1SGNE 2UUYA 3SNCA 3MQKC 1FZZA 1TRYA 2ZDNA 3TIUA 3E16B 3F2GA 3AAVA 1W10U 3AK5A 1O2GH 2ZHEH 2ZP0H 4H6TA 1HAVA 1ELVA 2F43B 2PLXA 2QGRA 2ZHFH 1ZGIA 1GI8B 3RXTA 2PSYA 3IG6B 3RXPA 2VIQA 3M35A 2SNVA 3U69H 1DX5M 1C5PA 1GBAA 1EPTB 1LCYA 1AE5A 1K21H 1DICA 2AIPA 2D8WA 1WUNH 4IMZA 2A32A 2ULLA 3SU3A 1CVWH 1UVUH 1C2GA 5A09A 1YCPK 1K1OA 1W14U 2QY0B 1BMAA 1TX6A 1NM6A 2ALPA 1LMWB 3N99A 1C1OA 2ODQA 1GBTA 3AAUA 5C5OA 4ISOA 1EJMA 2DUCA 1HAHH 1YPEH 1Z8GA 1GCDA 5FPSA 3DA9B 2BQWB 3LGUA 5A8ZA 1G3CA 2O8UA 1DSUA 1P3EA 3RDZA 2C8XB 1GMHF 4VGCC 1SGFG 4JYTA 3PROA 1TGBA 1EX3A 2BDYA 4IMQA 4R0IA 1WCZA 1ZHRA 2V3HH 4ABIA 4Y71A 1AD8H 5C1UA 1C5QA 2BY8X 2PFEA 3C1KA 1A61H 4I33A 3SZEA 1O39A 1FY5A 2Z9JA 3ZZ8A 4A5TS 2BZ6H 5IDKA 4NWKA 3HK3B 1ELEE 1K1JA 1SHHB 1WSSH 1O2QA 1DANH 1COWD 1O2IA 2J4IA 3KNXA 2R0LA 1ANBA 2PKAB 3SNDA 4M7GA 1V2UT 5FCKA 1ZPBA 2P3UB 1C1VH 2V6NA 2XNIA 3F1SB 1S81A 7KMEH 3MMGA 1LHEH 4U30A 3GOVB 1NT1A 1GI3A 3SJKA 1GHYH 5IYTA 2WPLS 4ISLA 2FO9A 1O3KA 3EA9A 2BHGA 5GNDA 1H9HE 5GJ4B 1F5KU 4TWWA 5C1XA 2VVVA 2O9QA 1NRQH 2CN0H 4U01A 2JJ1D 3TH4H 2BOHB 1C5LH 4ZROA 4B2CA 4DT4A 3LIWA 3ENSB 3VB7A 2PKAA 1J14A 1DWDH 1O2PA 1C2DA 3V7TA 1A1RA 1UHBA 5DN6D 1BJUA 1GGDC 2WYGA 1MTNB 1F0TA 3M5MA 5C1YA 2EEKA 1ZZZA 1C5SA 1Y3UA 4Q80A 1BBRE 2RG3A 1HDTH 3FANA 2VIOA 1OYTH 2IJOB 3SQEE 1F7ZA 1UVTH 1W0ZU 3UOUA 1ELTA 1F0RA 1SGFA 2ZU2A 3ZYDA 1TPOA 1JRTA 1TNIA 1OKXA 2TGDA 5F8ZA 3SHAH 2SGQE 4OGXA 3E0NB 2VBCA 4TY7A 1NPMA 2WPDD 3M5NA 3ATKA 3BTME 3GDVA 1TOMH 2AIQA 2FLBH 1AWHB 1NESE 2ZFQH 9LPRA 2Z94A 2O8MA 1UCYH 3U8RH 3WY8A 4DIHH 2STBE 2EC9H 5JYIA 1P2MA 2ZC9H 1H8DH 1D4PB 2OCVB 2H9HA 3LC5A 3I77A 5K0HA 1O2XA 2EQNA 2BY6X 3GISB 2OBOA 4CRAA 1SSXA 3DT0H 4JCNA 1MU6B 1HFDA 4FVBA 4H4FA 1GHVH 1GDNA 5AFYH 2B5TB 1QGFA 4WMEA 3U8TH 1XUJA 1NU7B 3QK1A 1P04A 1ZTKA 4YT7H 4B6FA 1P0SH 3TJVA 4B73A 2B9LA 2GKVE 1BTYA 5T3HA 4O3TA 4MPWA 3RXEA 2JETC 2P59A 4MDSA 3BTKE 4Y7AA 4X2YA 1HJAC 1GMDG 1BB0B 1SGEE 1FAKH 4B75A 2RA0A 2ZPQA 4NCYA 1EQ9A 1O2OA 1MTVA 1SB1H 1VCQA 2BDCA 2WUBA 3A7VA 1GBMA 1WOFA 7ESTE 5E2OA 2VH0A 1TE0A 1XMNB 3UQOA 1O5EH 2KR7A 2WSSD 5K7RA 1ZRKA 4F48B 2JETB 2L74A 2NWNA 5HGGA 2W26A 2G5NA 2FOBA 1AO5A 1V2OT 4GPGA 3PO1C 3ESTA 2YNAA 1HAPH 1GG6B 1GHBF 3GDSA 3A7YA 5HMAA 1V6DA 1OX1A 1ZMJA 1A5GH 1J15A 1EAUA 1T32A 1ID5H 1TNGA 2Q6DA 3QZRA 1P9SA 2JIZD 1E35B 3M3SA 1C5MD 3B9FH 2GV6A 1C5TA 1QB9A 1GVLA 2ALVA 1MBQA 2F9PA 3RM0H 3LC3A 1YCPH 2CGAA 1IAUA 4FUEA 7GCHG 4K5ZA 2VIWA 1PPEE 1EZQA 1KTSB 4SGAE 1AZZA 4DW2U 3TPIZ 1CT4E 5GDSH 3RM2H 5EU8A 1JXPA 1IQFA 2R9PA 1SOZA 3ELAH 4BOHA 1PPBH 1E38B 3UR9A 6CHAC 1QY6A 2P8OC 2BD5A 1CT2E 1HAZB 4K60A 1MQ6A 3P8GA 2Q6GA 4KP0A 2XCFA 1THSH 3QTVH 4K8BA 1GBFA 2HNTE 1TPPA 1XX9A 3BEIB 4CHAC 3RXOA 1IQGA 1O5AB 1UTNA 1UW7A 1Y59T 2Z9LA 3D65E 4HTCH 1MU8B 4ABFA 2Z9IA 1AKSA 5EJLA 4D9QA 4UEHH 1NRRH 2BM2A 3E6PH 3P8NA 5C5NA 1GVZA 8ESTE 1DPOA 3FOAA 3RXLA 1O3GA 2CJIA 2P95A 3BN9A 4K8YA 2CF9H 1NZQH 3GCHC 3RXFA 1LVMA 2FI4E 1C9TA 2DE9A 4NSYA 1G30B 3HATH 1GMHG 2V3MA 1TGTA 1O2YA 4ISIH 3EQ0H 3F3BA 1LVBA 1TRMA 2PP6A 3GY6A 4BAMB 1A3BH 4DT7B 1SLVB 2ILNA 4E7RG 1DWCH 4X8UH 3QUMP 4O03A 2BOKA 1J9CH 2SGFE 2ZQ1A 1V2TT 2FOAA 1C5OH 1AN1E 3A7ZA 4X6OA 1BMNH 4TPYA 3CNRA 3LU9B 3PLKA 1KIGH 3QN7A 5CMXH 1SR5C 2F91A 2ZQ2A 4AX9H 4Y6DA 3H7OA 3T5FH 4CH2B 5EXMA 3EE0B 2PV9B 5E0HA 3PWBA 1L1GA 4ABEA 1PPZA 4I8HA 2UWOA 3F68H 2J38A 1G2LA 2THFB 4DGJA 1SG8B 2EY4C 2ZFPH 2WPIS 5I46H 1HCGA 2FXRA 1N6YA 1THRH 1BBRH 2ZCLP 1KYNA 4NIYA 3LH3A 4CRDA 3TK9A 1IQNA 2VWOA 1FQ3A 3S0NA 1C1PA 4XOJA 2VGCB 1Z8IB 4AYVB 1YLDA 2KX4A 1CHOF 3RMLH 7GCHF 3PV4A 4KTUA 5HKKD 1P3CA 3A8BA 1QHRB 1TONA 2XTTB 1FAXA 4GCHG 2W7UA 3RXHA 3URCA 2QYIA 1Y8TA 1FNIA 2QV1A 1NU9A 1AWFH 1MTNC 3K9XB 3S9BA 3TGKE 3U98H 1W8BH 1DDJA 1UTPA 1DSTA 4DY7B 5FBIA 2R3YA 1DE7H 4B76A 1LVYA 1GI4A 1BA8B 1BTXA 1GBJA 2BD2A 1AZ8A 1H8ED 3QDZB 1GHBG 1AMHA 3ZV8A 3T2NA 4ISHH 2BY5X 1AUJA 3N7DA 1V2VT 3SO3A 3CENA 1F5RA 3GYMA 3GY7A 2FOFA 2JH6D 1T8OA 6LPRA 3KQEA 4BANB 1L0ZA 1GJCB 1K22H 1TMBH 4FUHA 2GJGA 3U8OH 2ZGJA 1O0DH 1EJAA 4RI0A 1OWKA 5E0GA 1A0JA 3SU0A 5C17A 4JZ1A 4O9VA 2LELA 1HBTH 3KF2A 2A45B 1QJ7B 3T26A 3U1IB 3VG8A 5C3NA 2KCOA 1Y5UT 2HNTC 1GDUA 4JZFH 2NU1E 4UFDH 2D2DA 3EYDA 3R3GB 3JZ2B 1SGIB 1UK4A 2ZU5A 3PLPA 4X6NA 4IW4E 1K1MA 3SV8A 1B0FA 1C4Y2 5DGJA 2OQ5A 3K6YA 3OY5U 5LH8A 1A5HA 4ESTE 3Q3KA 2CHAB 1YCPM 2A7JA 4QT8C 1BMFD 1O5GH 1DITH 1EPTC 1O32A 3VB6A 2QF4A 2UUJB 1SHYA 3RXQA 1P2IA 2QCYA 3ATWA 4FUDA 4IN1A 1KTTB 1J17T 3TK5A 1V3XA 5HXFA 3DSOA 1GJ7B 8LPRA 4KTSA 1Z8RA 4DVAU 2G55A 3DD2H 1OYQA 2WPKS 1SLUB 2VVCA 4BAQB 4WH8A 1K28D 1SQAA 1T8LA 2CK3D 1DT2A 2F4LA 3SV9A 4WY3A 1H8IH 4XRNA 1W12U 2AEIH 1WQSA 1ZOMA 2A2QH 2JDID 1BTWA 2ZCKP 4XBCA 3MU4A 4X8SH 1ZLRA 3SU6A 2YMSC 2NU0E 4DG4A 4Z6AH 1MD8A 3K6ZA 2WV5A 1SGRE 3BTHE 5FX6A 1TABE 2HVYB 2Y80A 1RD3B 2BZAA 4UONA 1MUEB 2PUXB 2FESH 1TX8A 1YP9A 4X2XA 2K1QA 3A8CA 3BTDE 2YOLA 2ZCHP 1AU8A 1KMHB 5GCHF 1GMCG 2PUQH 2WHXA 2GCTC 3SQHE 1VKYA 2WPJS 1UTJA 3HPTB 1TAWA 1GJ5H 1ARBA 5FBEA 3GY8A 5T6DA 2GZ8A 1OP2A 2VWNA 1GI5A 4X1SU 2F9OA 1TBZH 1H4WA 2B7DH 1C2LA 3FZZA 3KHVA 3SYJA 5EOKA 1V2LT 2XW9A 1OPHB 1LQDB 1GL1A 2BDBA 1O34A 1JIMA 3BSQA 1LHFH 1OWDA 3OU0A 1GBEA 3TK6A 2XWAA 2FTLE 1GBDA 2PWXA 1O31A 1Y3WA 3KGPA 4GUXA 3OTPA 1O5FH 1RTKA 4KGAA 4FVDA 2G00A 1AVWA 2F83A 2TRMA 3SGBE 4UFFH 1ESTA 1B0EA 1ZTLA 3MI4A 2H1UA 1CBWB 2O8TA 1NTPA 3RC6A 2DE8A 4NWLA 4GLYA 3M37A 1HIAB 1KLIH 3L6PA 2XBXA 3KL6A 3A88A 3DFJA 1DLKB 2BX3A 1BOQA 2PHBA 1IQLA 1ZJDA 3N7EA 1AIXH 1GBKA 5JBTA 4TYDA 4Z0KA 3TLOA 4CR9A 4H42U 3BEFB 1H1BA 2LNCA 2KAIB 1YYY1 2ZGCA 2BQ7B 2GZ9A 2ANWA 1TNKA 3RXBA 5FL7D 1D6WA 1GBLA 1UTKA 3FVFB 1ETRH 2BD7A 3E3TA 3LONA 4MTBA 3RMMH 1PFXC 4INHA 5CHAC 2HLDD 5FCRA 2BD8A 2LPRA 1GCTB 3CP7A 1CSOE 1HAVB 2VU8E 3FP7E 1YPMH 1TPAE 5LGOA 2FP7B 1MQ5A 1KY9A 1WBGB 2FMJA 1AKSB 3D62A 3FFGA 2BDIA 1AHTH 1O3DA 3KIDU 2QA9E 2VIDA 5DG6A 2TGAA 2ZDMA 1QA0A 1QBNA 2KAIA 3QZQA 2OC8A 3AASA 1WU1A 3VB3A 3BG8A 3O8DA 4NFFA 3VXEH 1FY1A 1Y3YA 3P8FA 2BTCE 3QGJA 4KTCA 4AOQA 5JBCS 3RU4T 4NIVA 1EP5A 2R2MB 3A80A 5DP6A 2ZDVH 4X8TH 2B8OH 3ZVAA 1DS2E 3N7OA 2J34A 2GCHF 2F3CE 2P94A 1C4U2 2W5EA 2XXLA 1P9UA 2QIQA 1VR1H 1UTOA 2VGCC 4Q7YA 1NFUA 1GHZA 2FOEA 3L33A 4J2YB 5E8EH 1QB6A 1SOTA 2H2ZA 3PMBB 1JOUB 1QQUA 4UFEH 1RTLA 3WWFA 1V2NT 3STJA 1ZYOA 4J1YA 3A81A 1A3EH 3MU8A 1ZJKA 1MKWH 3KYFA 1O3JA 3EE7A 2B0FA 4MNVA 3TJOA 3NCLA 4BTIB 2C93B 2O8LA 2Z3DA 1O36A 5FHTA 4YLUA 3EDXB 5A2MH 5KEDA 4XBDA 1AGJA 1TFXA 5EXLA 2JKHA 5F6MA 2XRCA 2FZZA 2IPQX 4JYVH 2CMYA 1LPGB 1BQYA 1O2UA 2PR3A 2ZECA 1GGDB 1FDPA 2Y5GA 3MNCA 1BTHH 1TMUH 2XYAA 4FU8A 4MVNA 1GJDB 1GBBA 1NFWA 2A4OA 1GI9B 3BV9B 2J5UA 1PQ5A 4OGYA 1OS8A 2BXTH 3D23A 3W1EA 2TPIZ 4NA8A 1EAWA 1AFEH 1WYKA 3T29A 4TPIZ 3U9AH 2FOMB 4YLQH 2XC0A 1TYNA 1ZRBA 2ZHQH 5GIBA 3V0XA 1MTSA 4NGAH 4YTAA 1FN8A 1ELCA 1O2RA 1HJ9A 5TCAA 1MCVA 3BTEE 3HGNA 3PRBA 1ANEA 2JH0D 2BDGA 3KN2A 4ABBA 1C5RA 3M3VA 2JH5D 4VGCB 2BB4A 1NROH 4NSVA 2ZU4A 5CHBA 5T1VA 4XBBA 4Q2KA 5LPEA 2FYRA 4WH6A 1YPLH 3GCTG 3P8OA 1GCTC 1S5SA 4X1QU 1T4VH 1YLCA 4YM9A 1F2SE 3UQVA 4KELA 1XUKA 4WXVA 5A0AE 1RJXB 2ZDAH 4CH8B 2R0KA 2C4FH 1S0QA 1O2VA 1GI7B 5DP3A 1SQOA 1EKBB 2Y82A 2HGTH 3RXJA 3PYHA 1C5WB 1KXDA 4UFGH 1TOCB 4Y11E 2VJ1A 5G4BA 2RFKC 2SNWA 2SFAA 3F2HA 1IOEA 1P06A 3T28A 4K69A 2XWBI 5F8XA 3RXUA 2BY9X 2G4TA 1QL7A 1O5DH 5PTPA 1KDQA 3FO8D 2TBSA 2AGEX 2GCTB 1PYTD 1ZMNA 5EGMA 1KLJH 3CS0A 2Z9GA 1O3EA 1FPCH 5JBBS 5L2YH 4JZIA 4E7NA 3RXMA 3PMHB 2EI7A 3OAAD 3RP2A 2W7SA 1HYLA 2Y5FA 1BZXE 1YY3A 2HVXA 4R8TB 1QTFA 4K1EA 4UE7H 8GCHF 1O3CA 4AG2A 2C90B 1S85A 1MTUA 5L2ZH 3ZVFA 4JZDH 1F92A 2Y7ZA 3TVJB 1WDIA 2A0QB 3LKWA 1QL8A 4UD9H 4WJG2 5TCCA 1VCWA 1YBWA 1TNHA 3OYPA 2ANMH 2K8IA 2AGGX 2WINI 1KDQB 5HIYA 3WW7A 1FIZA 1TQ0B 1C4V2 1NFYA 3PTNA 4THNH 3SV7A 5EIYA 3MH7A 3NZIA 5AHGH 3K65B 1O3FA 6CHAB 4CRBA 1G2MA 1Z1IA 1CU1A 1PQAA 2VWMA 4IC6A 3PV5A 2FX4A 1DUEA 3SN8A 1SMFE 2UWLA 4X0WU 4CR5A 5A0CA 1T8MA 1Y3XA 2WPMS 3RXGA 4K2YA 1TBRH 2VNTA 4ZCNA 4D9RA 4HFPB 4I8KA 3PM3A 4I7YH 1KXEA 2ZFTA 1K0HA 5GXPA 3BG4C 1GJAB 1BRUP 1EB1H 1C1UH 2BVRH 4BAHB 4FUIA 5C67A 2AFQB 9ESTA 3LOXA 3VB5A 4AG1A 2NU4E 1ELDE 2BLVA 1DUAA 5HM2A 1ZR0A 4IGDA 4Y76A 3TGIE 2C8YB 3AW1A 2FI5E 2VH6A 1HGTH 2F9NA 4DURA 2K0QA 5FPYA 2A7CA 3QX5H 1MMJN 3H7TA 2Y5HA 1EOLA 4MNWA 5DP5A 3UAIC 2G51A 1MH0A 1W7GH 1GPZA 1BUIA 2GT8A 4DCDA 5EW2H 1C1WH 2BMGB 3M7TA 4P00A 1K1NA 2ZTXA 4MPXA 4Q4LA 3VFEA 2AMPA 1SL3A 3SV2H 1PPCE 4AORA 1S6FA 1SGCA 3GCTF 2W6JD 4MLFB 4I8GA 1DM4B 4OS7A 2WUCA 1UTMA 3SZNA 3ZYEA 5EPYA 2FTMA 5L30H 1CGJE 3M5LA 2GVFA 1VITH 2XNDD 3NXPA 2Z9KA 1D6RA 2BDHA 2ZZUH 4MPVA 4Z1MD 1N8OB 1HB0B 1VITG 1CGIE 1SFQB 1C5VA 4HGCA 1ZHMA 1O3MA 3EGKH 4K1TA 4OS2A 1HJ8A 3MYWA 3MU0A 3VGCC 1H8HD 5AF9H 5EQSA 1KXFA 3BF6H 2FI3E 2SGPE 3A82A 2EI8A 4A6LA 1YC0A 2J97A 3PB1E 1G3EA 2A4RA 1PJPA 2OK5A 4BTUB 4CBNA 1N6XA 1N8OC 1O3LA 2J98B 3QWCH 1ZGVA 1V2KT 4ZXYH 4BNRA 1Z7KA 4IC5A 1IQJA 1G9IE 2PW8H 1XUFA 2J94A 2STAE 5KGOA 3EAJA 3P70B 1MAXA 3W95A 1B5GH 4I31A 1PPFE 2ZPSA 3LH1A 5DP9A 4CRGA 1FXYA 5L6NH 1P10A 1YPKH 1GHWH 1S83A 2M5TA 1E79D 1OHHD 1ELGA 2J95A 1YLNA 4OM9A 1HAXB 3MNSA 3A83A 1IQHA 1SGYE 4GCHF 3ZZ5A 1C1TA 1O3BA 1V2WT 2Y6TA 2FEQH 2W3KA 4FUCA 2UUKB 1SGTA 2Y7XA 2IPHA 1UCYE 2CXVA 2BQ6B 5EW1H 2A4GA 3SJIA 3ZZDA 1JIRA 1NRSH 2GP9B 3SJOA 1T31A 1P2KA 2A2XH 5A0BA 4BXSA 1TA6A 5JB9S 3Q00A 3L3TA 2GCHG 1XUHA 1UHBB 2ESTE 3SGQE 1O3NA 3LPRA 3MH4A 1FUJA 1YF4A 4X1RU 2GGVB 4MQAA 4WF8A 2KCAA 3F0PA 4ZMAH 2EI6A 1RRKA 1D3TB 3P17H 1FJSA 2F9UA 4OS5A 3OX7U 3IITA 3F9EA 3PRDA 1CO7E 1F0UA 3P95A 4ACAA 2Y81A 3RU4D 4AZ2B 4I86A 1CA0C 3ODDA 3CS7A 3UTUH 5ESTE 1Y5AT 1KXCA 1QR3E 2KCYA 1KSNA 4B1TA 4ZKRU 5FX5A 3LJOA 4JK6A 4ZKNU 4E06H 2WPHS 3PMJA 3STIA 5CE1A 1P8VC 3GICB 3OTJE 1BJVA 2IJD1 3SBKA 4LOYH 1EB2A 3OY6U 1ELFA 2QN5T 1W13U 5JDUB 3U1JB 4AN7A 3UFAA 3FAOA 1LKAA 1S84A 1CA0B 2QXHA 3UWIA 1TQ7B 1SLXB 3TJNA 1C2IA 1AE8H 2Q6FA 1V2ST 1L1NA 2QE7D 4AFZA 1ZMLA 4AGJA 3M3TA 2ZO3H 3SUGA 4WVPE 1UVOA 1ZPCA 3TITA 1OP0A 3BEUA 1QL9A 3SU1A 2BD4A 1SLWB 1SFIA 2WV9A 3S9AA 3RXSA 1HAIH 1LVOA 1P11E 3Q3XA 1C5ZB 1TPSA 1HPGA 4JZEH 1L2EA 1MKWK 3RXRA 3RXCA 3WWBA 3ZZ4A 5HM9A 5F8TA 2GMTC 1W2KH 2H5DA 2V0BA 3OSYA 1MCTA 2ZEBA 1AB9B 2ZA5A 4BTTB 1RXPA 4GVUA 1GHAG 1DXWA 4B2BA 1C2EA 2FODA 1J8AA 4RN6A 1QA7A 1GJ4H 4Y0ZE 1L4DA 2YMSD 1WXRA 3MH6A 2BX4A 1G3BA 2W6ID 4HG6A 2D26C 2P3FH 3NWUA 1HV7A 1ABJH 4U32A 1A5IA 6ESTA 1C1SA 1ZSLA 1RFNA 1GJBB 3TJUA 2AS9A 2GMTB 3MNXA 3T27A 3S69A 2AERH 5HIZA 3Q76A 1DXPA 1LO6A 1OXGA 2J92A 1NRNH 2VVUA 4Q7XA 3GY5A 2ZU3A 3FP6E 3OEED 8GCHG 1IQEA 2UUFB 1CBWC 1SGQE 5GCHG 3UPEA 4JYUH 2OUAA 1UJ1A 4ZXXH 1RIWC 1VGCB 5ABWA 1ANCA 1EUFA 3T62A 4CBOA 1E37B 3LGWA 1NBME 2M2AA 1BTUA 3OFND 1E34B 4FUBA 1ZHPA 3T25A 2CHAC 1D3PB 1OWEA 2AYWA 1NRPH 4YESB 1BMLA 3W94A 1UTLM 1K1PA 2A7HA 1RGQA 3F9GA 1O3PB 1TALA 1W7XH 2O8WA 1BRCE 3B23B 1RIWB 1C5UA 1VGCC 1UK3A 2G52A 1TGSZ 1DY8A 1YPGH 1FONA 2XOKD 4X1NU 3RMNH 1DVAH 1GMDF 2OD3B 1P2JA 2HWLB 2I6SA 4AFSA 1BIOA 5JB8S 3NKKA 3A85A 4INKA 2A31A 1HJAB 3F2FA 4I8LA 3Q3YA 3S7KB 1Q3XA 2ANYA 3TH3H 2RDEA 1BRBE 4K3JA 2HLCA 1ZSJA 3SV6A 4CRCA 3ATMA 4NFEA 2GT7A 5DP7A 5EXNA 1ZSKA 4YOIA 3ODFA 2ZFFH 4NA9H 2ZG0H 3URDA 2BYAX 3F9FA 1CE5A 1EP6A 1V2QT 2OC0A 1C1MA 1LPZB 2OTVA 5DJ7A 4KKDA 1BBRK 3O8CA 2BLOA 3ATLA 3M7UA 1FN6A 4IBLH 1IHTH 3DFLA 5A8XA 1QRXA 1OWHA 1TBQH 1F5LA 1QRWA 4ABJA 4AB9A 1UVSH 1EZXC 1O2KA 2FS9A 1PQ8A 2VWLA 2ZNKH 1MKXK 1O2HA 4GHTA 2VINA 4OS4A 5EJZA 4ZKSU 1QBOA 1WV7H 3PMAB 4AFUA 1TNJA 4ZUHA 3NRLA 1TB6H 3G01A 5T6GA 4ZKOU 1W11U 1LDTT 2PKSB 1AB9C 2HOBA 3U28C 5AVDA 1A7SA 2XC4A 3SGAE 5DO4H 3UREA 1BDAA 1T4UH 1MD7A 3SOSA 1CHGA 3E1XB 1P12E 2XBVA 1H9IE 1O3IA 4ISNA 1MZDA 4TWYA 3GY3A 1C1QA 4K1SA 1G3DA 1BHXF 5LPFA 1P57B 3Q77A 1TRNA 2R2WU 1QNJA 2F9VA 1QFKH 2WV4A 2J2UA 1FV9A 1K2I1 3LGTA 2HALA 3SNAA 1YPHE 3VXFH 3P6ZB 2J98A 1XUIA 1YM0A 2FX6A 4O3UA 1PPGE 1U6QA 1TX7A 3RXKA 3UB0A 5JPMH 1JRSA 4AB8A 3SHCH 1JBUH 3SW2B 4X1PU 1FI8A 3UOPA 4DOQA 3ZZBA 1O2JA 3QGNB 1AVGH 2FPZA 1BRAA 2BD9A 5LPRA 3HKJB 2RDLA 1VITF 1N1LA 1FMGA 4FUFA 4RT1A 2ZGHA 4MG3A 1E1RD 1SVPA 4Y7BA 1L1JA 1SKYE 1SQTA 2I6QA 4FXGH 3A87A 2OC1A 2TGTA 1FLEE 3FZDA 3OE7D 3NK8A 3SU2A 4HZHA 1MZAA 3KQDA 3SNBA 1VJ9U 3ATIA 1OSSA 4ABHA 1Z71A 2F9BH 1QQ4A 4B71A 1E0FD 1GL0E 2ZF0H 2OLGA 1LHCH 1LKBA 3RXAA 3GYLB 2BDAA 3KEEA 3A89A 3FN8A 4A1VA 2ODPA 3ZZAA 1O3AA 3A7WA 3M7QA 2SGAA 5C20A 1JWTA 2H5CA 3BIVH 1GHXH 2WZQA 4F4OC 1QBVH 1OOKB 4Y8ZA 2A4QA 3KYGA 2VIPA 5DP8A 3ZZ6A 4AFQA 1XXFA 1V2JT 3A86A 5CHAB 3R0FA 3LGIA 1ETSH 1QZ8A 1ELBA 2Q1JA 3MWIU 3DUXH 3KQBA 2GZ7A 2C3SA 4YOGA 5DP4A 3MO6A 3F9HA 2A5AA 3SU5A 2TIOA 1O2MA 2Z6BD 4LZ1H 1AQ7A 1GI1A 4INLA 2JJ2D 6GCHF 3S7HB 3SNEA 4ASHA 3VEQB 4ZHLU 3MO9A 2XCNA 2XBWA 4GHQA 1O37A 1OP8A 1AFQB 1C5NH 1K1LA 1QJ6B 3HGPA 3VGCB 3BIUH 1AVXA 3DSGA 2G81E 2ZDLA 1EXFA 3M36A 1E1QD 1S6HA 2ZU1A 5H4IB 5SGAE 2QAAA 4ABGA 3ZVCA 1A4WH 3S9CA 2HNTF 1IQMA 1EOJA 2PKSC 3LGVA 1C2FA 3LT3A 1GG6C 3A8DA 3UR6A 5TJXA 1O2SA 1DFPA 1Z6EA 5EQRA 1EAIA 3A7TA 5ESBA 1KLTA 1T8NA 3PWCA 1IQKA 2ZKSA 2AMQA 1C2HA 2ZFRH 1ESAA 1P09A 3PTBA 5EPNA 3UNSA 1FX0B 3RMOH 1NC6A 3TNTA 1HXFH 2AGIX 1LQEA 1P2OA 2BLQA 3MH5A 1BT7A 1FY8E 5KECA 5BRRE 4PROA
chains in the Genus database with same CATH topology
1GMCF 3AW0A 2ZFSA 1TWXB 4A1TA 1O5CB 2XBYA 1EZUC 1XXDA 1YPHC 2FDAA 2FIRH 4RSPA 1TIOA 1CA8B 2J9NA 4WXIA 3E90B 4D7GA 3SJ8A 1ACBE 4Y79A 4LXBH 1A0HB 1K1IA 4X6MA 4YT6H 1Z6JH 1O3HA 1GVKB 2FLRH 2P8OB 1P02A 3D49H 1UVPA 1DLEA 2ZHWH 4NIXA 3F6UH 2BY7X 3V12A 2CF8H 4D7FA 1D9IA 1M9UA 1G32B 4CHAB 1Z8JB 1C2MA 1NN6A 5GPIB 1GBHA 2HRVA 3NPSA 1AUTC 1UTQA 3A8AA 4E05H 1MKXH 3RXDA 2GDEH 1O5BB 2NU2E 2ZHDA 4X6PA 2ZDKA 1OWIA 3GCHB 2BD3A 2QF0A 2PGBB 2QC2A 5DK1A 1G36A 3SUEA 1BHXB 3ZVDA 2QF3A 1ESBA 1THPB 2Z3CA 2OINA 4BXWA 3SORA 1UMAH 1W0YH 1VJAU 2EA3A 1PQ7A 2XC5A 4LK4A 2R3UA 2ZIQH 3I78A 1GBIA 2AH4X 1SPJA 2BLWA 2SGEE 2VB0A 3GY4A 1GBCA 4RKOB 5EG4A 1GWAA 1UK2A 3MU1A 3SI3H 3MU5A 4LZ4B 2Z7FE 1HXEH 1O2ZA 3ZZ7A 4NZQA 2BVXH 2V3OH 4FU9A 1O2TA 3PO1B 4MNYA 1LTOA 4MPUA 1FY4A 1DWEH 4GAWA 3I29A 3GDUA 1NO9H 1J16A 4FU7A 3SJ9A 4Y10E 1C2JA 3C27B 5BPEA 5FAHA 3TNSA 5EQQA 1DY9A 3RXIA 1XKAC 3ZZCA 4NZLA 1C1NA 2ZPRA 1OWJA 5DKMA 4A92A 2P16A 1HIAA 1MTWA 3UNQA 3ZVBA 2YNBA 1D3DB 2SGDE 1BCUH 4DJZB 4WMFA 1EATA 4B74A 4D76A 2ZGBH 2CV3A 2GDDA 1F0SA 1BTPA 1P05A 4IN2A 1O2NA 3JZ1B 1EPTA 1JMOH 1TGCA 3MTYA 3B8JA 1GDQA 2GV7A 1B7XB 5I25A 1WQVH 1A0LA 1GJ9B 2FM2A 1CHOG 2NU3E 4WWYA 4NG9H 1Q2WA 1D3QB 2TGPZ 4UDWH 4FUJA 3UUZA 3KCGH 4ZHAA 1XKBC 3MHWU 2QXIA 1GI0A 4OS6A 2ZI2H 2G5VA 1FY3A 3RXVA 3NUMA 1SBWA 4X8VH 4I8JA 2RCEA 1TA2A 1AY6H 3ITIA 4A7IB 2ODYB 4X2WA 1P03A 1V2RT 1HAGE 1ORFA 1C9PA 3A7XA 1PYTC 1UO6A 1GJ8B 3SI4H 1WTGH 1QCPA 3V13A 3MNBA 1UCYK 2IOTA 3M61U 1O35A 5AFZH 1CT0E 5B6OA 1X7AC 2C8ZB 1C5YB 1LHDH 2WYJA 3LDXH 1KXBA 2HPQH 4AGKA 1EASA 1ABIH 1HRTH 1A46H 4DIIH 1BTZA 2P3TB 1H9LB 4XSKU 1MBMA 1O2WA 4Y8XA 4Y0YE 1IHSH 2ZTYA 1NFXA 2PGQB 3RLYH 1NY22 1WAYB 5FXLA 1EJNA 3ZVGA 2H9TH 3A84A 4WMDA 4MNXA 3TGJE 1XM1A 5EODA 1IQIA 2BXUH 3EA7A 3VPKA 1K9OE 2D1JA 1HAYB 1ZTJA 4YO9A 1Y3VA 3UIRA 1AFQC 4ZHMU 4NA7A 4FUGA 1P2QA 2RA3A 1SI5H 2FOGA 3GY2A 3KQCA 1HAOH 5GWZA 4ZAEA 3GCOA 1EZSC 1T7CA 2HPPH 1WTHD 3BTGE 1O33A 2FOCA 1QIXB 4YZUA 3O8RA 4I32A 3HKIB 2G4UA 3LJJA 1E36B 1O2LA 7LPRA 4B2AA 1HLTH 3BTTE 2OBQA 3MO3A 5F03A 4HI3A 5FPTA 1YPJH 3RLWH 2V35A 1G37A 1GHAF 1LPKB 2ZWLH 5E0JA 3QTOH 4A1XA 3ZZ9A 2FOHA 5E2PA 3SU4A 3UY9A 1YGCH 3K2UA 3TU7H 3V3MA 4XDEA 1HNEE 1INCA 1ANDA 4Y8YA 2GD4B 1Y5BT 1A2CH 2AMDA 4TY6A 1QRZA 4XFQA 1QURH 1LHGH 1O3OA 6GCHG 8KME2 4AYYB 1C1RA 2FS8A 3EA8A 5J4QA 4CRFA 1QB1A 2A5IA 2QXGA 4D8NA 3UNRA 3FP8E 2P93A 3E91A 1ETTH 4YOJA 3BTWE 3MOCA 2Z3EA 1BMMH 3RC4A 3E8LA 3UWJH 4SGBE 3BG4B 1P01A 2A1DB 1TLDA 2OXSA 1GJ6A 2FYQA 3ZZ3A 2PTNA 1S0RA 2BVSH 3HK6B 1SGDE 1C5XB 1L4ZA 5T6FA 2GX4A 5JBAS 4X2VA 1GI2A 1C2KA 1ARCA 2A5KA 3LGYA 1CQQA 3AVZA 1TMTH 2G8TA 2IN2A 1CGHA 1XVMA 3QLPH 4O97A 1TNLA 4OS1A 1Z1JA 1RTFB 3E0PB 1PPHE 2ASUB 3GCNA 2H6MA 3QO6A 1V2MT 3RU4E 1XUGA 1NS3A 4CREA 3M5OA 4ABAA 2OQUA 5C2ZA 2ZTZA 4GSOA 1YKTA 3P92A 3VB4A 2FWWA 2GTBA 4JMYA 1V2PT 3ZV9A 1W3CA 1DOJA 1S82A 4Q7ZA 2UWPA 4ABDA 4F49A 2C8WB 2VIVA 1QJ1B 2H9EH 1AI8H 1VCPA 3ZVEA 4NIWA 3IWMA 3BTQE 1KXAA 4BAOB 4RKJB 2OC7A 2PSXA 1P2NA 4ZH8A 2ANKH 1FIWA 2OP9A 1BITA 3TH2H 1RS0A 1O30A 4BAKB 3SUDA 4JK5A 1SGPE 4IS5A 3H5CB 3MFJA 5A8YA 2W3IA 1O38A 1Q31A 4XE4A 5DPAA 1XVOA 1HUTH 5HYOA 2PTCE 3RUOA 1ELAA 3PLBA 5J4SA 1ZPZA 2QXJA 1DWBH 2ZGXH 4U2WA 1VZQH 1TGNA 3RC5A 3BTFE 5ETXA 4H6SB 3SUFA 1SC8U 3DHKH 3O8BA 1EAXA 1FPHH 1MAYA 1GI6A 1SGNE 2UUYA 3SNCA 1FZZA 1TRYA 2ZDNA 3TIUA 3E16B 3AAVA 1W10U 1O2GH 2ZHEH 2ZP0H 4H6TA 1HAVA 1ELVA 2PLXA 2QGRA 2ZHFH 1ZGIA 1GI8B 3RXTA 2PSYA 3IG6B 3RXPA 2VIQA 3M35A 2SNVA 3U69H 1DX5M 1C5PA 1GBAA 1EPTB 1LCYA 1AE5A 1K21H 1DICA 2AIPA 2D8WA 1WUNH 4IMZA 2A32A 2ULLA 3SU3A 1CVWH 1UVUH 1C2GA 5A09A 1YCPK 1K1OA 1W14U 2QY0B 1BMAA 1TX6A 1NM6A 2ALPA 1LMWB 1C1OA 2ODQA 1GBTA 3AAUA 5C5OA 4ISOA 1EJMA 2DUCA 1HAHH 1YPEH 1Z8GA 1GCDA 5FPSA 3DA9B 2BQWB 3LGUA 5A8ZA 1G3CA 2O8UA 1DSUA 1P3EA 3RDZA 2C8XB 1GMHF 4VGCC 1SGFG 4JYTA 3PROA 1TGBA 1EX3A 2BDYA 4IMQA 4R0IA 1WCZA 1ZHRA 2V3HH 4ABIA 4Y71A 1AD8H 5C1UA 1C5QA 2BY8X 2PFEA 3C1KA 1A61H 4I33A 1O39A 1FY5A 2Z9JA 3ZZ8A 4A5TS 2BZ6H 5IDKA 4NWKA 3HK3B 1ELEE 1K1JA 1SHHB 1WSSH 1O2QA 1DANH 1O2IA 2J4IA 3KNXA 2R0LA 1ANBA 2PKAB 3SNDA 4M7GA 1V2UT 5FCKA 1ZPBA 2P3UB 1C1VH 2V6NA 2XNIA 3F1SB 1S81A 7KMEH 3MMGA 1LHEH 4U30A 3GOVB 1NT1A 1GI3A 3SJKA 1GHYH 5IYTA 2WPLS 4ISLA 2FO9A 1O3KA 3EA9A 2BHGA 1H9HE 5GJ4B 1F5KU 4TWWA 5C1XA 2VVVA 2O9QA 1NRQH 2CN0H 4U01A 3TH4H 2BOHB 1C5LH 4ZROA 4B2CA 3LIWA 3ENSB 3VB7A 2PKAA 1J14A 1DWDH 1O2PA 1C2DA 3V7TA 1A1RA 1UHBA 1BJUA 1GGDC 2WYGA 1MTNB 1F0TA 3M5MA 5C1YA 2EEKA 1ZZZA 1C5SA 1Y3UA 4Q80A 1BBRE 2RG3A 1HDTH 3FANA 2VIOA 1OYTH 2IJOB 3SQEE 1F7ZA 1UVTH 1W0ZU 3UOUA 1ELTA 1F0RA 1SGFA 2ZU2A 3ZYDA 1TPOA 1JRTA 1TNIA 1OKXA 2TGDA 5F8ZA 3SHAH 2SGQE 4OGXA 3E0NB 4TY7A 1NPMA 3M5NA 3ATKA 3BTME 3GDVA 1TOMH 2AIQA 2FLBH 1AWHB 1NESE 2ZFQH 9LPRA 2Z94A 2O8MA 1UCYH 3U8RH 3WY8A 4DIHH 2STBE 2EC9H 5JYIA 1P2MA 2ZC9H 1H8DH 1D4PB 2OCVB 2H9HA 3LC5A 3I77A 5K0HA 1O2XA 2BY6X 3GISB 2OBOA 4CRAA 1SSXA 3DT0H 4JCNA 1MU6B 1HFDA 4FVBA 4H4FA 1GHVH 1GDNA 5AFYH 2B5TB 1QGFA 4WMEA 3U8TH 1XUJA 1NU7B 3QK1A 1P04A 1ZTKA 4YT7H 1P0SH 3TJVA 4B73A 2B9LA 2GKVE 1BTYA 5T3HA 4O3TA 4MPWA 3RXEA 2JETC 2P59A 4MDSA 3BTKE 4Y7AA 4X2YA 1HJAC 1GMDG 1BB0B 1SGEE 1FAKH 4B75A 2RA0A 2ZPQA 4NCYA 1EQ9A 1O2OA 1MTVA 1SB1H 1VCQA 2BDCA 2WUBA 3A7VA 1GBMA 1WOFA 7ESTE 5E2OA 2VH0A 1TE0A 1XMNB 3UQOA 1O5EH 5K7RA 1ZRKA 2JETB 2NWNA 5HGGA 2W26A 2G5NA 2FOBA 1AO5A 1V2OT 4GPGA 3PO1C 3ESTA 2YNAA 1HAPH 1GG6B 1GHBF 3GDSA 3A7YA 5HMAA 1V6DA 1OX1A 1ZMJA 1A5GH 1J15A 1EAUA 1T32A 1ID5H 1TNGA 2Q6DA 3QZRA 1P9SA 1E35B 3M3SA 1C5MD 3B9FH 2GV6A 1C5TA 1QB9A 1GVLA 2ALVA 1MBQA 2F9PA 3RM0H 3LC3A 1YCPH 2CGAA 1IAUA 4FUEA 7GCHG 4K5ZA 2VIWA 1PPEE 1EZQA 1KTSB 4SGAE 1AZZA 4DW2U 3TPIZ 1CT4E 5GDSH 3RM2H 5EU8A 1JXPA 1IQFA 2R9PA 1SOZA 3ELAH 4BOHA 1PPBH 1E38B 3UR9A 6CHAC 1QY6A 2P8OC 2BD5A 1CT2E 1HAZB 4K60A 1MQ6A 3P8GA 2Q6GA 4KP0A 2XCFA 1THSH 3QTVH 4K8BA 1GBFA 2HNTE 1TPPA 1XX9A 3BEIB 4CHAC 3RXOA 1IQGA 1O5AB 1UTNA 1Y59T 4HTCH 2Z9LA 3D65E 4ABFA 1MU8B 2Z9IA 1AKSA 4D9QA 4UEHH 1NRRH 2BM2A 3E6PH 3P8NA 5C5NA 1GVZA 8ESTE 1DPOA 3RXLA 1O3GA 2CJIA 2P95A 3BN9A 4K8YA 2CF9H 1NZQH 3GCHC 3RXFA 1LVMA 2FI4E 1C9TA 2DE9A 4NSYA 1G30B 3HATH 1GMHG 1TGTA 1O2YA 4ISIH 3EQ0H 1LVBA 1TRMA 4BAMB 3GY6A 4DT7B 1A3BH 1SLVB 2ILNA 4E7RG 1DWCH 4X8UH 3QUMP 4O03A 2BOKA 1J9CH 2SGFE 2ZQ1A 1V2TT 2FOAA 1C5OH 1AN1E 3A7ZA 4X6OA 1BMNH 4TPYA 3LU9B 5CMXH 3PLKA 1KIGH 3QN7A 1SR5C 2F91A 2ZQ2A 4AX9H 4Y6DA 3H7OA 3T5FH 4CH2B 5EXMA 3EE0B 2PV9B 5E0HA 3PWBA 1L1GA 4ABEA 1PPZA 4I8HA 2UWOA 3F68H 2J38A 1G2LA 2THFB 4DGJA 1SG8B 2ZFPH 2WPIS 5I46H 1HCGA 2FXRA 1N6YA 1THRH 1BBRH 2ZCLP 1KYNA 4NIYA 3LH3A 4CRDA 3TK9A 1IQNA 2VWOA 1FQ3A 3S0NA 1C1PA 4XOJA 2VGCB 1Z8IB 4AYVB 1YLDA 7GCHF 1CHOF 3RMLH 3PV4A 4KTUA 1P3CA 3A8BA 1QHRB 2XTTB 1TONA 1FAXA 4GCHG 2W7UA 3RXHA 3URCA 2QYIA 1Y8TA 1FNIA 2QV1A 1NU9A 1AWFH 1MTNC 3K9XB 3S9BA 3TGKE 3U98H 1W8BH 1DDJA 1UTPA 1DSTA 4DY7B 5FBIA 2R3YA 1DE7H 4B76A 1LVYA 1GI4A 1BA8B 1BTXA 1GBJA 2BD2A 1AZ8A 3QDZB 1GHBG 1AMHA 3ZV8A 3T2NA 4ISHH 2BY5X 1AUJA 1V2VT 3SO3A 3CENA 1F5RA 3GYMA 3GY7A 2FOFA 2JH6D 1T8OA 6LPRA 3KQEA 4BANB 1L0ZA 1GJCB 1K22H 1TMBH 4FUHA 3U8OH 2ZGJA 1O0DH 1EJAA 5E0GA 1OWKA 3SU0A 1A0JA 4JZ1A 4O9VA 1HBTH 3KF2A 2A45B 1QJ7B 3T26A 3U1IB 5C3NA 1Y5UT 2HNTC 1GDUA 4JZFH 2NU1E 4UFDH 2D2DA 3EYDA 3R3GB 3JZ2B 1SGIB 1UK4A 2ZU5A 3PLPA 4X6NA 4IW4E 1K1MA 3SV8A 1B0FA 1C4Y2 5DGJA 2OQ5A 3K6YA 3OY5U 5LH8A 1A5HA 4ESTE 3Q3KA 2CHAB 1YCPM 2A7JA 4QT8C 1O5GH 1DITH 1EPTC 1O32A 3VB6A 2UUJB 1SHYA 3RXQA 1P2IA 2QCYA 3ATWA 4FUDA 4IN1A 1KTTB 1J17T 3TK5A 1V3XA 5HXFA 1GJ7B 8LPRA 4KTSA 1Z8RA 4DVAU 2G55A 3DD2H 1OYQA 2WPKS 1SLUB 2VVCA 4BAQB 4WH8A 1K28D 1SQAA 1T8LA 1DT2A 3SV9A 4WY3A 1H8IH 1W12U 2AEIH 1WQSA 1ZOMA 2A2QH 1BTWA 2ZCKP 4XBCA 3MU4A 4X8SH 1ZLRA 3SU6A 2NU0E 4DG4A 4Z6AH 1MD8A 3K6ZA 2WV5A 1SGRE 3BTHE 5FX6A 1TABE 2Y80A 1RD3B 2BZAA 4UONA 1MUEB 2PUXB 2FESH 1TX8A 1YP9A 4X2XA 2K1QA 3A8CA 3BTDE 2YOLA 2ZCHP 1AU8A 5GCHF 1GMCG 2PUQH 2GCTC 3SQHE 2WPJS 1UTJA 3HPT