1SM3H

Crystal structure of the tumor specific antibody sm3 complex with its peptide epitope
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
217
structure length
211
Chain Sequence
b'QVQLQESGGGLVQPGGSMKLSCVASGFTFSNYWMNWVRQSPEKGLEWVAEIRLKSNNYATHYAESVKGRFTISRDDSKSSVYLQMNNLRAEDTGIYYCTGVGQFAYWGQGTTVTVSSAKTTPPTVYPLAPGSMVTLGCLVKGYFPEPVTVTWNSGSLASGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDAKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SM3 ANTIBODY
publication title Crystal structure at 1.95 A resolution of the breast tumour-specific antibody SM3 complexed with its peptide epitope reveals novel hypervariable loop recognition.
pubmed doi rcsb
molecule tags Complex (antibody/peptide epitope)
total genus 44
structure length 211
sequence length 217
ec nomenclature
pdb deposition date 1997-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1sm3H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1sm3H01
3R1GL 4F80A 1T21A 2WBKA 3EYUL 1OP3K 3VI4F 1S5HA 4F57H 1RZKC 3GKWH 3GUTA 4Y4FC 5I71C 4QOKD 5JHLH 3QDGE 1TJHL 2QR0B 3CFCH 2D3VA 3QHZL 3OMZA 5C0DB 4AIZB 3NCMA 4MNGB 3ARDD 3UYRH 4RCAA 4L9LA 5FUOL 2VE6B 2XKNA 4JREB 5IP4A 4ZG1A 3P9MA 1HXYB 2NR6C 3OBAA 2AK4E 3DURA 1IAOB 3RBGA 2RCSH 3K7UA 1LP9B 1DUZA 3D6GA 3BP5B 2XY1A 3GM0A 3IFLH 4KKCC 4RMWA 1SJHA 3O6FA 4PBVC 3WSQL 4KROD 1QFWI 4KKCD 2NY6B 2XICA 4IMKA 2KQNA 1ZA3B 3QRGL 1NSNL 1WZ1H 4KY1L 1MI5B 4YQXL 4X9IA 1KLUA 4ODSH 1H3VA 4OZHE 4DZBB 4YDLC 2VZ3A 3RUGF 4P2CG 5HI5C 4OQTL 1T20B 2BSED 4LCCC 4ODUA 4YPGB 4XPAH 2J7LA 3F62A 4JHWH 1DBJH 3MUHL 5T1KA 3IFPB 1IILE 4PJDE 1UXWB 1BD2E 5A43C 4PGCB 2V5SA 4ZPTB 1SM3H 1YEGH 2Z93A 3F7VA 1QBAA 3HA0A 4HFWA 3U0PB 3JUYA 2A9NL 1TZHA 4MQ7B 1CTNA 3NAAH 4HMCA 1UXSB 3EUUA 2IAMD 1CDIA 4CU7A 3HNVL 3DO7B 3QNYB 5DD1L 4NN7C 5HYJE 3TJEL 3OKOB 3P73A 1X9QA 2GJZB 5CP7B 3C8KB 4KAQH 3GRWA 1U8NB 1UA6L 5GGVL 5EULV 3V5HB 4EDWL 4OD2A 1JP5A 4G8IB 4PP1C 2ZUTA 3QEGL 2A6KB 3U6RA 2FECL 4PP1D 4QRSB 2DOCA 4PJIA 5EORL 3TBTB 3MV9A 3D1MC 5DK2A 3V79C 5TF0A 4PGBA 1DQML 4NQEE 4ZSOA 1FFNA 4ZD3H 1KPVB 1V3LA 3T3MF 8CGTA 2HVKB 5IVZA 2L0DA 1BM3H 1KGCE 5I9QC 1TZGH 3KLAB 1QZ1A 1B90A 3I3BA 1AFVH 4RRPG 3MRBA 4NO0B 1ORSA 1JPFA 5FKAB 5TH2B 4MJIA 2APXA 2LV4A 5GISH 1CR9H 2ICWI 1NCTA 1JMZA 3K80A 2JJSA 2FGWL 1F6LL 1QSED 5FA4A 4EI5C 1E4KA 3U2SA 3LS4H 4XWGH 5FB8A 4G42A 5TE4H 3OXRB 5F72S 4K3JH 2H2PC 2R29H 5ANMA 2H2PD 2NTFB 3BH8B 4G8EA 2Y5TB 3UTTD 5JW4R 4CN1A 3PJSA 1K6QH 2XOTA 4OGZA 4LP4A 4OZIB 1NMCB 2CXGA 2VISB 3CVIH 5I2IB 4NM4L 1R3IL 2NY5L 2WWMC 3ZYJA 2A77H 5E99H 5FDYA 4YHZL 4QRTB 4Y5YB 3QWRD 2HG5A 4NCDA 5IR1A 4U3CA 3EYSL 4PUBL 4G6ML 4BQCA 4S2SA 3FO9B 4UQ2A 3LRSA 5E8EB 2HFFA 2CDEB 4OB5L 3EZ8A 3MR9B 5DQDL 1I8IB 4ELKB 4YHIB 4YAQB 1MIMH 4WFGD 1WC7A 4IOIB 4RISH 5KSAB 3T2NL 4M61B 3EOTL 5GGSA 4XMLH 4P46D 1FFOA 3G5VA 4G43A 3VXQB 4P49A 3O4OC 2R8SL 1YQVH 1DSFL 2IQAA 1G6RL 5GGVY 2Q7YB 4WEBL 2LVEA 2ZKHH 2EDLA 2HKFH 5E00B 5HPOA 4F7EB 1FVEB 5J12B 3QCVL 3QWQB 5FXCH 4LDLB 4P3DB 3ULVC 3SE8L 3ULSA 4GOSA 3MJ9A 5EFIB 2XWBA 3ULVD 3FRUA 2G2RB 4KUCD 4LNRA 5IM7B 3F5WA 3O4LE 3WN5A 4X80H 1BFOA 4YIQA 3MLWL 4XVUC 5A2FA 2FRGP 4EN3D 1WWBX 3KDMB 5CJ8A 2C9AA 2P43B 2MJWA 2I25N 4MX7B 5ELIA 1Q9KA 1WWWX 2VQTA 3PL6A 4NIKB 2E7BA 5KOMC 3W11C 2ERJC 4P5MA 1G0YR 2I07B 1BLNA 1PG7W 1URLA 3HE6A 4PGEB 1QSZA 4HC1H 4G9FB 2R2HB 3Q5YA 1R3HB 5DJCA 2MHAA 4M7KH 4LCIL 1P4IH 2HAZA 4JHAH 3EOBA 3MJ8B 4BYHA 3BPLC 5E5RB 1V7ML 4LCWB 3BIKB 3QDMB 4W81A 5HGHA 4XP9L 1A02N 4O51B 3MV7D 5E56A 3LB6D 3EIFA 2DQCL 3CC5A 3FB7B 3RVTD 4PJGF 7FABH 2D31A 2Y72A 2PYEB 1RULH 3CUPB 1ETZA 3U9UB 3PP3K 1F13A 1E4WH 4AEHL 2AXGB 3UBXG 3D18A 3QG6A 5F8QC 1F97A 3TBWA 2V2TA 2JB6B 5I6XB 3ZHLA 3L5IA 1HHKA 1CVRA 1KXQE 3SE3A 3CMOH 1HH9B 4X9FA 3VXNB 4JRXA 4Z7WB 4WWKC 4CRPA 5ICYB 4JVUA 2BNRE 3L7FB 5AD0A 3RIFK 5D71L 2AJZB 5IGXH 2HLFD 5EOCL 5ITBH 1NCCH 1KCLA 1NGZB 1WICA 3LD8C 2EDJA 2X1QA 5IVXA 5MEQB 3BQUB 3OAZH 1AIFA 4J7RA 1WFNA 1QSFE 3MNZA 5KW9H 3MLRL 4HPOL 1OGAA 5DHYB 5D2NE 5IKCA 3AMKA 4F7TB 4JFHE 5E03A 4PRNB 3MUZ1 5DHVA 5E2VL 3D3VD 5EO9A 3MRGB 4XXDB 2X4OA 4ODTH 3C9NA 4X7TA 5HHOA 2XWJB 4LLWA 4R7NB 4I77L 3OG6B 5KS9A 2QHRH 2I9TA 3FCTA 1Z9OA 1JL8A 2VYRE 5GIRB 2K9UA 3ARTA 4N9GB 5KZCD 5EBWB 1HOCA 3C5ZA 5GJSL 1AD9B 1F90L 2RBLA 2NW3B 4NFCA 4HIHB 2BOBB 4NPYB 5I66B 1QEWA 2EDXA 1I7UB 3U7WL 5DYOB 3S35L 4HKBB 5DJXA 1K5NB 3HPLB 4JB9H 4JVPA 4P5TB 1JK8B 5C9JB 2IPUK 2VXQL 2AGJL 4JZOA 3BP7A 2VXSH 1FL5B 4JRYD 1U58A 2HFEB 5HHPA 2VLRA 1LEKB 2C4FT 3D69B 5D9SA 2FATL 2OZ4H 3ZKSD 3CCHA 5FUZH 1LMKA 4OF8A 2GTZB 3UMTA 4M3KB 1RK1B 4KXZI 1PFCA 4KH2A 4UU9B 2Q8AH 1YMMD 1XIWB 4MZ2A 3WFEH 1RZ8A 5EUOF 4JO3H 1SMAA 4MDJB 1TVDA 4GXUM 4FABL 4ZS6C 1TDQA 1X5YA 1PYWB 1E27A 3FZUD 4GRLA 4MNHB 3EDKA 2GK0B 4RRPA 5KANI 4Q97A 3FO2B 4QHLB 1QSVA 1SEBB 4MNQE 4ZOBA 1KLGB 4JO1L 1U3HD 4RFOH 3TBSB 4XNMB 4ALAL 1D9KD 2OTWB 1U8QB 3I9GH 4JFEB 4KV5E 5AAMA 5HYSB 3BMVA 3OGCB 1KENH 4YNYA 3X11B 1CD1A 1BJ1H 2Q86A 1N64L 1QA9A 5DA4A 4TYUA 3OR7B 5MEND 4PJHF 4Z8FH 5I1HH 4J2XA 5TDNA 2JJTC 4YXKH 3LPWA 3TA3A 4GQ9H 4PY7A 1W8NA 1F58L 1CGVA 3EO1A 1JI2A 3MCKA 4NO5B 5H37H 3JZ7A 3B6SA 3VFNB 1EEZA 4NHUA 4NQDE 5TE7L 2D2OA 3KXFB 2CO7B 3QXDA 5EU5B 3V4PL 5BRZB 1YDPB 4HWBA 1INQB 4CDGC 1IJ9A 1R3JB 3N85L 1RUPH 3MRMA 4AY0A 1T5XB 2Q8BL 1ONQB 2F5BL 3U36A 5HDQL 3GSUA 3BRGC 1T3FB 3O6MH 3GBLA 2PTVA 1RVFH 4HWEH 4W4OC 1X6LA 3TCLA 1JNJA 5EU3A 4N0UB 4NKMB 4X8XA 3QFJD 4IM8A 3SDXB 2OL3A 4LGRB 1J0HA 3EDDA 3HI1B 3BPCB 1IEBB 3JTSB 3H9SA 5IFHL 3BT2L 1YECH 2VH5H 1EMTL 2CK0H 5F3BA 5IFJA 2NY0C 3EOYG 2OYPA 4NRXA 2NY0D 1A1OB 4MA3B 5GQBA 3AGVA 8FABA 4XRCA 1N0XH 5E08L 4X5XB 2ICWJ 4PJCF 2XXMB 5DUPH 1A2YA 1A7PL 4JO4L 4F9LA 2CIKA 5TPWL 3PHQA 3S36H 2VDOH 2ADFH 2A83B 1L7TH 3WNNA 3G6DH 4AL8L 1I7ZB 2FX7H 1NCUA 3GGWB 3D39A 1OAZH 5E94B 2ORBH 1S7VA 2XTJD 5C6PB 5TGBA 4M62H 3LMJH 5SWSD 3DJ9A 3MLZL 4X6DA 2WUBH 3LPFA 1CT8B 1OQOA 2IBZX 4N0RA 1WTLA 4GJTB 1UWGH 4UV7H 3WKNA 1S7RB 1UB5B 2F53A 3MRNB 4HKJA 4OIIH 4PRBA 4QXTB 35C8L 5F7KC 3KNBB 4O5LH 2YXFA 5ACZB 1CDCA 4D9LL 4JM2D 1D5IH 4RAHA 1MCOH 1KN2H 4K8RD 5DD0L 1IM9B 4NM8H 3GSQA 1B4JL 5IVOA 3IGAB 3TN0C 3BESR 2ZOLA 3W39A 1J05A 3OZ9L 4OM1H 3K8LA 3CU1A 4N0FA 1A6WL 3CZFA 5SWZA 3JWDC 2XZAL 4ELMB 3QPXL 3G5YB 2EE6A 2HJLA 2NX5D 4HFUH 4I3RH 5EO0B 4QRRD 2IH3B 3UBXA 4I0PD 3RDTD 1XF4A 3VD7A 4B50A 1T1XB 3RNQA 5HVHB 3VI4E 4M6AA 2HH0L 2F5AL 4XNXH 5EOQH 1OD9A 4AQ1B 4EXKA 3KPSB 4XCYA 4UT9H 3RWDA 3V6OA 3TVMA 5HXMA 3AS2A 4WFHD 2VR9A 2B39A 4YDKL 1M7XA 3OF6D 1I8MB 1FNAA 1XGRB 5JZ7C 3ARRA 1A6ZB 2DQJH 2ATPB 5JZ7D 3X3FL 3V9FA 2PTTA 4NQCD 4DN4H 5FYLL 3RNKA 4KPHL 2C4XA 1VFBB 1ZWIB 2HT3C 2ZNXA 4UNUA 3CFEB 4Z0XA 2ZWLT 1KTKE 1CFBA 1UC6A 2AQ3A 4JFFA 5L88H 1UWXK 4GS7C 3U0WL 4Z77A 1F11B 4R96B 1HYRC 3QULB 4TPRH 2EEAA 3CFJB 4JHBA 3ZE2F 4ZXBB 5CZVH 3VD4A 4I9WD 1N59A 3UXFA 5BOPA 3AROA 1IGCH 3BEWB 3MRIA 4GBXA 1S9WB 1QYGL 1YNLL 3TV3L 4GUPB 3RL2B 3SHSA 4LRIC 2P8MA 1MY7A 1F42A 4HJJL 1VENA 5IEKB 2FBJH 1GGBL 4UTBH 1UWEL 4X7DC 4XC3L 5KTEH 4MXWL 3MRHA 5CLWA 4YFDB 3Q6FA 3THMH 1P2CB 4LF3A 1RIHH 4X9HA 4UTAL 4OM0L 3HE7C 4Z5RA 2R4RH 2CKBA 4HJGB 3TEUA 2X2YA 3HE7D 4QRPA 3LKOA 1J86A 3ARGC 1OOAA 4P2YA 2Z35A 4GRMB 3A6OA 1SQ2N 3TPKA 1JRHL 3FQWB 3KPMA 2X4NB 5IOPA 3KYMA 1II4E 2Z91A 2XV6B 4Q74A 2FEDC 3IDIA 3T04D 2C7UB 1FNSL 2DMKA 2FEDD 5J13C 3EDFA 2YD4A 1CFSB 4OGYH 2Z31B 1Z3GH 5DWUH 4R9HA 1ZOXA 2HLAB 2FJHB 4WO4A 3TFKD 4OV6F 3VMNA 1KLFA 3I3EA 3TYFA 5IW1A 2Z92B 2ZCHH 4XI5D 3W5NA 4YHML 1GVIA 5GGTL 1G0DA 2QQLL 4I18B 1MCDA 1S9VB 4TOYH 4PJ5D 3PGCB 4NUJA 2YXMA 4YR6B 3W0WD 4M1GH 4Y16D 1FE8H 3GSVB 5C09B 4L8SB 1NCBL 4JPKH 3MLTB 1YYLL 2H1PL 1MWAL 4PTTB 2X4UB 2ZSWB 2EEBA 3OKKB 4IDLA 2W0KA 5HYSG 3QI9A 4IRJB 5GS1C 43CAA 4ZFOL 4TTGA 3HC4H 4NSKB 5H2BA 1EUTA 3FFCA 3LEYL 5C0JA 5BQ7A 5F3HA 4X4XB 4TVPD 2HN7A 5DMKB 4F9PA 3E8UL 4L4VE 4E41A 5L2KE 2UWEF 1CBVL 4I8DA 5CLTA 4YBLB 5JHDD 1ZHLA 4UAOC 3TT3L 4XNUH 5CJOH 1SEQL 1I3RA 1MCBA 1Y18A 2BC4B 3QZWB 2RR3A 3TJHC 4KUZL 3P4OA 4OCRL 4Y1AB 5JR1H 1KCKA 4PG9B 4KRNA 3ZE1E 1FDLL 2H2SD 2YD1A 5TFSL 1ED3A 1J0JA 2JF1A 4I2XE 3BJ91 3PQYD 4TTDD 3V8OA 1MIEH 3J8F7 5D5MB 1M05B 4NGHL 3QJFA 5GHWH 1KG0B 4F33A 3EFFA 1FAKT 4OLUL 1EVTC 4LQFH 4GG6B 4P59L 3V0WH 5A16B 3SQOH 2PR4H 3ULVF 1G6RB 5I1IL 3LV3A 2P7TB 3MGTA 5FKPB 3WD5H 3V6FB 3X13A 4KUCF 1S5IH 1JGDB 4YHLH 4WV1C 4WUUE 1G7PA 3V6BR 3QAZC 3TO4D 2OM5A 1MFBH 4X98A 4ONFH 5D1XB 5IF0B 4HIJA 1Q72L 2VITA 3VRLE 5T3ZL 4R4ND 1BF2A 5CGTA 3CH8A 1OTUD 2YD3A 4Y4HA 3RGVB 5ACMA 2D0FA 2A6IB 1X4YA 3BIBX 3TNMB 2YA1A 3GHBH 4BH7A 4NUGL 3NABH 3F65A 1S7XB 3CX2A 3W81A 1EK3A 2AXFA 1CGYA 4NDMA 4E5XA 4ENEC 1EX0A 4DVRL 1W0WB 3VMOA 1GAFH 4ZTOL 1EHNA 1JNLL 4PRAB 5DQ9A 1JWMA 5FOBA 1LK2A 3SQBA 1OD7A 3IJSB 5DK0A 1V3MA 3TF7C 1O0VA 5MERB 3S36X 4H1LB 3T4YA 4ODXB 4OZ4B 4K9EH 1X44A 4MQXC 1QFWH 1JZ5A 3MRQA 3QXAA 5JOEA 4OZHA 1FVCA 1I9EA 1IGJB 4HUVA 2VZOA 4QYOA 3JWDH 1NAMB 3O11A 2FGZA 4H0GA 1VGKB 2EIBA 1XCTB 2X1XR 3UTSB 4KGJA 5T1LD 2HMID 3JXAA 3MNWB 1NLDH 1SMOA 3BGAA 1ZEAL 3VFGH 3P9LB 5CEZD 4JZJB 4PRPB 1E28B 1UFUA 2D9CA 2DRUA 1AP2A 1GZQB 4JY6B 1J5OH 2XA3A 1GOFA 1DANT 1R6VA 2R0KH 3NCBB 2AKRB 4HUWB 5EN2B 3VD9A 1IKNA 2EC9U 2FEEL 5C6TL 1QFUL 4LSUL 1I1FA 2P5ED 3QWOA 1Q0YH 1AO7B 4R97B 5C0RH 1HI6A 4IMKC 1QRNE 5HYJA 4LLDA 1BHGA 4C59B 1IC7L 4U31A 3L3OA 2AV7A 3IXTA 4XP1L 3NBNA 2H8PA 4ZFFB 3LIZL 3BDBA 3UBXI 2XIDA 5TE6H 3B9EA 3UPAA 5K59E 2D9QB 3L3GA 4BUHA 3MLSL 3HN3A 1Z0MA 4OGXL 5AZ2L 3TO2B 1BP3B 1YC7A 4Z18A 5JOPE 2Y07L 5GJTL 1T80A 5GS2D 3SPVB 3WXVL 4R3SA 3PDGA 4FA8A 3DX6B 4NZRL 4XC1H 4HCRA 1MFAL 3LZFL 4C4KO 2ED8A 2VABA 1OB1A 1IAII 2YD9A 1LP9E 3QIUD 2ADGA 2FIKA 5D93C 5ILTH 4OUUA 5C0CB 3S37H 3E3QC 4JCLA 2VDPH 3IRPX 4H8WH 3VWJB 1WK0A 1SBBA 1DQJB 2GI7A 1B6UA 2LE9A 4UOJA 1VB9A 2N56A 4PS4L 2EO1A 3Q3GB 5DUBB 4CVXA 1RUQL 1OWWA 5D70H 3T08A 2KUTA 2PW2A 3BOVA 4S1RL 1R5VB 3GDBA 5LXGL 3L7EB 2Y1VA 4U1JA 4EVNA 5C0BA 1HIMH 1ZHBB 4XP6H 5DS8B 3B4NA 4LLQA 2AEIT 5C86A 3MV9D 4I3GA 3M8OL 1UZ8B 3DXAD 2YUWA 4JJ5A 2EDTA 3FB6B 4M8VA 4RGOL 4U1NB 3IAQA 2DI9A 4PRHD 1T04B 5CFHA 1CK0L 1A4JA 3CPLA 3H9HA 4X7SL 2Z4QA 5DEFB 3BRDA 2JJSC 1YJDL 5FYJH 2OTUB 4TNVF 2ITDA 5FO9A 1E4KC 1QBLL 3P2TA 3L3IB 2K7QA 1XH3A 2MQ0A 5H35A 2W65A 4Q2ZB 1V3KA 4RFEB 2EH8L 3H3PH 4YHOH 3GSNL 3SGKC 4KK5D 3ULVL 1L0QA 4NC0B 5T33H 3DGGA 1YPZA 4UIKH 1P7QB 2Y7QB 4KJYB 4AM0A 2R9HD 4EUPH 2FJGB 1E4XL 4HQQH 5DO2D 3ZKXB 2VDMH 4IRSD 4N0YH 3O4LA 3EOAA 1X5FA 5E9DE 4PP2A 5HHNB 3RTQA 4RGND 3DIFB 6FABH 4PJXF 3MRPB 3JV6A 1NC4D 1RU9H 2BCKA 3HRPA 4DOHB 3TWCL 4BSVB 2OMBA 1F4XH 1S78D 3IU4H 4LVNB 1YMHB 2JIXD 3DNKA 2BMKB 5HI3C 4ZOEA 3OTTA 3EYOA 1G9MH 1XF5B 4V1DA 3P77A 2HFGH 2BY3A 3RI5F 5FM8A 1N5AB 4Y88A 4OLWL 3I2CL 1DN0A 1WISA 2DTML 3RWEA 2FR4A 1EGJH 5ENWB 1IKFL 1D5BB 4LSQH 1BZ7B 3HKFA 1K3ZA 4F7MA 2WUCH 4BZYA 4G8GB 4JQIH 2EKSA 4MXQD 2R4SL 4L8DB 1PZ5B 4KRPD 4U6YA 3WN5C 1CLYL 3MV11 3DROA 3HG1E 3GBNL 4RGMC 3X12B 4PJEF 4Y19B 1WEJL 1CIDA 3VXRE 1EEYB 5LBSL 2XZCL 1OARH 4HS8H 3GMNA 3PL6C 4RNRA 1PAMA 2DQDL 3K0WA 3WJJA 4NNYA 2A2QT 3HE6C 1DUYB 5AWNH 4JFDA 1QPPA 1L6ZA 2X4TB 4WNQA 3UJTL 1U41A 3ALWA 3HE6D 3LY6A 5AUMA 3BZFB 5B39A 4OGAD 5FM4A 3LEVH 5CSZB 3O8XB 5CD5C 2DWDA 3LKRB 5IQ9A 4PJBB 4LCUA 3EJZD 4D0CB 1JPGB 3D2UA 4KTEH 4TULH 2GT9A 2DQEL 3HLAA 3SCMA 3PHOA 1NC2A 2IANA 5A2JH 1XGYL 1T22B 5C08B 1J9CT 2E6PA 2WINA 5DD3H 3H42L 2BZDA 2KH2B 2X4PB 3DX8B 1GYAA 3REWA 4O00A 3F58H 1IT9L 2BNQD 4ODVH 1HN1A 1T7VA 1MHEB 4DZ8B 2R0ZL 3F8UB 4J3WA 2V2XB 4QTHA 2PNDA 3OAUL 4X6EB 4JM2F 1YEKL 4FN0A 4R4FH 2R1YA 1HSBA 4QT5B 1QRKA 3RKPA 1EXUB 25C8L 2HYMA 3DVNB 2DYPA 1UM4L 4JEGB 3RZCB 4M5YL 1ZHKB 2O5ZH 4U1LA 1WT5A 4LVOB 4P2OC 4H20L 2C26A 2D4DA 5CIPA 5DDHA 2BVTA 4DKEL 5KAQF 1HKFA 2AI0L 2W9EL 4P2OD 2XQBH 3TBVB 2ATKA 4NC1E 3QQ9C 1L0XA 1N6QH 3ALXA 4HS3A 3BZEB 1OWRM 1I1AB 1UH4A 3SE3C 1OHQA 3DARA 5IEHB 4M6ML 1A8JH 2DAVA 4LCWE 2L7UA 1NJ9B 5T1DL 3QDME 2NY7L 1WIPA 1TQCB 4P9HH 5JLZB 3QA3A 4R0LB 5ICXA 5TDOB 3ARZA 4QLRA 4P3WA 5DJ2A 2X1PA 1MHPL 5F1NA 4N1CA 4D0DA 1IGFL 2E7CA 4S0SD 3UAJC 1KEGH 4K94L 4F15B 1LO5A 5KOVC 4PJ8B 3B3IA 2PYEE 1OGAD 5JO5B 1FVDB 1FIEA 2GSIA 1SBSH 1U8JA 5TJWK 1QR1A 4FXLA 1MCPH 4NNXB 4OFVA 3OKMA 5KN5A 5HHQA 3HC0B 3MZTA 1REIA 3TIDB 5BJTA 3QEUB 2QADC 4JANB 4YFLF 4HPYH 1KCUH 2XA8L 4HIEB 3C6LD 7CGTA 2CSPA 3TYGH 1DQQB 3QNXA 5JQ6H 1A6UH 3NTCH 3OWEA 1I7RB 3WXWL 4Q6IB 5HHMB 1RIVH 2DICA 3C5ZC 4O9HH 3S4SG 2DM2A 3U7AA 3IDMB 3T1FA 4HH8A 5GRJL 1HILB 2AEWA 2NW2A 2A6JA 4ZPVA 3GRWH 4MNQA 3SO3C 3E0GA 3AC0A 5DRWB 3V5KA 1AI1L 3T65A 4DW2H 3NIGF 1UZ6E 4HBCL 3GJEB 4OZFH 5B38B 4PV9A 3QT2A 3EKCA 2R2CA 2AJYL 3GK8L 1T1WB 4Z7NF 2I60L 5ERWA 1A4KB 4OQTA 3V95A 3L6FB 1FZJA 3FKUS 1B0GA 3Q0HA 5BVPL 4JG1L 2L7JA 3BSZH 2NQCA 4TUKH 2CO6B 4YDIL 1IGIH 3PWVB 3EGSB 3P4NB 1GC1L 3OAYK 1H5BB 3BGMA 3QUZD 4GRLC 2X1OA 3U79A 3T2PA 1UM6L 4NJ9L 2IPUG 4OCYH 3GSWB 5FIEA 3OJVC 2XN9B 3HC3L 2FHCA 3BKJH 2L4OA 5E8PB 1A3RL 1IL1A 4NN5C 1C5DA 4XAWL 4LK4A 3QUYC 3S37X 3TBYB 3QUXA 3QUYD 4U1GB 4IDJH 5I0ZA 5I76B 5B8CA 1X5GA 3LRHA 4LSSH 1K8DA 3TA3C 4LASH 1HWGB 1AJ7L 3V7MA 3C60B 3V4UL 2CLVA 3GSXB 3CDGA 4Y2DD 3RWFA 1S7WA 1NBYB 1KSRA 4X6FA 3PWPD 1MJUH 1N8ZB 4HUKB 2Y25A 4C56D 4XHJC 4F37F 3GI8L 1FZOA 3IYLW 3VG9B 2I9LA 4XHJD 1QSEE 1VADA 1ADQA 5DMGC 2BRRH 4LGSB 1JNNH 1BMGA 1MFDL 1MWAB 2ARJA 4LAJH 1CG9B 4MAYA 4AIOA 5B3JE 2DQUH 3SDCA 1NCWH 4XWOC 4O02L 1SJEA 1DBBH 1R5IB 4NQXA 5HGAA 1D5MB 2CLRB 4FMFA 4ZAKB 5FUCE 2QSCH 4JFEE 5KVGL 1KTLA 3SDAB 1HHIB 2EZ0D 1G1CA 4ZTPH 4C55A 4I48B 4UT6L 4RSVA 4LIQL 1MCNA 4HXAL 4Y4KD 4LPTA 4FQXC 4HGWB 2GITA 5EU6B 3FOMB 2FBOJ 5E6IB 1OAUL 4O2CB 4FQXD 4K8RL 4NNPL 3SGDI 3VXPB 1XGQB 4OJFH 3GSOA 4PJ7A 1RZIB 3BP4B 4UOW0 2WBJA 4WFGE 4MJ6A 1WIOA 1HHHA 3C2AH 3N1FC 1KIRB 4PLJC 4JN1L 2EIZA 5BRZE 4ORGB 1P4LB 2UZYB 2YUVA 1JPSH 3T4AA 1KTDB 2OI9C 4MXVF 4WW1A 1I8KB 3PXHA 2UUDH 3QR2A 3I6GB 3HUJB 3LQAH 3HR5B 2O93L 2FL5B 1Q0XH 1UEYA 5E8NA 2LTQC 1W0YT 4WY7L 3INUH 4N0UE 3SKMA 3SDXE 3LH2L 1AKJA 1AHWA 4JZNA 4Y4FB 5GSRA 4YXHL 3G6JF 2BXYA 3MUGA 5I18H 5I71B 3VXUA 4GAJL 4JFYB 3BX7C 1A5FH 1CFTB 1FNFA 4G8FB 2FX8H 1JWSA 3B9KA 3JV5A 1OW0A 3HS0B 2R69L 4PJ9D 4Q9RH 1IC5L 4LEXH 2F53D 3RU8H 4PTUA 4X9BA 2EDHA 3AFLA 3WHE0 4R8WL 1FV1A 1CDHA 1UG9A 3IKKA 1RMFH 1RUAL 1OAYL 1GCFA 3HI6H 3BKYH 3NA9L 5BXFB 2ZP0T 3L3HB 5IMKA 2I24N 4HDIA 4JY5L 5LAXB 5C1MB 2LABA 1JYXA 5MEOB 1IFHL 3GO1H 2C1PB 5F7UA 3QEQB 3QISA 4KTYA 1Y6MR 1Q1JL 5HY9B 3MJ7B 1OAQH 1HH6A 1UGNA 2YSSA 1AQDA 3Q6GH 3VFOA 4AENB 4HULB 1INDH 4UIMA 1OM3L 3KPNA 5ESQB 1BAFL 3DTXA 4YDLB 1WZKA 5KVMC 4FS0A 5IG7A 1MLBB 4HIXH 3S98A 2VSCA 1ZTXL 1BBDH 1FO0B 4LCCB 3CVHB 3BH9A 5GZOC 1DDHB 1G7HA 3OKEB 1U95B 2HFTA 1PZUB 1U36A 2D7QA 4WJ5A 2IFGA 5F1OB 4M1DL 3RUGA 1YY8B 3V6OC 3KYOA 4Z76B 3IDYC 3PF2A 4JY4A 2XT1B 5IBTL 5CBAB 1ULVA 3PDDA 2EYSB 3C09C 1LO0H 2W9LA 3K2MC 3C5JA 1AGEB 2W9DH 5ID1A 2FB4H 1JZ6A 1BF8A 4HXBH 1ZSDA 5DHVH 4RMVA 4DKFH 3SGEH 5F88B 3VFRB 1HQ4A 5LWYL 1UT9A 4NN7B 1NQBA 4BSWA 5HGBB 3BPNB 3O9WC 4HUUB 4YH6A 3OJDA 1NFIA 3B5TA 3O6LL 3RPKA 3O9WD 4JFFD 5FDWA 4NO2B 3MUJA 4X4YB 1Y6KR 2LFGA 1R0AL 3GBML 4Y8DC 2IPKB 5E2UL 4WHTA 1Z0NA 1CXHA 1W0VB 4G6FD 1JGUH 3KPRE 4XPHH 1G7JB 1Z9LA 3KPSE 2GAZA 3S4SA 2AJSL 5DSCB 3VFTA 4R4BB 2MKLC 4JQXA 3K4ZA 4Z95L 3ZDZE 3QG7H 4LCYB 4G7VL 1XR8B 2HT4D 3O45A 3D3VE 2R1XB 4QTIH 3EBAA 4JAMB 3CD4A 2YR3A 4YO0A 4AEIH 3HAEB 3VH8A 1GJIA 1MH5A 2XNAB 2OP4L 5D2LF 3RKDC 2M2DA 4FQIL 4EI5B 4UBDC 3ZSTA 2RAMA 3RKDD 4KGLA 5DR5H 1ZT4B 4TVPL 1F5WA 4DTGH 4F37K 1F3JA 1KCSH 1RFDH 3GSRA 4JQVA 2X9YA 5B38G 1ZANL 2JCCF 1G7QB 2DQHL 1BBJA 3TT1L 4PRID 4PGDB 5SWQA 4OFYD 1HKLH 3TZVA 4L4VA 3ZYOA 2EXYD 3O2WL 2YKLL 5INCB 4WO4C 4YHKL 4MLSA 3OB0K 3WUWA 3MLVH 3LN9A 1EBPA 1IQWL 4WDIA 3EJYD 4C83B 1AGFB 3ES6B 1LEIB 1RURH 2AEQH 4NO3A 3QCUL 4X6CF 4FTVD 2FLRT 3UZVB 2R56H 4ZS7L 1ACYH 1CLZH 3FONB 2X89D 3VXTA 2CRYA 4L3CA 5L8KB 1AR2A 5FYKH 4U6HA 1NGXA 3N1MC 1EA9C 1PJ9A 3UEZA 1YY9D 4JE4B 1CL7L 3DPBA 5F1SA 4HWBH 5DI8B 3MXWH 1EJOH 3UJIL 3GSNB 5CSGA 2G75B 4WUUA 4A2LA 4F9PC 5KVDH 2V17H 2KZWA 5D6DA 1FZMB 4JG0H 5F9OL 4M48L 5HHVH 5F93C 2PO6D 3D85D 1N2RA 3WFDL 4PYHA 2DTSA 2OL3H 1C5CL 4KQ3H 2FECI 3QXWA 4YLQT 3CX5J 1NCDL 4JFPB 2YPLB 2DQTH 1VFMA 2ERJB 1BQLL 2EC8A 3W2DH 1VACA 2A73A 4JN2A 3V52L 1OAXH 4ISVA 3ARFD 3PV7A 4EZMA 4GG8B 5C09E 4ZUSA 1ZLWH 2ESVD 4MD5B 3HZYA 2W0FB 4OSUH 3QNZB 4CJ1A 3GMMA 1HDMB 2FSEB 3FN0L 3UZEA 1VKXB 5T3XH 5IHUL 4XCNB 1H15B 3ZMRA 4BQBA 1DLHB 3GMOA 3BHBA 4X8JB 4P4RB 4L3EB 3QFJE 1B0WA 4LHUD 5CCKH 4OIBA 1FRGL 1FIGH 5HDBE 5JORB 5CEZL 2XY2A 3QDGD 3RWCB 4XB8A 5FHAL 4Y4HC 4HUXB 3GMLB 1A14L 4Z7UB 4Y1AE 4GW1B 1DQDH 3EYFB 3ZLQC 3RVWC 3H7BB 4ZUTA 3KYNB 4PJGA 3MOAH 1ZA6B 4RZCB 1G7IB 4ODSL 2AK4D 3MRCB 2J8UB 4LRNL 4LQ1A 5TQ2L 4PY8I 2VIRA 4FRWA 1WBXA 2XZQH 4ONOA 5L7XH 4DGVL 2FHFA 4LAQL 5E2WH 3G9VA 2GFBA 5F6IC 5HJ3A 4GG6E 3K8KA 5EBMB 4P2RA 1JFQL 1DBJL 2FH6A 1DVFA 2DIAA 1WAAE 3A0OA 3MA7B 3VXSA 4WWKB 3V0AC 4UINH 1X4ZA 3VI3E 4ZDHA 1YEGL 3L3JA 4B41A 2AJUH 5BOZG 1A7QL 3LD8B 4Z0BH 3MRFA 1SVZA 1VESA 4Y7MA 1UJ3C 1Z9SA 3V6ZA 3DGCR 1D3CA 1EFXA 4YC2C 3REVB 2P5WB 3PWUB 3BP6A 1IGMH 3IKCB 1JGEA 4NQUA 1N4XL 1MJ7H 1BD2D 5F7WC 1IKNC 2OJZL 4NT6A 5DLMH 4GQPH 4LLAA 1C1EH 4ETQA 3U9PL 3FO0H 5DJ0A 5M7QA 1P1ZA 2FWOB 4I5BA 4FHBD 4LU5H 5E5MA 5ACLA 3HNSL 1FC1A 5IMMA 1O7VA 4M7JL 1U93A 1FNEA 4DGIH 4RDQF 1IAIH 3ZDYE 1TITA 2IGFH 3JWOH 4WHYG 4MWFA 3LKSB 1T03H 4KZDL 2HRPL 2VLJB 2B0SH 2VXTL 2VXUH 4FQCH 1AFVL 2NXZC 2NX5E 1P84J 2AVGA 3DV6B 1UQSA 1GPOH 3L9RB 3SDDC 1CR9L 4R26H 2DF3A 4APQB 5EUKB 1W72L 2GQHA 5EU7E 4PG2C 1PLGH 3SDDD 3K2UL 4XWGL 1C16A 5I1EH 3UO1L 1PY4A 4M4PA 4NQED 3O3BA 2R29L 1KELL 5FCUH 1DQLL 4PRPE 3D9AL 5TF1H 1K6QL 1KGCD 1TVHA 4U0QB 2CDFA 3MRRA 1JWUB 1W8OA 5K9KA 3G6AA 1M7DA 5CHNB 5EZJA 4KVNH 1AO7E 5E99L 1IZKA 4ODWA 3A6CH 4Q7DA 5I75C 3PXJA 2X70A 3ILPA 4ZYKB 1MRDL 4NQSB 5KSVA 3F12B 2FD6H 3NZ8A 3ECBB 1J1PL 3TIEA 1P7KB 3HHRB 5EUOA 4WI5A 1J12A 1OTSD 1MIML 3BKML 4PREB 3MZGB 2HJKA 5C0FA 4I9WE 4M5ZH 1QNZH 2DQFA 3WIIL 3BVNA 5FGSA 2OJEA 1DL7L 1GSMA 4OD3H 5MENB 1YUHA 3KPTA 3IJYB 3HAEG 5GRUH 5E9DA 3MV8B 5C8JB 3ULUE 5I73C 4R2GB 5B4MC 2ZKHL 3MGOB 3ZT7A 4HWUA 3WFCL 2AJ3A 1TJGL 5DTFB 3HRZA 5B4MD 5LCVL 1K4DA 1I9JH 4KMTH 1HYSC 1M4KA 3MODH 1I3GL 5IJVB 4PJHA 3SJVB 1NFKA 2APTA 3BD3A 2D7NA 2VQ1B 1WWAX 1HWHB 5JXAH 2J1KA 5J11C 3IU3B 4AT6B 1JTPA 4X80L 2WP3T 3SN6N 5CILH 2NY2C 1IARB 2VXVL 3CGTA 1ZGLA 3FFDB 3V5DB 2F54B 4G9DA 1INEL 1KT2B 4GT7A 3FL7A 3UTZA 3L1OH 1LE5B 5H37G 3JV4B 1IEAA 5IIEB 2X44D 5IVNA 3RHWF 5KSUA 1F3RB 3KVQA 4FQ2H 2YPVH 3BKCH 4D8PA 1MHHA 3VCLA 3HG1A 4M7KL 4QXGL 3RTQC 5BVJB 5EIIB 4IJ3C 4JHAL 3CSYB 5F44A 3VFMA 1A9BA 3VXRA 5D1ZC 1D5XB 1KULA 3IFOB 1Q9OA 3GEWB 5DVOA 3UCRA 3MRJA 5BS0E 5D1ZD 1NH6A 4CKVX 1A7OH 3D48R 3VXMA 1DBKH 4TSBH 1S8DB 3C6SA 1FBIH 4YAQA 4UV4H 3CFBA 1S3KL 4Y5VA 4LLYB 3N9GL 1LK3H 4FG6C 3W0WE 1I7TA 3SGJA 2B20A 1G7LA 4PJCA 1HSAA 3E2HC 4O2FA 2PXYA 3O3AA 2YMXL 2DL9A 2I5YL 4DFHA 5GS0C 3SE9H 5I16B 4JDZA 5FF6B 3CIQA 2ITCB 3UYOD 4NYLA 5I30H 3NZHH 4RAVA 4MA8L 4J6RL 3PE9A 3ARVA 1BGXH 1V8HA 2H9GA 4JKKA 4BUGA 4WHCA 4ZFOA 1E4WL 4M8QA 4OFKA 2AABL 5EU4B 1X6NA 4LVHC 3EYVA 3ZHKA 5BV7C 1JZ8A 2WAHA 2X6MA 5EPMB 5D8JH 3EW3B 5ALCH 3WJJC 3B2UC 1MF2H 5I1CL 3CMOL 4X5LA 3WBDA 4K2UH 4DOHE 3LS5L 4JR9L 5FV1L 3U4BH 3K1DA 5DD5L 4EI6B 5JTWA 4P3CH 1WBZA 3U7YL 1CE6B 5JW5A 4R7DA 3ARBC 5I15H 1TZIA 2YN5A 3WNKA 3G5XB 1JHTB 3NACL 1IGTB 3TN0B 4NBXB 2VDQH 3ARBD 4GLRI 3SCMC 5B3NA 1FFPB 5MI0B 2JK5B 2LAAA 3IDXL 1NMAH 4HWZB 1FYTA 3QIWA 3DRTB 1OPGH 4NBYB 4MXVE 1MFCL 5EB9A 3P4MA 5FHBL 2QSQA 4XVTH 2ED7A 2BNRD 4G8GE 1T0NB 2ENSA 2JELH 1IM3A 5EC1A 1P5UA 4J3UA 2VLKB 1E6JL 2G60L 4R90L 5EBLB 1MEXL 5ICZA 1RJCA 2Q20A 4Y19E 4LLMB 3RL1B 2HTLC 4Y5XA 1QSFD 4RWYL 1NFDF 5D2NC 3OKNA 4A2MA 4XBPB 5LGJB 2UVFA 3ARDA 5DQJB 5BCAA 1MCCA 3SEPA 4JFHD 3D25B 3RZWA 1QFPA 1AR1C 2AEPL 1WT5C 2UV3A 3DX7B 3O41B 4UZGA 1U8PA 1RQ5A 4M7LH 4WW2C 4UUJA 1QHOA 2MFNA 4PJBE 4WTZG 4XBGA 4XCEB 3MNVB 4JKPL 1T0MB 4J23A 3CDFA 2Q6WA 5I19H 3GIZL 1HQRA 5C08E 1T89A 2VXSL 2OMNA 3VXNA 4CADA 4IMLB 1MRFH 5LG1A 1XFPA 1MREH 5ICYA 4J1UA 5KSBB 4LMQE 4HLZG 1SHMA 1VGEL 3PWNB 4GAYA 3WFBL 3QFDA 1YEJL 4JVWA 3GMPA 2P1YA 1F45A 2NXYB 1J7VR 1S9YB 5L0QC 3BO8B 1MRCL 2Q8AL 1UM5L 1HK6A 1PQZB 3DVFA 1NCNA 4O4YL 4GKSB 3KPLA 4L4TB 4TRPL 3PGFL 3SOBH 4RBPH 1BOYA 3QUML 3U4EA 4PY8J 1CD9B 2FNBA 1LD9B 4QHMB 4ZMAT 1BVKA 5CSBA 2YUXA 2ICWB 5K9OA 4POZD 4OZGF 3I9GL 2IAMA 4HCRH 1I9IL 3H6JA 4QRUA 3WIHL 3ARGB 2D7TL 1TVBA 4GMTH 2QLVB 2BJML 1DE4B 1QKZH 2YPKB 4Z8FL 5EZOL 4PR5B 4QRQA 4XVSL 3BDYH 3VA2C 3WO3B 2PCPB 3BFOA 2NW3A 5SX5K 4HIHA 2BOBA 3VGDA 1NPUA 1BX2B 2ZPKH 3M1BA 4LPVA 4M00A 3W5MA 1T5WB 3MOBH 3QEHB 4U6VH 1K2DB 5CGYC 5IFAL 5J13B 1P53A 3ARSA 4WEMB 3CK0L 3BDXA 2B1AL 4MCYB 4KTDH 3K4AA 3NCJL 2VLLB 3NFSH 1BIHA 1CZ8H 3O6ML 4PJ5B 1MCQA 4KI5C 4HKZA 4LBEA 4NWUL 3DYOA 1TETH 3ARED 1CF8H 2VN7A 2PYFB 2R2EA 5IB5A 1X5XA 1NGPH 4HUNB 1DBMH 4NQDD 2Y06L 4X7FC 5DUML 1QSEA 3BAEH 1BQUA 3DMMD 2F74B 5HHME 2OBGA 4EUPB 1IGYA 3EO9H 5GS1B 5D1QD 1FGNH 1A1NB 3QO0B 3UTTA 1Z5LA 2DBLH 1M6OA 1BEYH 2A6DB 3QUXC 3QJHA 4PJFB 2VB5A 2AK1H 1L7TL 2JCCE 3FB8B 4W4NA 4DCQA 2GJ6B 3QWRA 1JV5B 4UAOB 1EHAA 2CLZB 3QDJB 5BZDA 3V7AG 3N1PC 4NP4L 2UWEA 5I1JL 1DR9A 3PGDA 2ZG2A 4NN6B 4PRHE 5D7LB 2VL5A 2CRIA 1YEEL 4ODHL 1KFAH 1EERB 4PGZA 5EO1A 3MMEB 4X6CE 4L5FL 4PFEA 2X41A 3DRQB 3DUSA 1J8HB 4P46A 4N0CD 5JOFB 4UV7L 5GGRY 5DRXB 1S9XA 4MAYC 4S10A 2XI9A 1YA5A 3BD4A 5TDPA 1YC8A 3SDCC 4NCC1 5DJYB 3UYPA 1R3LB 2BVPA 4HK3J 1YNTB 5EIVA 2XN9E 1OSZB 4JFXA 3P11H 5SX4I 1T66C 3PDOB 2D7OA 4TSAH 3UPCA 3VJ6B 1D5IL 1JRHI 5EOCJ 1ORQA 4NM8L 3EO0A 4LHJB 1KB5L 2YA2A 4AH2A 3DV4B 3QUKB 3L5XL 4EN3A 2M1KA 2NY5C 4OCWL 5D7KE 1ODAA 3X14B 2NY3C 5JNYB 5DVMA 4ZUWA 4PJAF 3TCXA 1DLFH 2WBJC 4ACPA 3BWAB 5C0IB 3ZL4L 4HMDA 4YHPB 3WLBA 2A83A 3E1F1 4HG4J 3GMQB 5FA3B 2MCPH 1UVQB 1FN4B 3QCTL 2VDRH 3HZKA 2EE9A 1KJ2H 2WSKA 4IS6B 2DBJA 3OHXA 5J6HA 3NFNB 3WL9A 1VEOA 4NZDA 3K1KC 4GRWB 3G5ZB 1CICA 5F96H 2AJXL 1T21B 2D03H 1JGVH 1IEHA 3DHMA 5E6ZA 1MFEH 3GUTB 1AHWC 1I1YA 1JPST 2EXWC 4KQ4H 3MV7A 2MPAL 5HHXL 2EXWD 2DQJL 1Q8MA 4PV8A 3B9KC 3SY0A 1ZMYA 3QHFH 1FCCA 1NGQL 2A74A 3MXVL 4L9LB 2OK0H 2R0LH 4OT1L 2XKNB 3P9MB 5KAQG 1GIGH 3DURB 5EZIH 5EC2A 3S96A 1H8NA 4FFVD 3KPQA 5DFTA 1YNKH 4X4ME 4CVWA 3QH3A 2DIBA 4KMQA 1DUZB 2QQNL 4AG4L 1MUJA 1SJHB 3M17A 3O6FB 3KHOA 5KJRH 3HUJE 1QLEH 5CIPH 5J1AA 2Z9TA 4OLEA 2X4QA 5GGUA 4DGYH 2E8YA 5KVEH 4JFQA 1GGIL 3L95A 1DBAL 3QIBD 3VFWA 4JDVA 4HV8A 4ODUB 5DMIL 4BZ1H 4WI7A 4A6YA 4PJDF 1PX4A 5T1KB 1JCKA 4NRZA 3KPRA 5E8DH 3R1GH 3EYUH 4Q58C 5DJAA 2Z93B 2G9HA 5FO7B 3V2AR 2CKBL 3D3VA 4HFWB 1B88A 2V2WA 1TZHB 4HF5L 1H3TA 1TJHH 3F6LA 5AYUL 3QHZH 4KKBD 5C0AE 5K9QI 2WNGA 1TPXC 1QFHA 2DMBA 3A67L 5C3LD 1E6OL 3P73B 4KZEL 4OFPA 5FUOH 2AQ1A 3QEQE 5I1LA 3RP1A 3PNWA 5EA0H 4OD2B 1F11A 1WF5A 4K23L 3QQ4A 2Y36L 4AK1A 3U6RB 3NVQA 4L9DA 4EDXA 4PJIB 1H3PL 3MV9B 5DK2B 4JPKL 3WSQH 2D0GA 3O3DA 3MTRA 4ZSOB 1PDKA 1FFNB 3QRGH 4FQLH 1NSNH 3P3YA 4KY1H 5IVZB 3DUUA 4JRYA 1RSFA 4YUEL 3HC4L 3MRBB 5CBEA 1ORSB 1JPFB 2YEZA 3RY6A 2VL4A 4MJIB 4OQTH 2ARJQ 4Q0XL 5GRVK 5FA4B 5HDLA 3U2SB 5FB8B 4G42B 1XCQA 1LO2H 1YMMA 1JZ2A 4MYWB 4XNUL 5ANMB 1ZLSH 2FEEI 2NCMA 2IEPA 4G8EB 1BZ9A 1FH5H 1P5VA 3PJSB 3SDYH 1MQKH 5JR1L 1JHKH 4DWHA 4YZFE 3MBED 5F7MC 5DC0A 1LQSR 1G9NL 1AXIB 2B2XL 3C87A 1U3HA 3HNVH 1MIEL 1D9KA 1FQ9C 2V5YA 2HG5B 5IR1B 5L2KD 5DD1H 3TJEH 4S2SB 4UQ2B 5F6HJ 3FQNA 5GGVH 3LRSB 4EDWH 2HFFB 3KWWA 4J3VA 3E6FA 3QEGH 3BWUC 4EUPG 2XXCB 1WC7B 2P24A 4P23D 2ZOKA 1ZK9A 1DJSA 4WI6A 4PJXA 5EORH 2DLGA 4QXUL 5GGSB 1FFOB 3G5VB 4G43B 4CDHA 1DP0A 4J3TA 2IQAB 1RJYB 3KJ4B 4L8BA 3Q2CA 4PLKD 1M7IA 2Z8VC 1GH7A 2NYYC 3GJFA 4HGMA 1D5ZA 3R8BB 2Y9RT 3ULSB 4X4XA 5DMKA 1FFRA 3QFJA 2XWBB 4WUUD 3FRUB 3VWKD 3CFKA 2ZSVA 4LNRB 2FGWH 5J57B 3F5WB 4O58L 3KPPA 4GSDL 5GXBB 3WN5B 2I27N 1BFOB 1ITCA 3QP3A 4YIQB 2GCYB 4RGMB 1C5BL 4IRZH 2VUOA 1LO3H 3WFHA 3QZWA 1Q9KB 3PL6B 1ZT1A 4P5MB 4EOWL 3LKQA 3IFNL 1BLNB 5FGRA 4PJEA 1Q94A 1SY6A 1YEFH 5ABDE 4NM4H 1R3IH 2NY5H 1A6AA 4YHZH 5DJCB 5JW4N 2MHAB 3EYSH 3BI9X 4G6MH 1FPTL 3EOBB 4FQPA 2VKWA 3UPRA 4XX1G 5D96B 1PSKL 1JE6A 4HS6A 4HAFA 3NMEA 4OB5H 1HNGA 5DQDH 4XCFL 1XR9A 3VFGL 5HGHB 1TXKA 1U92A 5SWSA 3C08H 5DVNA 3T8XA 1KCVH 3OQ3B 3PIQA 2Y23A 1BQHA 3FHQA 3CC5B 1G6RH 5CS7A 1D7FA 5CP3A 2ILLA 2E27H 3K8MA 2DJUA 2XFXA 4WEBH 2D31B 1A0QL 1E4XI 4EIGB 3QCVH 1ZLVK 2YPLE 2W59A 5H94B 1OP9A 1WBYA 3ZTJG 1J87A 3VGFA 1ETZB 4GMSL 3SE8H 4PB9L 1ZAGA 3OKLA 2ZUVA 4JM2A 5ISZD 3AAZA 4KRMB 3T0ED 3D18B 1W0WA 2Q7NA 3QG6B 3MLWH 1RZJC 3TBWB 3HPJA 1MCFA 3NA4A 4S1DC 2V2TB 3WDHA 1HHKB 1QRND 1DVFC 3A6BL 4X0KB 4FQHB 1EFQA 2YC1A 4JRXB 4N8VG 3VFUA 4L3EE 1JHLH 5HYFA 4MGXA 5AD0B 2NX5A 4HKXA 2VTFA 3CFDA 4I0PA 4LCIH 5IVXB 3RDTA 4LSRL 1AIFB 5FYJU 2C1OA 3MNZB 5C70A 5IMLA 5ILTL 2PKDA 3ALPA 4OLVH 4XPTL 1OGAB 5IKCB 3O6KL 1V7MH 2MKWA 2YK1L 1JF6A 4Z7UE 2DQGL 5C2BL 5JOPD 2F15A 4XP9H 3OJMB 3DO3A 1F8TL 3MRLA 5DHVB 1GZQA 3KS0J 3O2VL 3ROLA 1NAMH 4R6UA 5EO9B 3H2WA 1NFDE 3OF6A 4WW2F 4MB5A 3MLYL 2APFA 2X4OB 3Q5TA 2DQCH 3C9NB 4X7TB 5HHOB 2QADB 4LLWB 3W9EA 3SE4A 5KS9B 3AXLA 4NQCA 2I9TB 3FCTB 3PP3H 2NY6C 4RQQA 4U1KA 4CU6A 1CXFA 2NY6D 5J89A 1HOCB 3PABA 3C5ZB 1V7NL 4ONGL 4YBQC 1G0XA 1MI5D 1QEWB 4YBQD 4AEHH 3SO3B 1YEDA 5C7XL 4KC3B 2V9TA 3S34L 4YDVA 4GKZA 5DJXB 1RUKL 1RI8A 4MAUH 1FL6A 3KGRA 3QO1A 2NY4C 4BQ8A 5IHZA 3QQ3A 5IMOA 2CUIA 1C8PA 2NY4D 3HZMA 4KDWA 3KPOA 2QSTA 2CDGA 4JZOB 3BP7B 4N90E 4YHOL 1WFOA 2P5WE 4NZTH 2WZPD 3TH2T 1U58B 5HHPB 2VLRB 4X83A 2E9IA 2QBWA 2Y6SD 5D71H 5D9SB 2MTPA 5EOCH 3CCHB 3S5LA 2BDNL 4V2BA 1PD6A 5KANG 3CU7A 5JXED 5KG9A 2PW1A 4Z7VF 2G5BA 1L0YA 1TTGA 4F8TA 1RZ8B 4HPOH 2A1WL 3G9AB 3HE7A 3STZA 3CDYA 1QLRA 3B8SA 4NJAL 1E27B 4K3GA 3B2VL 4GRLB 3HZVA 3C8DA 4OZGE 5E2VH 1UH3A 1ZKAA 2H32A 4KV5F 4B7IA 5L8LB 4NN5B 3WNPA 4I77H 3WS6C 4Z78A 3O0RL 4YNYB 4M6OL 4XXCC 4FFYH 1CD1B 2Q86B 1QA9B 3WIFA 1VA9A 1MCWW 1OT1A 3FQXB 4K3HA 2J12B 4NRYA 5I1AB 1OLZA 5TDNB 3RVUC 4FMKA 5IQ7L 3TA3B 5GJSH 4PY7B 4WUKH 1LNUA 5BS0A 1F90H 5L9DL 3RVUD 4XAKE 5AG8A 3BN9D 4KJWC 1UACL 3N0PB 3EO1B 4YGVA 1CGUA 3MCKB 3B6SB 1EEZB 1T4KA 4NHUB 3U7WH 4NO0D 1QLFA 3S35H 3OPZL 1P9MA 3W0WA 1U0QA 3QXDB 4Y16A 1LGVA 3FT4A 1KJ3L 2B8OT 3S8WA 5GS0L 4LSTL 3ZHDA 3MRMB 4OD1L 4QY8A 2VXQH 2AGJH 3U36B 3GSUB 4NKOA 2ZCLL 4HBQA 3TCLB 2NMSA 4XNYL 5EU3B 1CDJA 4PRIE 1I9RL 2OL3B 1N5YH 1JN6A 5BV7L 3H9SB 5IFJB 3LEVL 3F7PC 4IHOA 1WQVT 4Y5YC 3EJJX 2JB5L 2J4WL 1QTYT 4NRXB 5JHDA 4Y2OA 4BM7A 3MV8E 3B43A 8FABB 4XRCB 3QB7C 4TULL 5FCSH 1P84K 1R24A 3GIVA 2NTSP 1A2YB 1FNLA 2CIKB 3PHQB 4Y5VC 4JO1H 4ALAH 3SGJC 3SJVE 1JVKA 3F7QA 5DHXB 3PQYA 5KSAD 2XYCA 1OAKL 2QQQA 4M9PA 2PXYC 3D39B 3MCG1 4FXKA 1S7VB 2F54E 5TGBB 4WGWB 1FAIL 2DM4A 3NN8A 1GHFH 1F58H 3D0LA 5CD3A 2VERN 3DI2B 1BPVA 4X6DB 5D7IF 4HIIA 1Q38A 5F7LB 4GLRH 1MCRA 1EV2E 2OTPA 3TO4A 4G8GA 4WV1A 4F8QA 4KJPD 3VRJA 1DEEA 5F7NC 3N85H 4D9RE 2Q8BH 5HDQH 1NDGA 2JJUA 2F53B 1GRWA 4HKJB 2GUOA 3G6JA 4NQVA 4PRBB 1AY1L 1LHZA 2W60A 3AMLA 3WLWC 1KPUA 2YD7A 1S7TB 4U7MA 1CVSC 4OCSL 2PTUA 2IH1A 1TTUA 1J1OL 5IFHH 2NY1C 3GSQB 4G9FD 4NC1C 1HEZA 2ZOLB 3W39B 1J05B 4MB3A 4H88L 4ERSL 3NPZB 1TCRA 3QIWC 3CZFB 4JCMA 5SWZB 1A7PH 4JO4H 3GKZA 4LCWD 2HJLB 2YD2A 3QDMD 1KYOJ 3UBXB 4BH8A 4AL8H 5CJBA 1XF4B 5DJZB 3RNQB 2WWKT 4LNVA 5CKAA 4HPYL 2NPLX 4JGJA 1A21A 1TTFA 4N5UA 3NCYS 2B4CH 4Y5XC 4NWTL 3ARDC 5T1LA 4XCYB 4N8VA 1PG7L 3RWDB 3MLZH 2PYED 2ICEA 4QXWA 3TVMB 1H3UA 3IDYB 1ACZA 3R06A 5JIKA 3RX7A 2XWTA 1CFQA 2PTTB 3CMGA 2IJ0C 3QDHA 1CN4A 3RNKB 3DSFL 2P5EA 3ELAT 4KROC 2V5RA 4Z0XB 3ESVF 5FK9A 35C8H 1T89C 3KG5A 4U7SA 4D9LH 3MC0A 4Z77B 1TIUA 4GAGL 4OCXH 5DD0H 4LKCA 2WMPA 3I75A 3I02A 1N59B 3MLXL 4YDJA 3OZ9H 3MRIB 3H8NA 4GBXB 2CUMA 1WUNT 1XF3A 3BQUD 4KMLB 5FECA 2P8MB 4M4RA 3T0AA 1A6WH 1KXTB 4PIRF 1QVOA 2X4RA 2O26U 3P40A 2R23A 3MRHB 2K3TA 5A2IH 1RHFA 5FAAA 1MNUL 3Q6FB 4LF3B 3QSKB 4YGAB 3DSNA 2B5IB 3FQTA 1A47A 1ZVHA 4Z5RB 2CKBB 2IAMC 3QIUA 2HH0H 2WP3O 2J6EH 4QRPB 1KV3A 3LKOB 2F5AH 5FOJA 2Z35B 4U1MA 3L3DA 1QBML 1WCBA 4LVEA 1N3NA 4YHYB 4YFLI 3KPMB 4HT1L 1YN6A 4G80A 5D2LA 5IOPB 4YDKH 2Z91B 4UDTA 5KSBE 3X3FH 5K33A 1MJUL 1GGCL 4KPHH 3KR3L 2JCCA 1UWXH 4HX1A 4WO4B 3IVKA 5CAYB 3DXAA 3TYFB 1JNNL 5IW1B 4P5TD 2EIDA 4L4TE 3RVXC 1N6UA 4UILL 3VGBA 1RV6X 3U1SL 3C2SA 1KNOA 3NFPA 2DQUL 3RVXD 1RY7B 1JF1A 1W72A 4PRHA 2GW5A 4NUJB 1DBBL 3WS3A 1ADQL 4XTRC 1RJLA 4X6CA 5I74C 1QYGH 1YNLH 4XTRD 3TV3H 2X05A 5ADOH 3HMWL 4WTXA 1WLHA 1XIWD 1RHHA 4HJJH 2MQ3A 1GGBH 3QI9B 4L8CA 1UWEH 2IF7A 4XC3H 4MXWH 1KIPA 2DI8A 1A9EA 2EICA 5H2BB 1T1ZA 3FFCB 3SGKA 5C0JB 5BQ7B 5F3HB 1ND0B 2HN7B 4UTAH 4OM0H 4E41B 1QR4A 1CWVA 1S7SA 3TBYA 1ZHLB 4JFED 1BIIA 4IRSA 4UB0H 5I1GH 5I8CA 4CW1A 4WU7A 1JPSL 1I3RB 3MCLL 4FQJL 1Y18B 3EFDH 1OCWL 3NCFB 5GRWA 3ZE1F 3ZKND 3P4OB 3IDNA 5FYJE 3OL2A 1YN7A 3FQRA 2EC9T 3IDUA 2AXJA 1NKOA 1NC4A 4AIXA 1FNSH 4MCZA 1ED3B 4PB0L 2AAVA 3UROR 4K55A 5D7JA 1FORL 5C07B 2JIXA 4JPIA 2IMMA 5I18L 3QJFB 3KXFD 4P46C 4F33B 1S7UB 3EFFB 5BRZD 1A5FL 3JTTA 4DAGL 3K81A 5FO8A 4YHMH 1YJDC 3LV3B 3FT2A 5GGTH 2QQLH 3X13B 3RU8L 4OLYL 3S35X 1G7PB 3ARYA 1NCAL 1BJMA 2AP2A 3VRLF 1NCBH 4P4KA 2JKXA 1MWAH 5IB4A 4PJFE 4X98B 5D6CA 4HIJB 5LGKA 2VITB 2GJ6E 1ROWA 1R5WA 3RVVD 2V7HA 2IC2A 3QDJE 4EN3C 4HGWA 4Y4HB 3UDWA 3GO1L 3TH4T 4HC1A 1KN4L 4BH7B 3IDJA 2NLJA 1A6TA 3E8UH 3IDGA 3LKNA 1CBVH 3S88L 2DWEA 4NDMB 4X4MA 4E5XB 5K9JL 1PKQA 5J6GA 3TT3H 1MJ8L 4YFEA 1J8HE 5DQ9B 1I3UA 1JWMB 5FOBB 1LK2B 3LSOA 4F58H 3SKOA 5DK0B 1BFSA 4KUZH 2DD8L 3HUJA 3MLUL 4OCRH 5F6IB 1CICC 3QXUA 3X3GH 1OTTD 3CXHJ 3T4YB 4EQ2A 1CICD 3O81A 5TFSH 1MJJA 4J4PD 4XPBL 1MHCA 5BO1H 3N1QC 1K8IA 3MRQB 3QXAB 1CL7I 4OZHB 1FVCB 4HHAA 4NGHH 5F9DC 3LB6C 5EIQA 1LO0L 5GRZA 5F7DA 4QYOB 4HUVB 2BNQA 2YRPA 3O11B 1JBJA 4OLUH 2EIEA 4DKFL 4P59H 4OUOA 3RVTC 1RUML 3MRDA 1RZKH 4YC2B 2UYLA 1AP2B 2VUYA 2Q76A 3MBXH 3MRKA 5GPRA 2XPGB 4OTXH 3MV01 1Q72H 1IM9D 1I1FB 5T3ZH 3EDEA 2P8PB 3QWOB 4P2OA 5C0AA 3T2QA 1HI6B 3MACL 4X9GA 4WRLA 2ZJSL 2V7NA 4QHNA 5HYJB 4LLDB 5ITFA 1R3KA 1O7SA 4NUGH 5K59F 3L3OB 2AV7B 3IXTB 5F21B 2H8PB 4OCMC 2V9QA 2NXZB 4LMQI 4DVRH 3T3PE 2HLFC 3L3GB 3DBXA 4ZTOH 1JNLH 1H0DA 4K71B 4XMKL 5FYKU 5E4IA 2J8HA 4YE4L 5JIIA 3ZTNL 3T77A 3WKML 3KPRD 2RQ8A 4R3SB 3KPSD 1X3DA 1X7QA 1LP9F 4YHNA 1FCGA 1FO0H 2X42A 3CVHH 5E2TL 4BSJA 2VABB 1OB1B 3C8HA 4WHYH 1GL4B 3BEVA 5EZLA 2ADGB 2FIKB 4EQ3A 4OUUB 3C6LA 3I6LD 5I17B 4JLRA 4WI3A 5I75B 3MLVL 4WIQA 2AEQL 4HG4K 3WO4C 4HGKC 2LU3A 4CVXB 1UB6A 1IAKA 4NO2A 2PW2B 5M94B 5E1AA 4M6NL 5JDJA 1QFUH 4LSUH 4EVNB 5D7SL 4TSCL 4ZXBD 5C0BB 4LLQB 4LSPL 3FHAA 3Q1SL 4JJ5B 4ONHA 2CKNA 5FM5O 4JFOA 1F4YL 1WITA 3HFML 1MCLA 2OZ4A 2GEEA 4OAWA 3OR6A 5I73B 1IC7H 3NH7L 4XP1H 3MXWL 1A4JB 1ES0A 1MCJA 3CPLB 4K94C 4DJMA 3H9HB 4TUOA 3RY6C 3ZT6A 2EDDA 2Z4QB 2W0LA 4JAMA 5HGDA 3MLSH 2ITDB 1KEML 4MHHG 3QUMA 4OGXH 5AZ2H 5F7HA 5FO9B 4UT7L 5HHVL 1XH3B 5H35B 2W65B 1ZLUK 5CMAA 2Y07H 5D72L 2K7PA 2NY2B 3E3QE 4OLXL 5GJTH 3WXVH 2WIIA 3FZUC 3QUZA 4Z7VE 3DGGB 1YPZB 1LE9A 3HAEH 5DT1L 4H26A 1MFAH 3LZFH 4U05A 3WIHA 4YEEA 4FFZL 5JPMA 1OSPL 4AM0B 4OQ1A 1JI1A 1U3HC 1D9KC 5GGRA 4N5ED 3O4LB 3EOAB 2Z31D 3QUYA 4U1SA 4PP2B 3RTQB 3IXAA 4IJ3B 1DN2A 4WGVB 4PS4H 5F7YC 3GHEH 2I26N 1KJVA 5DEGA 3JV6B 1T83A 2BCKB 4C58B 1S7QA 1U8OA 4S1RH 4YJZL 4Y2DA 3HCVA 5LXGH 1A3LL 1XT5A 2GSGA 4MJIE 3PWPA 4GXVL 4L8SC 2BOCB 4C56A 3W9DA 5GRYA 4TNWF 3EYOB 3LQZA 3M8OH 5C09D 1SYSA 4V1DB 3P77B 4U6XA 3E2HB 1RZFL 2M26A 4OKVA 4S1QL 1FC2D 4IRJC 4U1HA 5ANME 4RGOH 4OZIF 3RWEB 2FR4B 4IRJD 1CK0H 3IAGC 1GC1C 2N7BA 4X7SH 5J4MA 4F7MB 5AAWA 3P0VL 1GOHA 1YJDH 2EKSB 2XQYK 4U6YB 3RY5A 3CSGA 4OF6A 1AGCA 2BSSB 3DROB 4LVHB 4KJQD 2EH8H 5M95B 3GSNH 4F7CA 5L7XL 2FDBP 2P48B 1PVHA 4Y4KA 1FLRL 3ULVH 3GMNB 5T1MA 4RNRB 2C3HA 1QQDA 2YPLA 5IB1A 4FQXA 4NNYB 4Y1AD 4JFDB 2D4FA 4WNQB 1KJ2B 2ZUSA 5B39B 3QRFM 1EIBA 2AJVL 1RZJL 4ZO6A 1EO5A 3CAFA 3WNMA 1F6AA 2DWDB 3GNML 4XCCL 5IQ9B 4URTB 4LCUB 3D2UB 1T1YA 2W92A 2GT9B 3HLAB 4P2QB 3SCMB 5FGBC 3PHOB 4XNZC 1NC2B 2IANB 1H15A 3LOWA 4KK8C 2XTJC 4CJ0A 3QXTA 3MYJA 2WINB 3TWCH 4KK8D 1CDYA 4ORZC 1MJ7L 3DOSA 3REWB 4D3CL 5DLML 2E6QA 4U1IA 3H9ZA 1DFBH 5D7IE 5JORA 5D1XD 4QTHB 4OLWH 3I2CH 4PJ9A 4D0BA 2DTMH 5JW4M 1F4HA 1HSBB 1IKFH 2X9XA 3RGVD 2DYPB 5HPMA 1KB5A 5C6WH 2BSRA 1XF2A 5IJKA 3FT3A 2R2BA 4JM2C 1T03L 4U1LB 1CD0A 1JNHA 3ARXA 2P44B 2B0SL 2R4SH 4K8RC 1NFDA 4FQCL 3RAJL 5CIPB 5DDHB 1N7MH 1CLYH 1AE6L 3K4DA 3GBNH 2ATKB 1WEJH 2DI7A 4HS3B 5JMOC 5LBSH 3WHXA 4KDTA 2DQDH 3ZE0E 2E8ZA 2MCG1 4DQOL 3UJTH 5FCUL 4LSVL 2VWEC 1VHPA 4JFZL 3O3EA 3QA3B 5ICXB 4I0PC 3RDTC 1MCIA 5DJ2B 3I6KA 5F1NB 4D0DB 5L0QB 5EU7C 2A0LD 2DQEH 4W6YB 3A6CL 1LO5B 3CLFL 3AS1A 2VDKH 3B3IB 3UTSD 1EAJA 2GSIB 5CEXA 2P5WA 1U8JB 3H42H 3DETD 4FQ1L 5BZWA 1QR1B 4PRPD 3OKMB 5KN5B 5HHQB 3O2DH 2GY5A 5BJTB 5A2LH 5IV2A 1IT9H 1MAML 5DRZA 3SE4C 1HHGA 2R0ZH 1XMWA 3T2OA 1KACB 4M5ZL 3OAUH 4HLZH 3QNXB 3NPSC 1YEKH 3K3QA 1AO7D 4Z7WF 1RK0A 2Q3AA 4WVRA 25C8H 4MMZC 1UM4H 1C12A 4JRXE 1JZ3A 3QPQC 2VRAA 4OZGA 1KF9B 3T1FB 3BPOC 5IESL 3O9WA 2VJXA 3QPQD 2NW2B 2A6JB 4H20H 4L3AA 4ZPVB 5F9JA 1JGLL 4GAFB 4MNQB 1UZ6F 2AI0H 2W9EH 4RMQA 1KC5H 4MJ4A 3T65B 5IVXE 4GXUN 2FYYA 1CLOL 4LARL 4PV9B 5F9WC 5C0GA 4M6MH 3ULUC 3CLEH 1NAKL 5EOTA 2F19L 2O5YL 3VXOA 2NY7H 1A1MA 5ERWB 2Z8RA 3ULUD 3LDBC 5C2UB 3IB4A 1FZJB 2C5DC 1B0GB 1I1CA 4MA1B 1A6VL 1EO8L 3RWJA 1BREA 5HHOE 1MHPH 3MUY1 1IGFH 4FQ2L 4K94H 5DZLA 5IW6A 3R0NA 3VWJC 3AU1A 3BGMB 2H6PA 2V9RA 3VWJD 1HCFX 3SKJL 3SBWC 4XP5L 4TSBL 1BOGA 1IL1B 4PRIA 2CR3A 3H7LA 1EDQA 5J3HD 4J3XA 2VO5A 4E0RA 4OFYA 4QWWD 1LK3L 3QUXB 3BZDA 3UJJL 4XP4L 4LEOA 5B8CB 4M7ZC 3TFKC 3VW3L 1K8DB 2YBRA 1FNGA 4XI5C 3SE9L 5I1DA 3U48A 1WV7T 4FXGA 2CLVB 2E9BA 2R0WL 2VLRE 4FTVA 3H0TA 1EAPA 3CDGB 5GRJH 3RWFB 4C54A 1S7WB 5BS0D 4X6FB 3NIFE 4Z7QE 1AI1H 1P9MC 2X89A 3SJVA 4Y16C 1FZOB 2ADIA 4HBCH 2I9LB 4X7CC 3WCYA 5A1AA 1VADB 5B3JF 3FO1A 1JF5A 1EHLL 5DRNA 2CQVA 2ARJB 2AJYH 3GK8H 4MAYB 5D8JL 2I60H 5ALCL 3SDCB 1SJEB 3BZ4B 5BVPH 4RAUA 1IVLA 4NQXB 5HGAB 4JG1H 5LGHL 1JIBA 4IBLT 3OAYH 3GMRA 1PEZA 1P7QD 1XGPA 4YDIH 5A40E 1BFTA 5IROA 3L5HA 1KTLB 2RFXA 1EHXA 1FJ1A 2PO6A 3QYCA 3D85A 4NKIL 2P8LA 2VSDA 2GITB 3WYRA 1FLTX 4ZFZA 2NNAA 4MA7L 3B9DA 1UM6H 4NJ9H 4WU5A 4XNQA 4BQ6A 5ADPH 4UMGA 4QCIA 2W0PA 1T6WA 2DLTA 3GSOB 3HC3H 5C0EA 4PJ7B 5FYKE 2NY3B 5T5FL 1A3RH 4BA8A 4XAWH 2H2SC 4LVNC 2WBJB 5TQ0L 3EYQD 4KU1A 4MJ6B 2P46B 1HHHB 3ARFA 2EIZB 4TTDC 1ITBB 4U3HA 2ESVA 3T4AB 2HA1A 4WW1B 3GFUA 4PJAA 1C08A 3B5GA 1AJ7H 3V4UH 1I75A 3SDXF 5E8NB 4YX2H 2AQ2A 4FP8H 3SKMB 4B53A 2DKUA 4MQTB 1AKJB 4MDIA 1CU4H 3TO4C 1AHWB 1F3DJ 4JZNB 5GSRB 3GI9L 3GI8H 3H9SE 3MUGB 4LHUA 3VXUB 4G8GD 1JWSB 3B9KB 5HYQA 5B39G 4R4NC 4XPFH 1MFDH 2N1KA 3QDGA 1OTUC 2SEBA 4Y19D 5DK3A 4PTUB 3CNKA 5CP3H 1IBGL 1FV1B 3PWJA 3VMPA 2APVA 3UZQA 4G5ZH 1VCAA 1MREL 4BZ2L 5KVGH 5T3XE 5IMKB 2AK4A 4CMMA 5J1TC 3BIAX 4HDIB 4QNPE 4HK0A 4LIQH 3PUCA 3WJLA 1CXKA 3O8XD 4HXAH 3J7HA 1BFVL 3D39E 1OAUH 3MX0A 1SJVA 1HH6B 2IQ9L 2YSSB 4XGZA 3H9YA 4X6DE 3VFOB 5C08D 4YXLL 1DEDA 1P7HL 1HXMA 1UADC 2E9WA 4UIMB 5ALBL 2KL6A 3KPNB 4JN1H 3DTXB 5IG7B 1CQYA 1MQ8A 1JYWA 5FEBA 2H45A 4ZUUA 4H5SA 1OP5K 3BH9B 1G7HB 1LILA 2HMIC 5EDXA 4WJ5B 3WNOA 3RUGB 3VFSA 2BHYA 4GMTL 4BKLA 4WY7H 1UJ3A 1QKZL 3KYOB 4HEPG 3LH2H 4JY4B 4PJDA 3DWTA 5AEAA 3DX9A 1SYVA 3RZCD 2P42B 4LVOC 1BD2A 3LEXA 1OF2B 5ISZE 4GAJH 4Y8AA 3BW9A 3C5JB 3T0EE 5ID1B 4HW6A 4U6VL 1MFNA 4LHQB 15C8L 1ZSDB 4FNLL 4X99A 2R69H 3ARUA 1HQ4B 1IC5H 4G6KL 1MCHA 4ELMF 2DLFH 1JUFA 2ZUQC 3AS3A 3MNVA 4BSWB 1I1AD 3ZSSA 1I3VA 3QDAA 2JE8A 3OJDB 1MVUA 3NFSL 4QHUA 4R8WH 5SWZE 1NFIB 3UC0L 2UZXB 5DC4B 4F7PA 4IMLA 1TQCC 2F58H 3VRIA 3OX8A 5FDWB 2AS5M 1OAYH 3PWLA 2HVJA 4RIRA 3FQUA 1TETL 4JY5H 1FZKA 4QF1A 1S9YA 1G9EA 4F15C 1VEPA 1Q1JH 1IQDA 3SDDA 3BAEL 3I84A 1KBGL 4PJ8C 3ZDZF 2GAZB 3S4SB 3P0GB 3OSKA 1Z2KA 4PG2A 5FGCB 4NQEA 4PJ8D 3VFTB 4MNGE 1B4RA 5HD8D 1MAJA 4F2MA 2DDQL 3O45B 2B1HH 1OM3H 5I8KL 1U8LA 1BAFH 4NBZB 4JDTH 2OR8A 4YO0B 2Q1EA 1ZHNA 1VPOL 3I85A 3VH8B 1LO4L 5EWIL 3QIUC 1MH5B 2R15A 3LHPH 5J06A 4M1DH 5CWSA 1CDGA 1F3JB 3GSRB 5HHMD 5J9PA 4KHXL 5DMJB 1BBJB 4ZO7A 5IBTH 4K7PL 1MI5E 1J1XH 5SWQB 4OIAA 1M71A 3TZVB 4L4VB 1KFAL 5INDA 3HB3D 4OV5A 5LWYH 3WUWB 3KLHD 1AGDA 1VFUA 4WDIB 1KYOK 3ZDXE 43C9A 1L7IL 4NO3B 3O6LH 1KPRA 1CFNA 1NDMA 1GGUA 1U2CA 2IALA 3CXDH 1R0AH 3VXTB 4L3CB 5J8OA 4C4KT 2DQIH 4XBEL 5E7FA 4P5KA 1BVLA 4PRDA 1XGUA 4U6HB 4QRPE 3BJLA 1T2QL 4CNIA 4RMTA 5I1KL 2FJFA 1UYWL 4KK5C 4MSWA 4Z95H 1QBBA 3V4VL 4G7VH 4GW4A 3KYKH 1G7MA 5A3ID 5CJQL 4MJ5A 2XN9D 2OSLA 2R9HC 1MLCA 4MHHI 3RGHA 2Z8WC 3BRFA 3T0BA 2CD0A 5DO2C 4FQIH 1N2RB 4XVJH 1HZHH 4IRSC 2KQMA 4IOFC 1U9KA 3QDJA 2CMRL 4IOFD 4RGNC 1IRAY 1ZANH 5CZXC 5D7KD 4EXPX 3TT1H 5D1ZA 3RA7L 1HINL 5CZXD 3C60D 1VACB 2A73B 3OB0H 4JN2B 2RJMA 4ISVB 1S78C 4ZFGL 1A7RL 3TPUA 5D7JC 1U8HA 4ZUSB 3O2WH 2YKLH 5D7JD 4YHKH 3HZYB 3KJ6H 1IQWH 1J8HA 2OR9L 3GMMB 2WLYA 4EEEA 3QCUH 2QKIA 4K7PY 2EYTA 1RZGA 4W6XB 3GMOB 3BHBB 4ZS7H 3FFCE 3FRPA 1GIGL 4IOSD 5HDBF 4P4KC 4OZIE 5GGQL 4MXQC 4ZAKD 4OI7A 4KRPC 4P4KD 4OLZL 3LCYA 3SDAD 3HNTL 2IFFL 1CL7H 4JPWL 3DV4A 3UDWC 2MWCA 4Q9BA 3OXSB 5EG6C 5EU6D 3UJIH 5IB3A 5E6ID 4JPVL 4QO1A 3BGFC 5E8OA 1KJMA 4ZUTB 3P30H 4LLVA 5D5MF 4PJGB 3SO5A 4DGYL 1Y0LA 2E3VA 2J5LC 2VDNL 3BWAA 5F9OH 4OGAC 4M48H 3T1WA 1T7WA 5C07E 2VIRB 4GG6F 2EDQA 4E42A 1WBXB 3I50L 1C5CH 2HJFA 5DJ6A 3EJZC 1BJ1J 2GFBB 3ARBA 5HJ3B 1WAAF 3NCCB 4P2RB 3VI3F 1NGWA 3BUYA 3ESUF 1BQLH 1DVFB 3G5ZA 4AJ0A 3AUVA 1MCKA 3V52H 3VXSB 1CFVL 3C5SA 1OT2A 4P99A 4ZDHB 4D9QE 3WUZA 4EBQL 3ZTJH 3L3JB 3FTGA 5F89A 2EDWA 4A6YL 2BNRA 3PV6A 4Y4FD 5DURB 1ZVSB 3FN0H 3MRFB 4GRWH 5DFVC 5JW3H 1CLCA 5DFVD 5IHUH 3V6ZB 2COQA 3HI5L 1EFXB 3VFPA 3BD5A 1QSFA 1CXLA 3CH1A 1PGRB 1T7XA 5T3ZD 3BP6B 3IETA 3OV6A 1DCLA 5D2NA 1JGEB 5EA0L 5HI4C 2NR6D 1FRGH 2FLBT 4NT6B 5F7EL 5HI4D 4I4WA 1UEMA 4H25A 3VE0A 5IBUG 4ETQB 5DJ0B 4G9FE 5CEZH 1P1ZB 5E5MB 4I5BB 4U2YA 5IMMB 5FHAH 1NBZA 5HDOA 3SKNA 3ZDYF 5C0AD 4X6BA 1A14H 1U93B 1FNEB 3P9WB 4WW2A 4LP5A 5JIHA 3QEQD 4LPCA 4FQLL 4KFZC 4MWFB 1A7NL 5E4EC 4ZODA 4RMSA 4LRNH 5TQ2H 4IIQB 1UQSB 2XG5A 4DGVH 4JGMA 4LAQH 4BK4A 3S3PA 3ROOA 5HI5D 4CGTA 1Q9LA 1QO3A 2NY4B 1JFQH 4DVBA 3BXNA 1C16B 1LO2L 5C3TA 3O3BB 1OGTA 4RX4D 1ZLSL 5CUSH 4Z6AT 1FH5L 3SDYL 1TVHB 1MQKL 2CDFB 3MRRB 3R4DA 1JYVA 1JHKL 5FO7A 5K9KB 3MQIA 1ZVYA 3DVIA 3G6AB 1A7QH 4X5WA 5GS2H 1M7DB 4MD4A 5EZJB 2RIKA 3RWIA 4K3EL 4KKLC 3C6LC 5DJ8A 2IG2L 4ODWB 5L6YH 1FSKC 5KVFL 2X70B 3ILPB 4KKLD 4TQEL 1IE5A 3BPNC 3UTOA 5KSVB 4KVCL 3RIFF 3TH3T 3NZ8B 4MD0A 4GFTB 1N4XH 1YEHL 3TIEB 4Z7VA 4TNVK 1FFQA 5EUOB 2OJZH 4JGUA 4KXZH 4OZFA 4Z7WE 1B0RA 1ZS8A 2HJKB 4O2EA 3U9PH 1NLBH 5C0FB 2UY6A 2VAAA 2CJUL 3CXHK 2DQFB 3HNSH 5DXWA 3BVNB 3ULUF 4G3YL 1IAMA 2OJEB 3UP1A 4M7JH 1YUHB 4YK4B 5E9DB 3VH8G 3TNNA 1FGVL 2RHEA 2FH8A 4KZDH 4J8RA 2AJ3B 3OKDA 2HRPH 2VXTH 3HRZB 5HBBA 3ZKQD 4XH2A 1F3DH 1K4DB 1XAUA 1TLKA 4PJHB 1FNHA 2FO4A 3AREA 4HZLA 1ZT7A 1CE1L 1W72H 5CINL 4NQDA 3FOLA 4Z7OE 3K2UH 2VDLH 3UO1H 4EI5D 5ESAA 4IRZL 4S1SH 3VDCA 1ZGLB 1KELH 2A9ML 1LDPL 3DMMA 1DQLH 1VFOA 4G9DB 3D9AH 3QUZC 1EUUA 3WUWG 2OS7A 1LO3L 1YYML 1XZ0A 3UTZB 5D1QA 4LLUA 1HHJA 3GB7A 1IEAB 2FIRT 4ZUVA 4K7FA 5IB2A 3GJFK 3RI5K 1YEFL 5KSUB 3D0VA 5C0BE 2CPCA 5E70A 4D8PB 1MHHB 2OQJA 3VCLB 2WWMD 3HG1B 2X4SA 1MY5A 2WW8A 5F9AC 12E8L 1MRDH 3VFMB 3VXRB 1A9BB 1Q9OB 3MFGB 3MRJB 1J1PH 1T83C 1SY6L 3VXMB 2GHWB 4KHTL 5JMRA 2DIJA 3C6SB 1WZLA 4Y2DC 1NEZG 4UDUA 3BKMH 3CFBB 5IWLA 3C08L 4WWID 4Y5VB 2OX5A 1KCVL 1U8MA 1I7TB 2BSTA 4NZUL 4HH9A 3JVGA 3WIIH 4ZO9A 2C3VA 1G7LB 1DL7H 4PJCB 1HSAB 1WVZA 2GIYA 5ETUA 4O2FB 2PXYB 3O3AB 3LRGA 1RJYA 1BWWA 2E27L 3STBA 3MFFB 4GKNA 4JDZB 1U8KA 2BFVL 5ID0A 3WFCH 3RRQA 4NYLB 4PD4J 1TJGH 1YPZE 5LCVH 2ADJA 4RAVB 1H3XA 3U4AA 3HMXL 3LKPA 1RIUL 1F4WL 1I3GH 4K3DL 1B2WH 5AZEH 3VFVA 2H9GB 4ZFOB 4M8QB 3S9DB 3WMSA 3T09A 2X7LA 2EZ0C 3EYVB 4FZ8H 5D7IA 1L6XA 2VXVH 2GCYA 4Y4KC 1INEH 4XVUD 3MO1A 3MJ9H 1RZ7L 1I8LA 4CVUA 5I8EA 2CUHA 2YPLD 4OF0A 2BNUA 3W11D 1KIQA 4WCYH 1VFAA 1JHLL 2D0HA 1WBZB 2NY1B 5JW5B 4R7DB 1TZIB 4QXGH 2XQYG 3KXFE 4V1DE 5C92A 4LKXA 3UTPE 4G7YL 4CVZA 1CGSL 4OLVL 1TJIL 5JDSA 2ZZUT 2WQ8A 1TQBC 1FYTB 3QIWB 1YEIL 3IF1A 1AD0B 1EO7A 2WLZA 1S3KH 3P4MB 2BVOA 3LN5A 3N9GH 1NAML 4L3ED 5EC1B 1IM3B 4UQ3A 1FL3A 1A3QA 4QOKB 3STLA 4JHZA 3V0VA 4AMKL 2YMXH 5ICZB 2I5YH 4PJ9C 2R1WA 4Y5XB 3OKNB 3ARDB 1U8IA 5H94A 4MA8H 3B5HA 1UJTA 4J6RH 4JFDE 1QACA 3RX5A 5IJKC 2EYRA 4LFHG 4HD9A 1KCRL 2O61A 2AABH 4PJBF 1I4FA 1U8PB 3FMGL 1P4BL 2DN7A 4UUJB 3WEXA 1XGTA 2JJWA 4KDTC 4XBGB 4MAUL 3VU2A 4P2QE 5LQBL 5C71A 2D7MA 4KROB 2Q6WB 2IANE 4KK9C 5I1CH 1HQRB 4X0KA 3EDJA 4FQHA 4OF7A 2VZ1A 3LS5H 4KK9D 4JR9H 4BFEA 4NZTL 4CADB 5DD5H 2P47B 3FB5A 4Q9QL 4J1UB 1F02I 2VZUA 3U7YH 4WWKD 4GAYB 4XMPL 3QFDB 1K4CA 4TUJA 3QIBA 3NACH 3GMPB 1GZPA 4RA3A 3G04A 3LN4A 4CMHC 3ULUL 1Q9WA 4QEGA 4G6JH 1ERNA 3IDXH 4I3SL 3KPLB 1MFCH 3U4EB 4N90D 4OFDA 2P5WD 5FHBH 1CGXA 3P0YH 5IUSA 1CS6A 1BVKB 5GSVA 1E6JH 3KYAA 2H26A 2G60H 5K9OB 4R90H 1MEXH 3FN9A 1AQKL 2IAMB 5JUEH 2W1NA 4QRUB 4ZQKA 4FFYL 4RWYH 2VN4A 1TVBB 4M43L 5MHSE 3GM8A 4AEFA 1FG2A 4QRQB 4WUKL 2AEPH 1JTTA 5MEPA 4ELME 3M1BB 4AEEA 2H3NA 2VLJD 1U6AL 3NCYP 4N8PA 3IS0X 3L5WA 2IADA 1U3ZA 2V6HA 4APQC 5MP6H 4OBSA 3L3KA 4JKPH 4N8CL 4APQD 3GIZH 1UCBH 5CJXC 4HKZB 4NHCL 2Q3ZA 4GW5B 4LBEB 5F1IA 1S9KC 2HT4C 4XAKD 1VGEH 5I9QB 3WFBH 1YEJH 4YBHA 2ZCKL 2R2EB 5IB5B 1N5YL 2F8VA 2UZIL 3WE6A 3I3DA 5I74B 1MRCH 3X17A 1NBVL 1UM5H 1IC4L 1QSEB 3I6LE 3M45A 4O4YH 4TRPH 1IGYB 3PGFH 3V8CA 5CGMA 3QUMH 4ZS6D 3VGEA 3UTTB 1Z5LB 1J8KA 1IZJA 1CTOA 2E7LA