1SM4A

Crystal structure analysis of the ferredoxin-nadp+ reductase from paprika
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
296
structure length
296
Chain Sequence
ISKKQDEGVVVNKFRPKEPYIGRCLLNTKITGDDAPGETWHMVFSTEGEIPYREGQSIGVIADGVDANGKPHKLRLYSIASSALGDFGDSKTVSLCVKRLVYTNDKGEEVKGVCSNFLCDLKPGADVKITGPVGKEMLMPKDPNATVIMLGTGTGIAPFRSFLWKMFFEKHDDYKFNGLAWLFLGVPTSSSLLYKEEFEKMKEKAPENFRLDFAVSREQTNEKGEKMYIQTRMAQYAEELWTLLKKDNTFVYMCGLKGMEQGIDDIMSSLAAKEGIDWADYKKQLKKAEQWNVEVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of paprika ferredoxin-NADP+ reductase. Implications for the electron transfer pathway.
pubmed doi rcsb
source organism Capsicum annuum
molecule tags Oxidoreductase
molecule keywords chloroplast ferredoxin-NADP+ oxidoreductase
total genus 99
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2004-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1sm4A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1sm4A02
3W5HA 4AF6A 3P27A 3AVTA 5JBQA 1I7PA 1D8TA 1EFTA 2YWFA 3G71B 4M4SA 1EFCA 1DDIA 1QX4A 4DQLA 4QHYA 3QSYA 1VQMB 4M1KA 1QVFB 4NBSA 1NDHA 3J81k 1CNFA 1IJFA 4M0LA 1QFJA 3CB4A 2XEXA 4FK8A 1S72B 1WDTA 5TY0A 1FNDA 4WQMA 4MYTA 1K9MD 1KK2A 4Q7JB 1G7TA 2BMWA 1TLLA 1Q7YD 1ZM3A 3VNUA 4UAJA 4PGOA 3ZC3A 2EFGA 1SM4A 3OZUA 3WNCA 2BF4A 3CC7B 1KRHA 3AGPA 1YJNB 3CC2B 2GPJA 4B48A 1AIPA 4PC7A 3AVYA 3W2HA 4QFMA 2QN6A 2ZITA 1GR1A 3FPKA 2B5OA 1BQEA 1G7RA 3OZWA 2HMAA 4TMWA 3CC4B 1ELOA 3CCVB 4H9GA 1QG0A 2CNDA 1F60A 1YIJB 3LRXA 1QGYA 3A1FA 1JA1A 4ZCIA 4YALA 4MYUA 4YAFA 2QA4B 3VNVA 2OK7A 3B78A 3ZZTA 4YHBA 2BSAA 4AC9A 4Y9UA 4TMVA 3VO1A 1BX1A 3G6EB 4B4DA 1QUFA 2VNJA 2VNIA 1B2RA 4M53A 1M1KD 5KSWB 5GV7A 3V76A 2B7CA 2C77A 3I56B 1VQPB 4RD0A 3E1YE 1FNBA 4G1BA 1OGJA 4ACAA 1ZM9A 1G7SA 1F20A 4YAOA 2BV3A 5TR9A 3ZZ0A 1BX0A 3ES9A 3CCLB 3CMAB 3FJOA 3CPWB 3W2EA 2RC6A 3MCAA 1DG1G 4LC0A 1VQ5B 1FRNA 1TVCA 1Q81D 1TTTA 2VZLA 1YITB 3WNDA 3WBJA 1EWYA 2PMDA 1SKQA 4RD2A 3U2QA 4B44A 1JNYA 3I55B 2RC5A 2BVNA 3LVBA 2AHOA 1OB5A 1B23P 3QFCA 2DETA 1YHQB 2DCUA 4Y9RA 1N8RD 4LBYA 1K8AD 1NJID 2CRVA 3CCSB 4PC2A 4NCNA 2VNHA 1Q82D 4J0QA 4RD1A 1TUIA 1W87A 3QFTA 4G1VA 1KK3A 4ACBA 4DQKA 1QGAA 3ZBTA 1FNCA 4ZCMA 1KK0A 3W5UA 1VQLB 2XNJA 1OGIA 2C78A 5DSZA 2OTLB 2QEXB 3AVVA 3WYAA 4B47A 3VO2A 3OJXA 1E62A 1GJRA 1CNEA 2BM0A 3WY9A 2HDNB 2J7KA 2YWGA 4F7DA 4R71A 1Q86D 4HE6A 1EFUA 1FNMA 1OB2A 5EMNA 3E20A 3CD6B 3VMFA 1J9ZA 1G7CA 4FWTA 5FA6A 3JQPA 3SJZA 2D74A 3MMPA 2HCJB 4P6VF 1VQ4B 1VQOB 3OJWA 4YAWA 4N3GA 1IB0A 3G4SB 1D1NA 4PC1A 2X3UA 1XB2A 5GV8A 4RCYA 1EXMA 2E1RA 4AF7A 2XNCA 1GVHA 1M90D 1R5BA 4B43A 1R5NA 2BPOA 2GQFA 3B8HA 3CRZA 3W2FA 3W5VA 1VQ8B 3OZVA 5THXA 3P26A 3ZZUA 1ZM2A 3AGQA 1N0UA 2DY1A 4TMXA 3CCEB 2OTJB 2PLFA 1FDRA 1E64A 1GAQA 3AVUA 1UMKA 3ZBUA 1DDGA 3CMEB 1D2EA 4C0SA 1K73D 4LBZA 1VQNB 1QGZA 1W2BB 1KQSB 4M2LA 2QTLA 1BJKA 4ZCLA 3U6KA 1R5OA 4RCZA 4RJLA 1HA3A 4HE5A 1KC8D 3QE2A 5H59A 1QUEA 4ZV4A 3CCRB 3LO8A 2QDXA 3CCJB 2YWHA 1W35A 3AVXA 3QFSA 4RD3A 2EIXA 4RD4A 1U2RA 3QFRA 1YJ9B 1KTVA 4TMZA 4TMTA 1KJZA 1H85A 1QH0A 2VNKA 1AMOA 4PC6A 2OK8A 1IJEA 1YJWB 3JQQA 1H42A 2NPFA 2BGJA 3CW2A 2B7BA 2QMUA 1VQKB 1VQ6B 1VQ9B 1JJ2B 1JA0A 1ZM4A 4C43A 1YI2B 3W2GA 1EP2B 1A8PA 4LBVA 2VYQA 1XE1A 3OW2B 4BPRA 2YWEA 2PIAA 4FN5A 1CQXA 3B82A 2BGIA 2QTZA 1KD1D 4P3YA 1QVGB 4RD6A 4N3NA 4PC3A 4ZGQB 1JB9A 4YAUA 3CCUB 2DERA 3LYUA 3PENA 5HXBA 1EP3B 1KK1A 2R6HA 3WBKA 4Y7CA 1QFZA 3WNBA 1VQ7B 3WXMA 2FX3A 4B3XA 4G5GA 5H5JA 3CCQB 3CCMB 3JQRA 4LBWA 3MHPA 3U6BA 4ZGNB 4EH1A 1GO2A 1QFYA 1EP1B 4U9UA 1DARA 1FRQA 3I1FA 1W34A 2BN4A 1S0UA 4IW3B 2DEUA 1E63A 1ZUNB 2BM1A 3AVWA 4K1XA 1N0VC 3W2IA 5TV2A 3CXCB 5AN9A 1GAWA 4TN1A
chains in the Genus database with same CATH superfamily
1TIBA 4JLSA 3MK31 3VR5A 3HU3A 1V6AA 3E7XA 4LWOA 2ILVA 3W79A 1HYQA 1L1FA 2D7JA 2X1HA 4M4SA 3N7UA 1KSHA 3ED1A 2ZRGA 1QX4A 4MUEA 4CMGA 2PE3A 1YQDA 3PKIA 3T5AA 4KQCA 4JROA 3D6MA 4QU0A 3OIGA 5I5GA 3VDMA 2LIPA 1SCUA 4NZYA 1W49A 5EUBA 1ORVA 1W85A 2BZ1A 2XRFA 5A1JA 2QF7A 1YJBA 1U8FO 1JSXA 2NUAA 2P75A 3PKZA 2IELA 2W6JA 1KBZA 3L7CA 4X3CA 5KOJB 1CNFA 3W4KA 3KQLA 1Y37A 4FCCA 2X8WA 5SYNA 2VXCA 4DR1B 2G9RA 1RWBA 1A1SA 1PK9A 3KLNA 4J7CA 5JD3A 3TZ6A 3DE0X 4OG2A 4QBKA 3ET5A 4KR9A 1VG9B 1T8TA 2NQ2C 3JVDA 3AL3A 1ECJA 2ZK7A 1RS0A 2TSYB 2ACVA 2QTFA 5E7IA 1XKLA 3AFMA 2IPNA 1ZPDA 4TLDA 4CN8A 4BKPA 1NE2A 2FMTA 4M8SA 4MIYA 3G23A 1HG0A 1PV1A 3MD9A 1HY3A 2JFZA 3LCJA 1RC8A 5FWXB 2GNOA 4TSFA 1CZRA 1FA9A 2XNHA 4R3NA 1N2CA 1E77A 2R5FA 1TA9A 3BB3A 2WJ6A 4GLFA 3TXXA 1ZM3A 3SX4A 3RSZA 2I2FA 2ZJ5A 5E4JA 3UGKA 4E08A 4H1UA 4RE5A 3SJPA 1TMYA 3TTSA 1L9KA 4LZWA 5A8AA 4XN0A 2EFGA 4AN1A 4TVSA 1K86A 1ZD1A 2CFSA 2M6RA 2VSXA 1D2CA 4XH9B 5A7FA 1NXOA 1XQYA 4AJ4A 4NVRA 1V0JA 3DB1A 4QXQA 1TC1A 4YACA 1YZLA 2UVPB 4AJHA 4DPKA 2FUKA 3HJBA 4UVEA 3RGGA 2EBFX 2IV7A 2HU2A 3ZGOA 1CC1S 1VHTA 5KYKA 4EGQA 2GFQA 3WLJA 2VT2A 4AS2A 3BZBA 2EDCA 1YFLA 4NZZA 3B6EA 4PBTA 3TPCA 1TVMA 5CEJA 1HZEA 2HLDA 2WHQA 4Z4RA 4B3SB 1XQ1A 2CFIA 1NJSA 5CB0A 4XGQA 1NMEA 2XCRB 4QKQA 4DB2A 3PUYA 4X62B 4FZVA 4UM9B 2I7VA 3WV4A 1G7RA 5DO9A 4FMBB 2HMAA 3CURA 3NWPA 3L8FA 2HHAA 3NTLA 3IT0A 2ZG6A 1QG0A 3FMPB 4OQQA 1M0SA 1W5BA 3EGCA 4J4HA 3G0GA 3N5CA 2XGOA 3MERA 4MI1A 4NESA 1OBOA 4OQLA 2Z2ZA 3HB5X 4TV9B 4W7SA 2ZI6A 4NDNE 1P9WA 1QQ5A 1S2MA 1PWYE 2CD7A 5CP8A 2EJCA 3SCZA 2W9XA 1ZMRA 2Y1FA 4OL9A 3VI4B 2ZE7A 3H9EO 2X40A 1X19A 4K8OA 1LPNA 1EFDN 1Q16A 3BRSA 1GEGA 1LSJA 2G63A 4JUDX 4Q3BA 3C5WP 3PWSA 3R3HA 5TJ9A 1CS4C 4LSWA 2F8LA 4QXOA 1N9KA 1OZAA 2H9AA 2YJTD 2Q9AA 3KSUA 5A5EA 4OJMX 5TPZA 4DUGD 4Z4CA 3FFWA 1RXWA 4G4JA 3UA4A 2MINB 1P5JA 1DX4A 1S01A 1U8TA 2RGAA 2JGDB 5J3JA 4LGVA 1NTRA 2ZRLA 3LQRA 4J91A 5H16A 2D3NA 4S1NA 1QK4A 3CM0A 1Z34A 3NQ41 1QUFA 4I08A 2Q4TA 4QNNA 5J1TB 3SHTA 3SZUA 1UBJS 3VGPA 3WYGA 3B13B 2E48A 3A9RA 4LJ8A 2C0QA 1E4VA 6NULA 4O5AA 4AMVA 3PHJA 3ZHSA 3TAUA 4AJ2A 3GQBB 1Z13A 3E22A 1DUSA 4QODA 2O2XA 1WEHA 1US8A 4RD0A 5ICMA 5EKDA 3COSA 2ZRAA 4GI5A 3T3PB 3UAYA 4S1PA 2OAGA 5KTNA 1WLSA 2HA4A 3EWNA 3WHIA 1AURA 1CUXA 2R2AA 2FXVA 3MFQA 1TU3A 5J4KA 1DBWA 1N25A 1PJRA 5BV2P 1A7KA 4GMXA 1T36A 4RK0A 4REMA 3WJ1A 4ZK2A 1RJEA 1B4DA 2YJ3A 2IEIA 1R6TA 1I30A 2ZBRA 3TM4A 4G3XA 1B8PA 1X1SA 2EFJA 2KSQA 3RM3A 4EEXA 1CY4A 4KPUA 1FTGA 3E9QA 1X7WA 3W3AD 2PWBA 1QVZA 3HTXA 3S1LA 4ROXA 2WKSA 2ZPUA 1OW3B 3I9KA 2BTEA 5EMJA 1MIHA 3HG7A 1ZHFA 2GFIA 2FVYA 3IAM6 3NWEA 3BDVA 1HMPA 1BFKA 3HKEA 4W1RA 3KLBA 1CUSA 2GR9A 4D4GA 1U7DA 1YONA 2OHVA 4K9QA 1GPAA 1OXMA 2AOTB 3NTQA 4H1TA 4NU5A 4YDSA 2EOAA 4YASA 3U31A 1P73A 3FHJA 1XEWY 1RWKA 1GGKA 4OHKA 3P1JA 3U3RA 4AJJA 3QKRB 4C04A 2OQ2A 1GTJ1 3RVSA 4DA4A 2G9QA 4I8XA 3O21A 1LVHA 4V02A 3EBPA 1V8PA 4YRZA 1YMUA 4GVPA 3I2YX 4GXQA 2CXNA 2EW1A 4TLCA 4F11A 5DM0A 1AXRA 1N9GB 1UBTS 1ZL2A 4RD2A 2J3EA 3AP3A 1Q91A 3IPYA 2A0XA 4RHEA 4JA0A 4S12A 3UK0A 3LM8A 3SMVA 2XF2A 4GPBA 4MQUA 3TZCA 3W4IA 4DA9A 2RC5A 4KYIB 4RHCA 5AW6A 4OLHA 3UFXA 4R1OA 2AE2A 4DABA 4UASA 4FDTA 1GM5A 4OX9Y 3CH5A 2J3QA 5KNDD 1ZITA 3PC4A 2QLJA 3DLIA 2PL5A 3TNFA 4HLUA 3SEJA 2P5TB 3BMCB 5FWYB 1RM3A 2ZYTX 3CESA 4U9IS 2HJRA 5KKCA 3L6CA 4I1PA 1QH8A 1UXOA 3DYIA 4NPAA 4MI6A 3W90A 4ZYYA 5IWCA 1DPGA 1RE1A 3I5MA 2G6TA 5BUCA 2GF0A 2OBYA 4GZ3A 1T8PA 4URWR 1Q3HA 4GP9A 3CKKA 4MPPA 4KMSA 1C9MA 2VNHA 1I3KA 1Z0DA 4AMYA 2C3OA 1X1EA 3K2IA 2R47A 3K94A 2A4KA 1TUIA 4A92A 1GN9A 3DMFA 2SBTA 4GC9A 4M0DA 4PLZA 1G5HA 1JSLA 1XZQA 1FMTA 3GEDA 1KK3A 1HYBA 3Q7SA 1W29A 4C0JA 5ALIA 3C3DA 3AONB 4L28A 1IC6A 4DIBA 5LIPA 1B73A 3N7AA 3B20A 4FSHA 1JZSA 1VJ0A 2C78A 4L6CA 3E3AA 2P1ZA 4D3SA 1X7YA 4RPKA 4DYDA 5HBRA 5EQJB 2IF0A 1ZZEA 1U0RA 2HFKA 3NEJA 2NO7A 4XUEA 1VHQA 2O2IA 3UXMA 1C30A 4IIFA 4ERNA 4OX9B 4N6GA 2WSMA 4DCGA 1JMYA 1S9HA 1PS8A 5D84A 3S7TA 3C5CA 1JEEA 2A3NA 1LWNA 5JZSA 4P93A 4LY3A 5FFFA 1T2NA 1ZU4A 4GMDA 4JH0A 2CVZA 3FTEA 3HA7A 2DAPA 1T1EA 3RRXA 3O73A 3VJRA 1VYHA 3V8VA 3ZCUA 4X9XA 4X6YA 2AV6A 3ABOB 1DNPA 3HI6A 2QN3A 3HKDA 1FYVA 4LRXA 4CIYA 4BB0A 4RS3A 5J2TB 2BR5A 3E20A 4EFMA 1N4AA 4CF3A 4D96A 2C7QA 4EA7A 1ZD9A 3R6DA 3OLYA 4Q05A 1HRDA 1RBZA 4L95C 3JAKA 3DGEC 4DKJA 2OKCA 5AI0A 4TQUS 1PRYA 3O1JC 3ROKA 5CA0B 5AM1A 3BC9A 1YS1X 5CB4A 1R4MB 2V58A 4B31A 3TLJA 1G3RA 1ULZA 3N8GA 5ALPA 3U5TA 1Z5NA 1UXKA 4QGFA 3B1WA 2YNMD 3LQQA 4EGAA 2IX3A 4FHZA 2RMKA 2QMOA 2X8JA 2KYRA 4O4HB 3F6BX 4A16A 5IT0A 4MVJD 3DM9B 2C0CA 2VQ6A 3CZRA 1SN7A 4L4RA 1O0BA 2DYKA 2JIQA 5IN5A 1DZ3A 3DOFA 1KPGA 3L4SO 3UHAA 2W6ZA 3RIYA 3OKCA 3OICA 1IIBA 1XIVA 1DXHA 3GIDA 4QICA 4C6SA 2PZBA 3QX9A 4MPDA 4UU7A 4E6EA 3JYNA 3S70A 1UM8A 2J1LA 3G1WA 4OKSA 3VZQA 4ZVRA 1F4LA 4ASUA 3BD9A 2ATCA 3KG2A 3HV0A 4O3FA 3GFFA 1C1YA 5AI8A 3H75A 1E1LA 4ZC8A 5IVDA 2F1KA 3RS0A 3DMPA 1KDYA 1SCKA 4UW9A 4I99A 2C2MA 5FX2A 2XPCA 1DAEA 2IBSA 3NKVA 3WB0A 2JLUA 1PLLA 4OMFG 5GVRA 2BC9A 3ICOA 2PMEA 5THXA 1ZAKA 3QXJA 1W581 2C4MA 2W2VA 3BQ9A 4I3GA 2DLCX 4B3DA 3SSNA 2XSZA 4R7ZA 1KAOA 3T7CA 2NZJA 1BEZA 1H1LB 3UV3A 4YCCA 2ZI5A 1X1TA 4V03A 4OMUA 1SY7A 4JBLA 4PG6A 2XZDA 2NZYA 3ZY2A 2V0GA 4JK3A 5BNIA 3NWJA 4PYJA 4DIOA 5L95A 2HSJA 4FJ2A 4QDJA 1CY0A 1AUXA 1VLLA 2BEWB 2XYRA 3H8SA 2CFOA 3KV3O 1DDGA 2PANA 5F4BA 2YWDA 1IK6A 2ZWMA 2H17A 4QWWA 2W7TA 5JSQA 3ILVA 5KWSA 2E1PA 4XM3A 4FGKA 3NFYA 1WDKA 2NUTA 3TR0A 4DJJA 3CHYA 2XMZA 3TIGA 3HXOA 1M2WA 5IBPA 4US1R 3UF0A 3GC6A 1M2OB 2SKDA 3A9CA 3QF4B 3UJHA 4LQCA 3YASA 1O9BA 3HBJA 4JLPA 5ADUS 4IJUA 1CUHA 3ICEA 2WJ3A 4RJLA 1PNTA 3P4UA 3PR1A 4KLNA 3V7UA 1UK6A 5IAKA 2CLSA 4GL4A 2HL6A 4RVOA 5EXSA 3RPEA 3VTAA 3O5AA 2WJYA 1X70A 3KLOA 1JWAB 4NZMA 3U26A 4UEQA 4NG4A 3H65A 2WWTA 3DD1A 4IXTA 3VH4A 1DAIA 3AUKA 2IQIA 2MIIA 2I4MA 2R2GA 1JA9A 5I7SA 1D5CA 4KZKA 4RD3A 3FZQA 5BR4A 4RD4A 1UOOA 1JHDA 1TYCA 1M67A 3ZCXA 3A31A 3GNQA 1TZBA 2JAQA 2J3DA 1N7JA 1YJ9B 1RZUA 2IOFK 3IEIA 4TMZA 2VPIA 1QTIA 3IKJA 5T67A 4DC9A 2O50A 4TMTA 4QJ3A 3H42B 5DLDA 3A2MA 4A10A 3ETLA 4GE0A 2ORVA 4TYQA 4YRPA 3JWHA 4PG5A 1QH0A 1RXYA 1A5BB 3JQGB 3R9XB 5C8YF 3VOSA 2W6QA 3CIFA 5ITVA 1RPAA 4IIEA 5CTAA 1EFHA 1IJEA 1VJ5A 3DLAA 3C70A 1LH0A 2FHSA 2UV8A 3LHFA 5CAEA 3OOWA 1LFAA 1KDVA 3W9UA 1L0BA 3QHAA 3T4UA 2FSUA 1LV7A 5JEDA 2V6GA 3LQEA 1M6HA 1JXAA 4DG9A 4TLLB 4QFDA 1N5MA 1J07A 1UKYA 2IXBA 1F6DA 3AY0A 5E3IA 3SEZA 3C98A 4II7A 4EGSA 4YRRA 2QMYA 3PVSA 3AERA 4GBMA 3KQWA 4DQXA 4CDRA 4RFVA 2NZ8A 2O1WA 3STYA 3DQZA 4HXYA 1Q0UA 4P4UA 3G9QA 4BMCA 4HZUA 3OW2B 3AI7A 3UC9A 2PIAA 1RLTA 2APJA 1B43A 1YBMA 2ZL6A 3T1NA 4FBLA 3IBTA 1MQSA 3BQNB 4JGIA 1MB0A 2IXAA 2O2CA 3ORHA 3OP1A 1GPUA 4HXGA 5F23A 4KR7A 2O2DA 3CLHA 3COZA 3UAXA 4N3NA 5TLSA 2W90A 3LQ4A 5H9VA 2ZIVB 3RAFC 1RAAA 2FG6C 1XZJA 4YAUA 1YZNA 3ZNNA 4UFPA 2I9KA 2LBPA 4GGOA 3D4BA 5EVJA 1H2XA 1RQXA 2CLEB 4CLOB 1CR0A 2QRHA 4UHDA 2QPAA 4TLBA 4Y7CA 1QFZA 1M2VA 2CSUA 2BP7B 2VF5X 2ZTVA 2MINA 3DZ8A 3AKDA 1YZQA 1XDDA 1ZC3A 4HOYA 3RF7A 4HNHA 2RGUA 4P9SA 1ULSA 3QVSA 3WYNA 4RKEA 1P2FA 2N42A 4J7XA 2B1IA 4GMKA 3PQ7A 4UMVA 1Z6QA 4QQ8A 3HC7A 4LYFA 2RK3A 1BXKA 2PGIA 2QPLA 3OOJA 3RC2A 3A37A 1XVUA 2ECQA 3FW1A 3JQRA 3IOYA 4HD8A 4KBFA 1MF7A 1WPRA 4NXMB 2GZDA 4JJGA 1SIWA 2IEGA 2NU9B 1DMRA 4M8KA 4QATA 4F8EA 5IAGA 2DR2A 4X7EA 1JR2A 1YC2A 3GLTA 2WP8J 3P0HA 4NX2A 2I4TA 3H2ZA 2M1XA 4XYGA 1AQNA 1G6KA 2JJQA 5H3HA 3DTVA 2PYDA 4CKCB 3UN1A 1EP1B 1KI8A 4REQA 3EZFA 2Q5FA 1U8AA 5FI3A 3RTBA 3NORA 1AF4A 2Q6LA 3HA2A 3BDAA 2IOFA 1HT3A 2O0KA 4P0PB 1H2EA 2JFXA 4HVTA 3NMUF 3VSBA 4MO9A 5H1YA 5KVVA 3H6GA 3ZLVA 1H2FA 1RMYA 3G2NA 4FCWA 4EEKA 4H2DA 3HAGA 2QUJA 3N5KA 1DBRA 1TEZA 1MAVA 1DRWA 1QK3A 4AIRA 3PITA 5DNCA 2UVDA 3ANNA 1JVSA 2VDJA 1SCAA 4J07A 5KTKA 2B4QA 2ZYDA 1AE1A 4MV0A 4QFCA 5ALOA 5FB3A 4R2LA 3FCEA 2X0RA 4P7JA 1C9DB 2E6UX 2YRXA 3D3EA 3BHNA 4NONA 2F3PA 4C87A 3FPPA 4NBKA 1SAYA 2C84A 3GLGE 4EPXA 2FN9A 4DQLA 2ZRBA 3D6TB 2J7PD 4E22A 2DPXA 3DFZA 4Y2VA 5E8RA 1JIUA 4JSTA 4YJ3B 3T7IA 3U49A 3KZVA 4B3JA 1E5DA 4GT1A 2B8WA 2WIBA 1VQMB 3KTFA 1RRKA 3IKLA 3HYTA 4PZ9A 1SXHA 5ECDA 4HYQA 5DLQC 1XL0A 1VJGA 1A50B 3QU4A 5FWAA 1IHPA 1IYZA 4AU1A 2PFGA 3KXDA 1A7JA 3C7DB 5HFNA 1G16A 1CZNA 3KETA 4F1WA 1USWA 2PKYX 3NEYA 4RXMA 4GGPA 2ZIZA 4M88A 5LBUA 5KMGB 2ZTUA 4W5TA 5HKKD 3VR6A 2CJWB 4MW5A 5E6RB 1UBGA 1UFQA 2A9PA 1OX4B 4F3RA 1W4AA 3D2AA 4JP8A 5F98A 3EHEA 4MKGA 5FR2A 2Q46A 3D5QA 5LD2B 2PD6A 3R3SA 4X06A 5AI6A 2H2WA 4UULA 4RETA 5A6VA 3OQVA 4FKBA 3L1UA 4AB1A 1UK9A 4P5DA 3K9QO 1ISJA 1PQ4A 3ZQ4A 1YZHA 5BWOA 4GQAA 4A36A 4X91A 3A36A 2O0MA 3EUWA 1J5XA 5CEEA 4PGOA 2J9YB 1Y1SA 1GPBA 2DM6A 2AHRA 5CT9A 1P2DA 4H3VA 2DPMA 3BULA 3WC4A 2WJVA 4CIBA 5EE5B 2X6RA 2K7FA 1VMKA 3AGPA 3IUMA 1IXRC 4MULA 1CEXA 1WETA 2VJOA 2ECOA 2YQ5A 3HS3A 1FW6A 4YUWA 4NXNB 3FH0A 2D62A 2WABA 1KOLA 2ZIXA 1DEHA 4KXNA 2MSEB 3L01A 4HNAA 2GXUA 1E9CA 4QPDA 3V1TC 1P7WA 4NV0A 2DWQA 3N2ZB 2QN6A 2CDRA 1V6SA 1VBFA 4QIHA 5DNAA 3OMWA 4PE5B 1V96A 1ZNQO 3QWIA 4FFNA 4XX0B 2JJ8A 3FMOB 1KYIA 1PG0A 2PFKA 5ALKA 5ALQA 1ZWLA 3THOA 4E4TA 2LR0A 1SUSA 1JE1A 1JHXA 4NEGA 4F97A 3W78A 2PV0A 4UHCA 4HCJA 1ONBA 3AHHA 3VJLA 2CNDA 4DQ0A 3FF4A 2D7CA 1JIXA 3F98A 3R7SA 4BNUA 1XJWA 1TU4A 2NZUG 3ABRB 4QXMA 4GL2A 5FHQA 3FGNA 5HUQA 5TARA 4MJ3A 1CV2A 3F9RA 4NMWA 3GDGA 1Q0RA 1REQA 2C94A 2MMCA 1Z12A 2HQBA 2VA9A 2BFPA 2XTNA 4XQFA 3IQGX 5KIAA 5KYUA 4YHBA 3R4CA 4AJNA 2EYQA 3AUYA 3BXXA 2F43B 2PGDA 5B7PA 1EQ2A 4ZANA 1V8OA 4OXXA 1MQ8B 2XVZA 3IUJA 2VJAA 3TRJA 3GJ0A 4E5DA 2VUUA 5CXXA 5AFSA 5IP5A 3P9NA 3PCTA 5G40A 1L4MA 1RRVA 2VCYA 4Q6WA 4EG5A 2X0EA 1KWKA 3AM3A 3NHLA 1YO6A 4AZTA 5TRTA 4O25A 4P32A 2XB8A 5FV4A 2GAJA 4ZVQA 4F91B 4B2LA 1OQAA 1GZUA 4IHAA 4K6FA 4TMFA 2ZR9A 3SM9A 5MDHA 3ZDRA 1ZISA 2EFCB 1W8DA 3EVNA 3BF7A 1GU0A 4ZT2A 2UUOA 5LL6P 3K8OE 5EZYB 3E1YE 2B8NA 4MB0A 3HPRA 4JI7B 3WTBA 1NN0A 5D8DA 4BN0A 3WS7A 3GOQA 4R6XA 5E2BA 1GAXA 3M3PA 3IIIA 4E21A 4I3HA 1CG6A 1NU8A 3L8MA 4UD2A 5C1DA 4X66B 1UD6A 4K46A 4QUEA 4IKOA 1FX1A 3KOWA 3VSEA 2M32A 1YKSA 1E3WA 3NHUA 5HZGA 1NW4A 4ZGBA 2C1XA 2CHUA 3NAQA 2PU7A 3F71A 3RK1A 1TLFA 1D4FA 3LWZA 4GI1A 4QQFA 2FMFA 4RZUA 2WJHA 2AN9A 5BN3B 3IMGA 1KNQA 3DDNA 4QFBA 1N2GA 1B16A 4DVJA 5C1OA 1GNQA 1ODSA 5IARA 2FR1A 3QK7A 1GUZA 1SUBA 1T8SA 1NM5C 2PVSA 3H1FA 3OO0A 4LN1A 4PXSA 3VVLA 4DRYA 3SM3A 1GQSA 3IT1A 1UJNA 4ARIA 2H9IA 4N39A 2PZGA 3ANXA 1SQGA 2ZT7A 5KTSA 2KQUA 3WXBA 1OKKA 2VP9A 2ZP1A 3IEPA 4ZEXA 1G6OA 1YTLA 2YZ2A 1KAEA 3THWB 1WUIS 3Q88A 3RVQA 1JDUA 4WVLA 1QIDA 1N6PA 2EG5A 721PA 4QM6A 1E2IA 4NNJA 2EIHA 2RG7A 3MT0A 3Q10A 2ZB2A 3RKRA 3UXHA 4EVIA 2D06A 3CRMA 4ZDIA 1HNWB 1C0EA 3BH0A 4R84A 4XI9A 3WQSB 1FY2A 3VQTA 5A06A 1LNZA 3BL8A 4XGNA 3U2QA 2BMFA 2CLCX 5LWQA 4RK6A 1BHSA 1WOPA 2HJVA 3HJUA 3C14C 2ZETA 4CLDA 4UZSA 5JAOA 1GPH1 5J35A 4MUGA 3ROGA 3U3KA 3V34A 2BKXA 2FN8A 4I9FA 3VYUB 2GD1O 4CXMA 2QB5A 4YROA 4JC5A 1KH3A 1QYVA 5FLKA 4ZCPA 3UK7A 4R1PA 3INRA 1I32A 1M8KA 2G5CA 3LQYA 3DDCA 1IQ0A 3LVBA 3FYSA 3I0NA 4LJ6A 5CVJA 1XQBA 3BFVA 5IW8A 2Q7DA 3GDFA 3ZDYB 3U44B 1YQQA 1KPHA 3FPGA 5K2MA 2F3QA 1Q0SA 1HBJA 3GBSA 1KE2A 2OZLB 3HI4A 4LBYA 4WKCA 3I52A 3UAOA 1WTAA 3F5DA 1K8AD 2AG8A 3HEAA 4KVAA 4X65B 2E37A 2WUGA 3V8PA 3LY8A 4ED9A 2Q9CA 3PFCA 2GN4A 1LDGA 5BSYA 4Q7LA 3TSCA 3H94A 2C1ZA 3R7DA 1KP2A 1UODA 4HLCA 1AMNA 1E3ZA 4LYGA 4G0VA 4KJZA 1IH8A 2DLDA 4OOEA 4BQSA 5H70A 1GKLA 1P33A 1WKBA 2IVZA 4O5OA 4MQEB 3TZKA 4PLGA 3UKDA 2ID9A 3AX6A 3CF6R 1LLQA 1P74A 1WCWA 3O8LA 1WSRA 4LGYA 3IQIX 2OBFA 1PKEA 2O0HA 4I1SA 2E5FA 3A4VA 3EVZA 1DG9A 4JR1A 2B1QA 4XOTA 5CW2A 3WQBA 1U7PA 3C6KA 4G26A 2I4LA 4G67A 3L8GA 1CNEA 2H3HA 3NHYA 4WGGA 3RRYA 2BM0A 1CY2A 2G25A 4N6OA 4E32A 5HP4A 3WKCA 2COEA 2HQOA 4I0WB 4F7DA 2MJLA 4FNGA 2PMFA 4ZT5A 3OWHA 3TNLA 4JC4A 4OHBA 1LW6E 1X80A 4NFLA 4AJ9A 4O2LA 5CDTA 5TMDA 5HF8A 5MFPA 2Q1UA 2RB4A 3KV1A 4PNEA 2DFVA 2VRNA 5LLSA 4EHBA 3DZKA 2ZWVA 4HAWA 1FS5A 4BVJA 2C96A 1XZDA 1QO0D 4I1VA 4L0DA 3R7AA 5J59A 3DVQX 2F2TA 1G8AA 1SXJC 3DKRA 4KIJA 4XR9A 4Z4IA 1SXJA 1DCMA 2OVBA 1FDVA 3WLTA 1E2BA 3FUTA 1VQOB 2C4HA 1D04A 2PBRA 3AQ4A 3NRCA 1EWVA 1U0BB 2BKAA 2C9OA 3D6AA 1OLXB 4OFXA 4LSGA 4WY5A 4O2BA 3B3AA 1FP7A 3F3MA 2GBFA 4GP7A 1EZ1A 3Q85A 3VO9A 4GPAA 4MKXA 1HGXA 1WU8A 1UDAA 3TK1A 3Q9SA 1OKKD 5CFLA 4J1QA 4RCYA 5DYGA 3GARA 1M0TA 1VIMA 3UOAB 3VJKA 3ADPA 2ZIUB 1X7ZA 1NBME 3FTNA 1XKXA 2X9LA 3L0IB 2PX0A 3FWNA 3GMDA 4G5SA 4JQYA 3PC7A 4LZOA 2VDQB 1B8NA 1IZ9A 1XRRA 3O8QB 4KQHA 4Q34A 3WL5A 3LECA 2QTWB 5HRAA 2ZUVA 2JI7A 4AO8A 3TSWA 3WWDA 4YMUA 2HMWA 2C29D 4QX6A 1H4TA 4YECA 3B8HA 3CRZA 1EUCB 5C81A 4HXEB 1L5LA 4W7HA 3O1LA 5H82A 4HTAA 1I6KA 1K0FA 4Q4DA 3T1QA 4ZIRB 3SLDA 1CZKA 1PI3A 1WQ1R 2YJ5A 1R9NA 5CX1B 3LKVA 4DA7A 4YX9A 4V0ME 3UMBA 4BFUA 3G2LA 1XNQB 1IUKA 1AKUA 3PZRA 2OCAA 4GQBA 4MVJI 3MT9A 3ECCA 4YJGA 2Y1KA 1Z17A 1BXGB 1J7JA 4MWTA 1YQUA 2Z95A 2Y93A 3C6ZA 1V39A 4KUEA 3RANA 2NW6A 1ENYA 1YH3A 4CYMA 3AF2A 1XQ6A 2JGDA 1SCQA 4XOPA 4PZCA 3KL9A 4YMSA 1OH8A 4PCUA 5CDFE 3SHFA 1CUAA 3L6EA 1MXHA 3ADBA 3CNBA 1ECFA 3H7AA 2QTRA 4JUFA 4KTVE 3F46A 2X0FA 1OYOA 3U1TA 3D0QA 4EX7A 2QYOA 1B14A 1S02A 1FRFS 1ENZA 4HH0A 1QV9A 5FFNA 2E1BA 4KH1A 3KKLA 5AXBA 3OOCA 3ZZMA 3NOXA 3I62A 5AVVA 3FVVA 3U6KA 3TLAA 3I6ZA 4N9WA 1Y0BA 4KXVA 5G0UA 3DAHA 5DEIA 1YB7A 4BO3A 2QZSA 3CLSC 1U6JA 3MINA 3T6KA 4XCQA 5CURA 2RGNA 4ZCSA 5HX7A 1UZMA 3ESDA 2NP6A 4E0BA 1XF9A 5JYBA 1QF6A 1OAOA 2QR3A 2IDMA 4IDHA 1UC8A 1W35A 1YS7A 3AVXA 5LDHA 3NT5A 3ROMA 4DR2B 3ODGA 4P38A 3CVXA 2BCEA 4P35A 2CLLB 3PUIA 1XWWA 5AVRA 4F5ZA 5CX1A 3HYRA 5JYEA 2XAUA 3PEEA 1KAGA 3EK2A 2HRDA 3R0QA 2I87A 4LHYA 4NYJQ 3R5SA 4U00A 4WEOA 3V1NA 3ZU4A 9ABPA 1K5GA 1U0EA 3DB2A 4W5NA 3RWOA 3BGVA 4KGVA 2C4VA 2JGRA 1FU7A 3EMVA 5AIAA 1SB8A 5CIQA 1FQJA 5B3LA 2OBXA 1FJGB 2C61A 4G2NA 3CVYA 3DV0A 3IAS6 1FFDA 1C7EA 1QCZA 2WYUA 1JDNA 1H3EA 2HTFA 1U28A 1A8QA 1YMQA 5TS3A 2DKOA 1QS0B 3Q1LA 3INNA 4X0CA 2J33A 3HCDA 4NNPA 5TGDA 1USKA 1U5BB 4PO1A 1UQRA 4C6TA 1S2DA 2CWWA 3ZDQA 2WZNA 4CL3A 1CETA 2XWJI 3ZVKA 2ZAIA 1XZBA 1NBWB 3LKDA 4FXPA 3PEWA 5KDOA 4XJSA 2P62A 1VQ9B 1NXTA 2Y05A 1BWSA 2Q3DA 3Q8WA 1IB6A 3JQEA 4R1MA 4XRRA 5E95A 4C43A 4P92A 3L4JA 1ZXLA 1N0WA 1H4SA 4KNWA 1P2TA 2KM1A 2HCRA 2P30A 2WJZB 3B36A 1WDWB 3GR6A 3QPAA 4I1OA 4L4XA 2ZREA 5FUYA 4P33A 4XIIA 3VPXA 4D26A 3X1YA 1SBQA 1RSZA 2ZBQA 2C8LA 2GS9A 1WZCA 3JYHA 3R4VA 1ILWA 1IDOA 5K03A 1VLVA 3TLYA 1LTKA 3QUQA 2D4HA 3W3AH 2G5TA 1J1UA 1QH8B 2CCJA 1ORTA 3JD2A 4LEIA 1JJAA 4DXDA 2P9YA 3ZHUA 1EUQA 4WXMA 2IYSA 2C7GA 4CI9A 1KP9A 4AJEA 1FQKA 1ZRSA 5REQA 1AS0A 5FNVA 4L2IB 4PTLA 2PZ8A 3D4PA 3N3BC 1RACA 3TD2A 3P9PA 3VPAA 1CQPA 4XWAA 4OLJA 2NTJA 3OSZA 2V3VA 5F76A 1QHSA 1G2QA 2FW7A 4NTZA 3VTFA 1KH2A 4QBTA 2D6FA 4PHCA 1RM4A 2ZAYA 1CVLA 3WL6A 1KIFA 1P1FA 2O9JA 4G2TA 4JP2A 1NR1A 2IU6A 2O0LA 3AM1A 1DEKA 2K2WA 4YGYA 4BWFB 2ZL5A 2R66A 4QJIA 2JI9A 5TC4A 1G0NA 1SHTX 2YRFA 2EKDA 5A6SB 4B85A 4TPKA 4ZYTA 3WKDA 2HLPA 2H63A 3IVRA 1RQRA 3S2YA 2O2JA 1IQUA 1ETUA 3K53A 3L0ZA 4Q48A 1UF9A 1XZAA 4MDYA 3EZ2A 1E8MA 1U2EA 4BC1A 5IKMA 1KFBB 2NU6A 3JPYA 5HSGA 2PA0A 4L22A 3I72A 2JGIA 1J2EA 1ZVMA 4U2CA 1BRMA 2V31A 1IBLB 2XUQA 1RMTA 3DCJA 4BFVA 2AGVA 4FD3A 4ZO7A 1KFJB 1SVLA 4HNQA 4K6HA 5A3QA 1CK4A 2ACWA 3QQPA 4IHKA 4KB5A 4LJ9A 3EIQA 2A9OA 4TYMA 2VBCA 4QUAA 5TQ2A 3U3JA 5JPIA 1VJSA 1DIBA 2IKQA 3LJKA 1TKAA 3ZLBA 1BWPA 3IMCA 3EVAA 2FLKA 2I5PO 1N2XA 2QRGA 3U9TA 4EKNB 1GAWA 4KJXA 4X1KA 1SVMA 3EC7A 3DDOA 4WESB 3TNDA 2F6RA 2WT8A 5DCYA 3HSYA 1T6ZA 3SOPA 5CDFA 5JMWA 3TGLA 4HIZA 3GFQA 1P0MA 5EE9A 2OYRA 4TT3D 4OI4A 2WDPA 2VTKA 4LDPA 5I7VA 1Q57A 4OLAA 1W9HA 4EMTA 4YP5A 4JVMA 5FPSA 1N2IA 3SAJA 2EEPA 4YAJA 2BFCA 2GA8A 4HG2A 3DEZA 3V6MA 2IP4A 2Y1GA 3PU6A 2XGJA 2ODTX 1PNRA 4C2UA 2XDAA 2QTBA 3CQ9A 3S29A 1SXQA 1D07A 1KEPA 5DBIA 1KI6A 1G2PA 2VSFA 2WIJA 1WD7A 3IX7A 3BXHA 4LY6A 3FWPA 3Q72A 2JD1A 3EMBA 3K9HA 5KPDA 3ZHZA 1S72B 1UK7A 2OFFA 3BMNA 1W5AA 2CEKA 1NG9A 3D64A 1ZIPA 1RRCA 4E0FA 4FZRA 6REQA 3B48A 4IJ5A 2CWDA 3B9PA 1R50A 4FFBB 4MDFA 1UM9A 1EWRA 3MRXA 5FBVB 3MRSA 2VPXA 2H1FA 3VYRB 2JAOA 1Y3BE 3VKGA 4FM9A 2D1SA 4HI0E 1TLLA 2BOVA 3GLHE 4UZUA 1M2HA 4FDVA 4RSRA 5KINB 2EERA 3FMIA 3UICA 2QUAA 4A4DA 2NXCA 4YCMA 2BE7A 5G4LA 4E1VA 2OL4A 2Q0SA 1NB9A 2AEFA 5JJ5A 1W73A 4IKEA 4MS4B 3D4IA 3CW9A 2FDRA 3WYCA 5ISMA 4KR3A 3F1LA 1XNGA 2IXGA 4RLHA 3M89A 5ALZA 2WNIA 1H05A 2HY7A 3GHYA 5G0VA 4B35A 3DM5A 4Y7DA 4BEBA 4WBNF 2ODWA 2AVNA 2P41A 5HYVA 2JHGA 1JMVA 1RKVA 3O4VA 4K9NA 2C95A 5FR1A 2EZ9A 2F3UA 5TVKA 4QTXA 2R6DA 1KO8A 2OHJA 2Y0BA 4MR8A 3CJRA 2QK4A 4JJEA 3KSDO 1L4GA 2BBSA 2VPZA 3ORQA 4X3PA 4J6EA 2WV7A 3GVKA 2RH4A 3D3KA 3Q9UA 3T7KA 3E9YA 5A89A 1CW2B 1V4NA 1YVRA 2GEVA 1A2OA 2WD7A 3F96A 4ZVSA 3GG2A 4M9ZA 1E2JA 3WQHA 4DG5A 2E2WA 3W5AA 2Q07A 4H0NA 1Z74A 3O91A 3ZV7A 3ESYA 5I9IA 2NMVA 2GJAA 1WOYA 2XB4A 2G1KA 3KEOA 2AJDA 1E4OA 5L3RA 5KX5B 4MYRA 3WK6A 2FFRA 3R7WA 3TNYA 1Z7BA 2HGSA 4GM0A 2J07A 1UWKA 2Y6VA 3ETCA 4XLFA 2BMAA 3L7NA 5EZQA 3ONYA 1GTL1 5HGJA 3F1KA 4B32A 3FYCA 4ZOLB 4J03A 5AJVB 1QCCA 3HJAA 1VHLA 1CQIA 1DC8A 3HEMA 5EIEA 5B64A 4NQRA 4HSEA 4Y9UA 4IJVA 2VAVA 3A6GA 1Z4QA 3PVZA 1HK7A 3GRUA 2LCIA 3TLKA 4BV3A 4BX9A 3CKLA 4DMMA 5JAMA 4F8JA 4NE9A 1MT3A 2E4ZA 2JD0A 5FL3A 2HA6A 1GPKA 4HYEA 3GJRA 3OKAA 2L69A 4BNGA 3PUVA 2DFTA 3FWHA 4LKRA 1ZRHA 5L3SA 5IXYA 3NHBA 2XIJA 4AICA 1CEYA 2JLXA 1AGXA 4KBGA 1C1XA 3OOYA 2B7CA 1DC4A 1Z5OA 4OH1A 3IUNA 5LBTA 4IS2A 5F1KA 5JNSA 2H59A 4LDJA 1YOVA 4JL5A 4AM8A 2ERYA 3U48A 1T0UA 3TL3A 2XB6A 7ABPA 2C57A 3D6VA 3H6HA 5HK8A 1PV2A 2UYYA 4IM7A 4A6XA 3PXAA 4H60A 4IO0A 3HXLA 4XM0A 3H1AA 5ARBA 2OHIA 3W5JA 2CCGA 3CX4A 5JADA 2ETVA 1K6JA 1JHAA 1G3QA 2QU8A 4X71A 3HBAA 5G3YA 2CLIB 2FN7A 4XB1A 4X7RA 3HCCA 5EPOA 1BLIA 2ENUA 3V8NA 2WICA 3ICPA 4YRMA 2OBRA 2RBKA 2XBMA 4ZJPA 1FSSA 2FF5A 3FJOA 2X4DA 3BSFA 1PJLA 1N33B 3RASA 2BKEA 1LX7A 3AU9A 1JMKC 1L5FA 1PV4A 1UFKA 1ZLYA 2EZUA 2EZ4A 4H3KB 4WCFA 5D3QA 5TT1A 4XLLA 3GFOA 4CU5A 3GLFB 1OC4A 4MKRA 3ZLTA 4WBNB 3A1PA 1A9QA 1P9RA 1Z6XA 2WM9B 4CKWB 2D4AA 1LPMA 3MLEA 4AULA 2VZLA 4ZCQA 4FILA 5GINE 4BO6A 5KNBD 4NCHA 4EF5A 3NZEA 3TEMA 2W2QA 4AYWA 4EA9A 4LOKA 3KZNA 3AJEA 4DDHA 3BFXA 1AU9A 1ZD3A 5BSXA 3L77A 4J0KA 3PHBE 4IILA 4WLEA 3GUYA 2WWVD 3RVOA 2O2EA 4MAFA 4DTCA 1KYTA 2I6GA 1VM6A 1TMOA 5B7QA 1NVTA 3RY8A 4OM8A 3L7MA 3UQZA 2CEAA 3IO3A 4AX8A 4UBOA 5LNK1 3Q3HA 4URFA 3GGDA 4ER6A 4DDUA 1GR0A 4WCVA 2VKTA 3HBMA 2IPOA 4JEHA 1ISPA 3D2CA 1OB5A 3TFWA 1Z0UA 4PO9A 1E3MA 3AH8A 4KOEC 4C0HA 1ID8A 4XIYA 5K3FA 5TGZA 2W5UA 3I6IA 3WDSA 3KAKA 4ZREA 4AKHA 1N8RD 1UQUA 2A7QA 2R8OA 2IS2A 3HH8A 3FFAA 3DGFC 4J1TA 4KQ1A 4WOBA 3CCSB 1EBUA 1M34E 3KJHA 5DTJA 1IAQA 4KE9A 3NRJA 4WUVA 4DIFA 3O8OB 5ICEA 5L7TA 2BBOA 1UWVA 4E7OA 3DE5X 3A3YA 3GCDA 2O5EA 5DS0A 1RWMA 1ZA1A 2IOQA 5IDYA 1EUDB 1UD3A 3QSGA 4NJEA 5G3ZA 4MSUA 1KK0A 4N7BA 2JC3A 2Z58A 3JATB 5JO0A 2VP6A 1MHPA 2PSFA 1VLJA 4DLVA 2ZATA 1PUIA 1SUFA 4G0MA 2PUFA 2R4UA 5CJ2A 1DC7A 1RYYA 1J90A 3AKYA 3LE8A 1YVPA 4Z4GA 4BFZA 3KR2A 3LC7O 4MRRA 3UMJA 5LQAA 1CUZA 3PFBA 1BCRB 4N0DA 3OJXA 2CHGA 3Q7QA 4F4DA 4K9LA 5TE9A 1WMBA 1Q0ZA 2OORC 2RGDA 1T26A 4MOWA 4LHWA 2PUWA 2C7RA 3V7FA 1CUDA 5CLJA 2XJ9A 3B3QA 4WKGA 4G7XA 4PG7A 1P1RA 2HU7A 1A1VA 1UXJA 4K6OA 1II8A 1CEEA 1YE8A 1NYTA 4JB8A 5JDCC 2W2MA 5JCXA 3I42A 3N75A 3VTKA 4WOCA 1IFXA 5LSAA 3QA3E 13PKA 5GM1A 2CMGA 4QQNA 1XD2A 1Z0AA 5FXMA 3RSQA 1Y5MA 4IUBS 3WLOA 1O77A 1XT6A 4BJ1A 1NJ5A 4AG5A 2JHAA 4LXTA 1E8NA 2IIVA 3BA1A 4KSCA 1EE1A 5CHYA 2OXTA 4PN3A 4IFEA 4DV0B 2CBZA 5ELXA 4Y2XA 4DK1A 1TRHA 1GFSA 2W70A 5C8XA 3CSSA 2IU4A 3OY2A 4IH1A 3RV4A 4OP2A 2PUCA 1KJNA 1WW8A 4BMNA 1ZMTA 1W44A 1DJQA 1PJ2A 4OU4A 1SZPA 2X3UA 3S2FA 5EUCA 1XB2A 4YEDA 5AVXA 1NFQA 4BDTA 1U7HA 2BEUB 4G09A 2RHHA 1OTYA 1LF0A 5JJLA 3SIWA 3DKIA 4QBFA 4JGGA 2E1RA 1QV6A 2N1MA 2FKNA 4COKA 4Y1EA 5H80A 1ABBA 4AF7A 3ASQA 4NDZA 4P34A 5H83A 3SU8A 3M6UA 4Z7JA 5F4ZA 2OQRA 2QTVB 1PL8A 1L5HB 4BFYA 5DRYA 2H5LA 3FYHA 4I5FA 3BWXA 2AEJA 1WMDA 2JI8A 3F5FA 1GPLA 3DH0A 1LF5A 4BVAA 1BE0A 4JBIA 3OPOA 3UUGA 2V7VA 2W6OA 1EJ0A 1U0SY 2F4VB 3OEWA 1EFVB 3CLKA 3QMVA 2XUHA 1S2GA 4UCFA 1H8ED 1GT6A 5HPYB 2VHQA 4ZYZA 1X1AA 3PX7A 4EY4A 1OTXA 2WKWA 1PWZA 3EG9A 3OQOA 4J9UE 4AJPA 3TOXA 1WSWA 2JGEA 3S8YA 5KWIA 1LQTA 5EGNA 2E89A 1GPMA 3LP6A 2CKDA 3UO8B 4MQBA 2GDJA 2ABWA 4IWYA 1XCJA 3FCXA 2EV9A 1A04A 1QO7A 1VL2A 3CR8A 5JI3E 1XRJA 4YP7A 4BFTA 2XMDA 3WLNA 4CMHA 8AT1A 1ADGA 2EQBA 4KREA 1FFXA 1XP8A 1JPJA 3ZNQA 10MHA 3V3TA 2QR5A 1TLTA 1XC7A 2GARA 2LXNA 2OCIA 5HCNA 2JKYA 2FEXA 2GWHA 4K05A 1W2BB 1A71A 4I50A 4HMQA 1KQSB 1FNNA 2BL4A 1UANA 1I36A 4ITVA 4MVWA 4YCSA 2WWHA 3EX7C 2H1LA 4BXOB 1JFFB 3K6KA 5EWJB 3NI2A 4LF4B 1UT5A 4Z2YA 1N2OA 2MSCB 4DDMA 1IHOA 2X9QA 4IOJA 5ALHA 1I1QB 4KXXA 1NONA 1FZTA 2I4IA 1EFAA 5FF9A 3RE1A 4PWZA 3QF7A 4RZ2A 3W34A 4F4JA 2XIQA 1AV7A 2Y71A 2PX6A 4OUKX 2R5NA 1ATZA 1L7DA 1U99A 1RYNA 1Y1RA 2M98A 2H5JA 3NM6B 5AOAA 2X6XA 2PL3A 4ZI7B 4KSYA 2RH9B 1BVYF 1XTSA 1EFPA 2B2NA 3ZWQA 1KETA 2EDAA 1U2RA 2B5VA 5CLHA 3EIUA 3WMRA 1S2LA 3JXEA 3WKEA 2ZPAA 5I7UA 2XMBA 5FBLB 5IDVA 1OWNA 1E7QA 2I2AA 2AWOA 2MU1A 2O7VA 3MELA 4HAUA 3IBYA 1NE7A 2JCBA 1A5AB 1SC9A 3G5AA 4JBYA 4PZLA 3ASRA 1ZQ1A 3G5TA 3EIFA 3RFCA 3ZR4B 5LXTA 4IG4A 2PQ6A 2Z6UA 3CTPA 1NHGA 1X80B 1OFHA 3C6MA 1N1DA 2PSJA 3IUEA 1F7UA 1AS2A 3GPIA 4RZQA 3I6QA 1IG0A 1JRLA 2BZSA 2ZR0A 1VIVA 4PNZA 3UC5A 1F17A 1HM5A 1YK0A 3B9BA 2Z04A 2AFIE 2GPNA 3GUCA 3TB4A 5IH7A 1MENA 5KVAA 1YFZA 1PYDA 3EDOA 3TECE 2NXJA 2XRYA 1TCAA 1GFIA 1ZOSA 2IW1A 2QV7A 3GLGA 5T4HA 3D43A 2NXEA 3ROQA 3FNBA 1Y7LA 3HGQA 2QL6A 5AHWA 2D0OB 1CSEE 3CE9A 5FUMA 1MFZA 3GW8A 3UOGA 4Y9DA 1XO1A 1RRPA 4M1WA 5J5VA 1M5RA 2VYQA 3AP1A 2GSWA 1K7FB 3D5EA 1VLOA 1E3WB 3NDJA 2C0PA 1A9OA 5FAXA 3KT0A 4D9JA 2F1HA 4RJIA 2VBVA 1FEZA 2Q3LA 1ZD2P 2IYXA 2X8JB 3CU5A 4IDOA 4OHXA 1JBEA 2BHTA 3HUUA 3UWKA 4HLUC 5ICGA 3JAKB 3F9CA 1MJFA 3KC2A 3RAPR 5DHUA 5BW5A 1DINA 2GI4A 4IVQA 4CFSA 3EBLA 1PTKA 1I9GA 4IPTA 1XWIA 1GL3A 2AUTA 3FZYA 2VDVE 4OOFA 2GHQA 1KK1A 2R8BA 5KTOA 1AB5A 4BLVA 2QRJA 1NAHA 2GXSA 3Q0IA 4JS0A 1FSZA 2ZJ0A 3MOIA 1XTZA 1Y8ZA 7REQA 4EYKA 3WNBA 1NI4A 2JD2A 3NHMA 2YWXA 2CXPA 3CCQB 3JSXA 1R3DA 2GJ9A 2BFNA 4OY3A 4UUBA 5J2UF 5T5QA 2ZJ7A 2UZ1A 1ZBQA 3N0VA 3GNSA 1UDXA 1PGPA 1WPCA 2AQIA 3BE8A 4PYRA 1C9YA 1I4EB 2GM3A 3DXZA 4IMJB 3D02A 2IIPA 4Z0PA 4CV3A 3PLNA 5C5EA 1WQ4A 5JPCA 4OP7A 3SSAA 1BYUA 1TOAA 1T3GA 2HIGA 4BTEA 1C14A 2ZWIA 3G89A 4IOLA 3CVVA 1A9ZA 3HDYA 2HPVA 5FT9A 2O1SA 4KVFA 2I65A 2I03A 3GNLA 3KR0A 4PFQA 5JVDA 3T7DA 5FV7A 2JFVA 2FN4A 2TECE 2YN2A 1NLMA 1SHUX 1GDTA 3H19A 1V45E 3TG2A 5HXAA 3MFYA 3BWEA 5KNCH 5JDIA 3B1YA 4OSOA 3W1EA 2O2ZA 4IDNA 4D79A 1UP6A 2AOUB 1FDSA 4PLTA 3DMTA 2DHEA 1RHJA 4D5EA 2HJ9A 1FFSA 3QVUA 3DOCA 1U1DA 2Q8NA 2FPRA 4FHFA 3ZY6A 3F67A 3GSIA 3VZRA 4CM4B 1PS0A 3EZLA 1E2PA 2NO4A 3ZE6A 2BFEB 4FEGA 4CG0A 4P3OA 3OF2A 4RK5A 4A2WA 5BSTA 2YBDA 3OLCX 1EUZA 4DLTA 4MV3A 1I24A 2Y68A 1A8SA 3NOOA 2QUHA 4BV8A 3QG1A 4EY6A 3GHHA 4X60A 2Z2JA 4PPYA 1JPNA 2NWQA 5IEBA 4N82A 2I1VB 1N78A 3GEIA 5HMLA 1RYFA 2QMHA 1DKUA 3IQHX 2VLIA 2C5LA 4KVGA 2YQ4A 3R3VA 3RFUA 2BW0A 4C78A 5IXJA 3C2QA 1MC1A 4TGLA 1PAUA 5HTOA 4KC0A 1SEPA 1BQ4A 5GGXA 3I61A 5IYWA 4UPEA 3K0EA 5AJUA 2SCUA 3T54A 4DJEC 2A1TR 2WTAA 3AUUA 5BP7A 4AY2A 1DXYA 2YMMA 4R54A 5AHRA 1OVGA 1WMFA 3NTUA 2P79A 4G5RA 4TV9A 4R81A 3P5SA 3RLFA 3FBTA 3TOZA 2QT1A 2Q4RA 1FK8A 4LOJA 2B25A 1RYDA 1ZHOA 2QE7D 1CUBA 3AOEC 3O95A 4XPIB 3THSA 1K9SA 2OV1A 4UTXA 5CCXA 4RY2A 3I64A 1XVTA 4B6FA 1ZA2A 3O8DA 4HADA 2GCOB 3FUCA 1EINA 3W9SA 1TYDE 2JANA 2A59A 1UCFA 3I01M 4NK4A 4OHZA 5IDXA 1RXCA 4RAQA 3VJMA 3H04A 2Q5JA 2A67A 3IA2A 3FPBA 3T7AA 4NF2A 4IEIA 5A7GA 3JQFA 2C3UA 1J8YF 2X8BA 4B4KA 4BFSA 2F17A 4L6IA 2WTEA 2PUGA 4G6IA 4RE6A 3CH6A 3QJYA 5FPHA 2JF0A 3QHQA 4FMDF 3SQWA 4IDAA 2BGTA 4OQXA 3B3JA 1VSVA 4F4FA 1Y6RA 2OHHA 4I4TB 4ANFA 4MW7A 2CZCA 3SZMA 4X20B 1VXOA 2BI4A 1MDFA 4KQMA 5GOZA 5C5DA 3MRVA 4FE7A 2DHDA 4B48A 1OV6A 2M5SA 2CCKA 2DQ4A 4B4VA 3GJ7A 1C0LA 4F0JA 4Z4QA 1FE8A 1N05A 3NIFB 3WIVA 4OI0A 2NAFA 3QLVA 4QOSA 1FPQA 3PBKA 3ZD6A 3TNJA 3LPNA 3FNGA 1N7HA 3N53A 3FD8A 3WHLA 5JNUA 4ZO6A 3GJ4A 3I37X 2W98A 2G9VA 2YYSA 2G06A 4QTYA 2QV0A 3PFWO 4D4KA 3LX6A 1AA9A 2YUTA 3OE5A 1EWTA 2ZYVX 4OHCA 5ALYA 5HOEA 2GLTA 1TFRA 1L1QA 1RZVA 3KO8A 1XYVA 3UMCA 5JHHB 4N12A 3MJTA 1APBA 2CGEA 1DI0A 4BGDA 1K06A 3BSYA 4GUAA 3O8RA 1BS2A 1SR8A 1UZLA 3OZCA 5AHOA 2PLAA 1ID1A 3BAZA 2E49A 2QA4B 1ZGZA 1WV0A 1J25A 3EXHC 3MXOA 3BXEA 2WE7A 2OK7A 5JSKA 4E70A 5CMLA 3LYLA 1RI1A 3M34A 4QHTA 3MINB 4FJ1A 3OESA 2H51A 1YGYA 2ONKA 4CTNA 1W6RA 4LHEA 4EAQA 1JKJA 1VHJA 1FFYA 4MI9A 4EFDA 5DM4A 5DP2A 4OOSA 2GZMA 3RFVA 1OE0A 4XNFA 4CCWA 5C8YB 4D4MA 3P9YA 2G67A 2IY8A 1CP3A 3VO1A 1LLFA 2BHNA 2ECFA 2OPBA 4B4DA 4P08A 3T0IA 2GESA 1QE0A 1SQSA 3OX2A 1TIPA 1QKIA 3HVRA 1H1DA 1I80A 1RM5A 1X1RA 4W5HA 1VPVA 2W43A 3E18A 4DCUA 3ZGLA 2CDNA 2I4NA 4MV8A 3JYLA 1GTVA 1TZ2A 2EJWA 2V7GA 4BV2A 4DIDA 1LI5A 1C1DB 2BISA 4XYMA 5DPMA 3CWQA 3GA5A 3GD5A 4PW0A 1L7XA 3LHDA 2IV2X 2XUOA 1NKSA 1TRKA 4DLBA 5C8ZA 1J7KA 1XMJA 2IYUA 4M38A 1EGMB 5HKKA 1WMSA 4M83A 2AMFA 4WOPA 1Z33A 1H9BA 4MHOA 1KDZA 5IDWA 4D8WA 1RDFA 2LNDA 4BECA 1E2GA 5DN6D 4Z9XA 1QS0A 4HZGA 1IJBA 2XA1A 2IYPA 1VCIA 1UMBA 1P60A 1VECA 3QXXA 4EO9A 3IIEA 4JL8A 2HWWA 4XWTA 4E5KA 4H16A 1R8XA 1VHDA 3P9KA 2ZTHA 3C3XA 3IDZA 3A7DA 3A9UA 3IURA 4JAVC 4XA8A 3L06A 2ZAGA 4NFYA 5DHPA 4C20A 3WLRA 4DLSA 3V2HA 2WZPP 3LGAA 4LJAA 4AJOA 1DJNA 2H0QA 4HK4A 3GJ3A 4ZOAA 4AQ7A 2ZRFA 4EG8A 3RJ9A 3I30X 4A2PA 3NIDB 4HFNA 3RRFA 2VJIA 1WHSB 3BAFA 3CYFA 4F86A 3G2OA 2JK0A 1EFLA 4BE4A 4BZQA 4ZJZA 4TVOA 4M8LA 1CWUA 1XRLA 3OHSX 3JZMA 1GPNA 5FLXA 1RPZA 4MRVA 3TO5A 4RJJA 4Q7QA 2WIKA 1U3UA 1T9GR 1LI4A 1T2CA 1MIOA 3AEKA 3KKKA 1J49A 1JZQA 3KPVA 1M6EX 4IKPA 4WNAA 5T4BA 3RHSA 4DJAA 5CT8A 5EXXA 1MRNA 4ZYLA 2PMCA 5ED4A 4YWJA 4TYNA 3T5TA 2QAJA 3KT8A 1F2UA 2JGKA 1N08A 2P9GA 4RIIA 1Q77A 2LE0A 4LXUA 2VBSA 3T4EA 3KYIB 4GQNA 3C43A 3RYCA 1JF8A 2P4UA 2DECA 5TF0A 1UD4A 1PZEA 1E1YA 1E6MA 2R7KA 1F2VA 2WD8A 4BZPA 4HDAA 2F1OA 1DQZA 1XTQA 4EJSC 1JFFA 1U6KA 4CTJA 1QDUA 3MTDA 5AVQA 3UG6A 5HGXA 1QRRA 2JFHA 3U0BA 3K5PA 2NU6B 4KDCA 1YAJA 1U0JA 1V5WA 3BGDA 1SOAA 4PR0A 1OD6A 4ZOEA 4PC2A 1N6LA 2OOSA 3GGPA 1BOFA 1YE3A 4WK6A 3WL4A 3IXLA 4HWGA 2PO7A 2W6MA 2FR8A 4YIHA 4Y8VA 1QKKA 3AR6A 1IBSA 3I5UA 1DQRA 1OBCA 1Z3IX 3OEED 1OBFO 2B4KA 1CR6A 5AKHA 4L3VA 1XXHB 2OZPA 1QB8A 1PT6A 5BYAA 1L4HA 1GYRA 1ZUHA 2Y1DA 3KK0A 4O33A 4V0KA 4JJ7A 5H0IA 4JI4B 4WA8A 1G42A 5FIUA 4BBZA 3IR6A 4IMRA 3TX2A 3WYAA 2E4AA 3EYAA 4MTCA 5J3OA 4Y2UA 2O8DA 5FYQA 2NT3A 3DAGA 4IQ4A 5LDGA 3TD9A 1M66A 5JYDA 5B37A 5KJ6A 2J85A 5GJVC 3WBBA 2B2CA 2WJ4A 1G20B 1KXZA 3IOMA 4OHRA 1XZLA 3OE4A 3RU3A 2AYZA 1DJLA 4DKXA 4YONB 5JD6A 4R1LA 4KQJA 4HGPA 4LGCA 1MX9A 1NXWA 3VU3A 1N2BA 2ODQA 2CK3A 1R0KA 1I14A 4TXJA 2O8NA 5EKUA 1OB2A 5TT0A 3HUEA 4RTRA 1PS9A 3PE3A 4JWTA 4E13A 1W1WA 4AJKA 1H9CA 1K2WA 2M2IA 3GL9A 1I1NA 1M8PA 5K0FA 2DB3A 3BCUA 1VYTA 2DFPA 2RJOA 3NIGB 4IQ0A 4K26A 4RJ2A 4L5IA 3SXJA 1SIUA 3L0PA 1TAHA 1OHHA 4X24A 4X1KB 3TQOA 3JVVA 4OYYA 1P72A 4JP1A 4U1RA 3E2PA 5CBKA 2QVYX 4RPBA 5MHTA 1P3Y1 3LCUA 7GPBA 3VR2D 3A3NA 4CEIB 2PRSA 3AF3A 3GLHB 4YRFA 2IWHA 4BP9A 3ESRA 2AKYA 3PD1A 2IJGX 1T5EA 2ZBEA 4HRAA 1KORA 2VBUA 4HX2A 1DOZA 3E9EA 2ZZGA 1H65A 4NULA 4RW0A 2WJWA 5B3JA 1CLEA 2NVUB 3ROTA 4D0RA 4DCCA 5KOHB 4R7TA 3FY4A 1QAOA 4Y6GB 1SCIA 2DULA 1PE0A 1WORA 2Q50A 3LQKA 2X5JO 4R41A 5EP2A 4Y30A 4HH3C 4A5SA 1CUGA 2DE0X 3I9OA 1V1RA 2DLNA 2QLBA 4P7BA 4IIGA 2PUHA 2ZSFA 5EJ2A 1I4WA 2I99A 2QXYA 2JIPA 2DGDA 2XUIA 3P9ZA 1FS6A 1SBYA 5E7MA 4DSZA 2WZDA 5EZSA 4P22A 4TLEA 3EF3A 3TLMA 1TECE 4PO8A 5B5SA 2GQFA 2YMQA 2YWBA 3G7UA 4HN2A 4U2KA 2BSQA 2YVLA 2OC9A 2WF7A 3Q3VA 5FTMA 3P0RA 5JH7A 1KI1A 1NPDA 2XBUA 1MVLA 2GETA 3QIAA 1CP2A 3FIJA 3ZX5A 3A2LA 3L46A 1Y3FE 2FUCA 3LXXA 4TS9A 2CFTA 3KCNA 1NOKA 3K4QA 5A05A 3KX2A 4JI0B 4J7AA 5EIOA 1VPLA 5IJ9A 3OCYA 2JCYA 4GOND 3QUAA 1JXMA 4JUBA 3TN7A 4QOJA 2LP4Y 3IJRA 4Q21A 3E8XA 3GT3A 3ZHTA 1I2CA 2BJVA 4IICA 1N36B 2PZEA 4OBWA 1HYGA 3EQ9A 1QVVA 3JARA 3TL2A 4E33A 2YV1A 4C4OA 5I4BA 3ETGA 2Y1LA 1Z0FA 5EIWA 4CR8A 1CR4A 2JIDA 5HILA 4J4BA 1ZSNA 2H52A 5ESDA 4ZVKA 3TSAA 2PKWA 1YGPA 1UBUS 4L16A 4P98A 4HX5A 4MRSA 4LX8A 5BQFA 3QFHA 2FSPA 2HRCA 4OGFA 1GP2A 1BJKA 3RC1A 5JISA 5ADWA 1FU8A 2O23A 3CG0A 2ISSD 3PQFA 2F8MA 3LK7A 4IHJB 1FFHA 3UA3A 1JI0A 3DWIA 1T8WA 4GOXA 1K63A 2X7HA 1ZIYA 5FPPA 2WWWA 1G5PA 4AKIA 5F33A 3PDUA 2W37A 3S28A 2QLLA 2O6LA 3CCJB 3OT5A 3IODA 5B6PA 4YAIA 1G4AE 4RV5A 3CLVA 5DYNA 1USVA 3EMKA 1U0TA 2IHKA 1T6YA 3EAQA 2ZBFA 4P3IA 4ALNA 4LK2A 2HA0A 3ZXYA 4FZJA 5I7AA 3CWCA 5JC1A 1ZBDA 2WSSD 1WU7A 3KUUA 3Q87B 3O4GA 1N75A 1YUBA 5I4KA 4S2EA 4UU8A 1YX2A 4BLOA 2D5CA 1XOIA 4KGZA 2J0UA 3ORFA 4WKBA 5CT5A 5JNTA 3UJ8A 1EG2A 3MGCA 2XYQA 4JI2B 2LGJA 2WNHA 2IHVA 1KI3A 3TCNA 4TROA 3HP4A 5AM2A 3QW4B 4C1NA 2YNMA 3ONUA 1X9IA 2ZIWB 1CIPA 1OI2A 2DBYA 2YVUA 4BMYA 5I9LA 3RGWS 3N8DA 4RTSA 3EIHA 2ARKA 1G4HA 1R6XA 4C21A 2IBTA 4ROSA 3B85A 1K3FA 1QONA 4YCBA 2A5GA 1VKRA 2P9TA 5A0FA 1XMVA 1EP2B 3EZ6A 4W5OA 4DLXA 5BMOA 5FBHA 4ILEA 1E3DA 1ZUNA 1PW5A 1FP2A 1AC5A 4RKQA 1M2JA 4OPSA 3B3GA 1UMCB 1GZSA 2CHVA 2R4QA 1FVHA 3BD7A 3KHUA 4IGIA 4OJKA 5FOWA 4ZXPA 2BGIA 4XLTA 3USCS 4EZEA 3MMSA 2CBGA 3BMXA 1NF8A 1BA3A 3LBAA 4L8LA 4RD6A 4Q3AA 5HQ3B 1UFVA 2AN3A 4F4IA 3IE1A 1YOBA 1ZN9A 2WC1A 1Q7BA 2W6IA 2EW2A 1H0SA 2ZVPX 2AXPA 2QG4A 1C0PA 3A0RB 4MW0A 5C0OE 2R6HA 1T4BA 1W4BA 1Z4PX 1BGVA 4BBJA 3A4NA 1EK6A 2Z8YA 1DTSA 3AVOA 4P4GA 2HN9A 5DBOA 3VKFA 3VR6D 4PHGA 2GKOA 1M34B 1XI2A 2FX3A 2Y9MB 4B3XA 3AHIA 3R0VA 3E4CA 4GPTA 3UJDA 5JHGB 3A1EA 3TQFA 3D7NA 3CCMB 5H7XA 3ZKAA 1JT9A 1A8UA 3BQMB 4B81A 4DCSA 1EWQA 4UZEA 3OLQA 4ZYUA 1Y5IA 2G36A 2OO7A 3Q7RA 1SULA 1TCVA 2D5IA 2P2LA 3K20A 1N6KA 2EAUA 1EX1A 3SQNA 1DIRA 5AR1A 1NYQA 2ENWA 3K9LA 1FFXB 4WLVA 1M2GA 2WFLA 4HJXA 1ZJ5A 4INZA 1G1AA 1ESZA 1FTSA 1SXIA 4YLYA 4YYZA 3HJFA 1GO2A 4RDLA 2GCPA 2Q3MA 3LX4A 2LDXA 2I76A 2CT8A 4KXYA 4ZI5A 3MPOA 4WXPA 2A8YA 3QXGA 1LDBA 1G9SA 2W83A 3IOBA 4LOIA 3ZUGA 3MBKA 5C80A 5IYZA 3M1IA 3GVXA 5GQSA 4K1XA 1R7RA 3W2IA 3FPJA 4GZMA 3ACBA 5AW8A 3KE9A 2WVGA 4Q3LA 1LLUA 4UTPA 3ORRA 4B8ZA 2C7PA 3R6JA 4HNSA 3AHGA 4B6SA 2FUG6 1A9TA 2QPTA 4WHMA 3ZDFA 1ZN8A 1Q74A 3AUSA 1RQGA 2YL2A 4AF6A 4KHZA 4WXHA 5I6DA 2R6CA 1L7MA 2JFOA 1U8YA 1U3VA 3KAJA 1L3IA 4FSXA 4ZJUA 4GPZA 2XT0A 4K6GA 4AFNA 2E6KA 3OPYA 1NQWA 2Q3CA 3VR5D 4DZRA 1W94A 5JXGA 7ADHA 2FEOA 1DDIA 1WL8A 2H48A 3PTAA 4TM8A 2QJRA 4DV5B 4G8CA 1EB8A 5EIAA 3JQ8A 3W6UA 3ZUPA 1NW6A 1S6YA 3D8UA 1K5DA 1Y89A 4QHYA 1K7SN 1PZMA 2BD0A 1WXGA 3CV3A 3GVCA 4IYJA 5FLEX 2AFHE 2BAGA 3SIXA 5C37A 1M34A 2X5OA 1GZ7A 3EAFA 4RWZA 1PP4A 5D6OA 2JBWA 2ZVJA 4U4AA 1VJTA 2V8OA 1W36C 3EE6A 1KH1A 3GT0A 3ZEAA 2QSZA 3CB4A 3M83A 2X2FA 1KZ7B 3DYBA 1CYEA 2YHIB 5B1DA 2IYNA 4IL5A 4NCXA 3QELA 4CU2A 3K6SA 3CN7A 2ST1A 4DB4A 1LPSA 3PCXA 3U7HB 2QN2A 5LCXA 2I8AA 4BNDA 2CLHB 4ZT4A 4ZAVA 3AI1A 2XR1A 4JT8A 4C5BA 1K9MD 3O4FA 3STXA 5K2OA 3DOEA 2FSIA 4C30A 3NBAA 3BRQA 5D1HA 2VOJA 2WG2A 5JI2E 3VHLB 3MG9A 2BEKA 4B73A 1OFGA 3RU2A 3N0WA 4A0QA 2ZSEA 2O8CA 4I66A 2NXNA 1JLSA 4Y2PA 1WG8A 1N5KA 2IQ5A 3LHSA 3S5UA 5CDYA 3SICE 4BIIA 4C4ZA 4XDYA 3WNCA 5E6SB 3TRIA 5JC8A 2AQHA 2GHRA 2GD6A 1KHHA 1CY6A 5L3QB 3TTUA 3RRBA 3A3BA 4RPDA 5EHGA 3FOWA 3GQVA 4QDUA 1K68A 3JALB 1BWRA 4EVRA 1ISHA 3WQRA 3GG9A 1N6HA 4YXWA 1V16A 3HVUA 3MAAC 2PRIA 3PEUA 3PRYA 3RYIA 2JAWA 2J31A 2H2IA 1JIKA 4WZEA 1ISRA 2RGXA 3OIUA 4QJ4A 4BNHA 2XDYA 2XUZA 4HUQB 2GUGA 4FFPA 4ZTZB 4HBGA 5DU2A 4ALIA 3V1YA 8OHMA 3GP3A 2WPDA 1XAGA 4L6AA 5I7RA 2WZCA 4OBBA 4IGEA 4KFSA 3HZZA 5TX7A 1BQEA 1GDHA 1OWOA 1GTMA 3VISA 4DCPA 1D7AA 2BUCA 4L78A 3T0GA 2G77B 2D0IA 3NBKA 4CM5A 3WWEA 4D9HA 3HBLA 1HFEL 1CJBA 4WNIA 5C7LO 1OH5A 4O4IA 5DCWA 1OWLA 5AJTA 5BN3A 1ZLXA 2EP5A 2NV4A 1GCIA 2WTMA 3DFUA 4FFWA 1GGMA 3WWCA 1TQDA 4OI1A 5GIPE 1HC7A 3T8YA 4PGMA 5JQGB 3NDBB 1R6VA 3A1FA 1IZ0A 4MYUA 4E5YA 1EXNA 1W8IA 2OHGA 1C30B 1X2BA 3ZOKA 5K4GA 3BH4A 1UZNA 2YX1A 2UZ0A 3I2FA 5FBRB 5TRDA 3COJA 2H18A 5T41A 1L7PA 1M0EA 4CIXA 4CMAA 4U6QA 5KYXB 5HRUA 5ALWA 4B76A 1VLYA 3IUBA 3LCCA 2ANBA 1FUYB 3UV7A 5IJZA 2MWMA 4BGIA 4NI5A 4MLDA 4RIGA 2I6TA 4CL8A 5DTQA 5JFOA 4MVJF 1XRPA 5KREA 5DYYA 2VP2A 4BO9A 1VMIA 3IT3A 2OLJA 5BSMA 3AW9A 5GZ6A 4EO4A 4R0MA 5KSWB 1FBNA 4FB5A 2FEWB 2H2AA 1DKNA 5EZYF 1YMVA 4LOLA 4XTCS 2GOYA 1WBDA 2ZYUX 3COPA 4BGEA 1VJ1A 1U2GC 4EEZA 4GKVA 4AUMA 2GVZC 4JXZA 3U56A 2DQKA 2XYPA 2UYGA 1EB9A 3CF4A 5EIBD 2JJMA 4E5SA 4TUYB 1QRAA 2QGGA 1JPVA 1ODLA 4P58A 3SEQA 1WB5A 2BFFB 1WXXA 3CVJA 4WZ6A 1OTHA 2B1JA 2WU0A 2ZRKA 3GYGA 3KU1A 3ONNA 3UMSA 3MWFA 3F3YA 3KYJB 5G0WA 1TM4E 3VU9B 2Q3EA 4KX3A 5PNTA 3SR4A 1BO6A 1H66A 2XI4A 3CCFA 1XPOA 4C4YA 2BJWA 4UHFA 5AJYA 4YMHA 1EXWA 1GRVA 3FJ1A 3BWVA 4H4DA 3FHTA 5JSZA 3C15C 5KDDA 3WFJA 1YCDA 1EVZA 3H1TA 2IHZA 3ZJ4A 1DBIA 1TJPB 3C6BA 4K2HA 4GZLA 2OM6A 2CDBA 4WESA 5DNYB 4RACA 1NBMA 1WZUA 1XA0A 3SVZA 4WZKA 1HRKA 1K88A 1UWCA 4YV1A 3W6ZA 4BMDA 1RLUA 3GPCA 3GVHA 3H87A 5JFTA 4H7DA 2HJHA 4XPIA 1D6JA 1R6DA 4OQMA 5A2GA 3P96A 1GNVA 1ZRMA 1VL6A 3GLUA 4G86A 2DRIA 5CIWA 3KPWA 2PMWB 1F8GA 1P2SA 2PSSA 1PR6A 1TAUA 2EGGA 1Y8QA 3LK6A 1R9MA 1VSTA 3LWDA 3NUZA 3P9SA 2V59A 1NJ1A 3H2KA 1U9IA 4ZVTA 4QT4A 1EX7A 4PRKA 2C5AA 3Q6NA 5IM5A 1Y80A 4YXWD 1SPXA 2H0AA 1HDRA 3C3AA 4C0KA 1B00A 1SKQA 1F8YA 1FVOA 1N5LA 1UL1X 1W5TA 1GN8A 1GRCA 1GRQA 2QSJA 3K09A 4G0OA 3TS1A 4EKGA 5LZ2A 1N3LA 4FXOA 4TKUB 4LUCA 5CYFA 3K1AB 4GLOA 4ENQA 5BN4A 5JR3A 2DJIA 2Q2VA 2X0JA 2WKRA 1V9LA 4O4IF 3DHVA 5CIYA 5ARDA 3SYMA 1GGJA 3WRXC 2H1VA 5B7GA 3ZHVA 1WUTA 3G1TA 2JJ2D 2VZ0A 2WIAA 2MSNA 4EG6A 3FVRA 3FI0A 4ZMRA 1SU6A 3SS9X 1TK2A 3UMVA 5HOQA 2IHUA 3G2QA 1Z28A 3OC6A 3F78A 2AOUA 4MR9B 1H1TA 4MNTA 4UCWA 2FSHA 2MR5A 4DADA 3LOQA 2X9GA 3FKSA 3EUEA 3OU6A 4S1TA 2BLNA 1KDOA 3P20A 3V8RA 1JKMA 3WGTA 2GZ3A 4LPKA 4H0FA 1CULC 1TYAE 4RD1A 1BW9B 3VAZA 1W87A 1LGYA 5IK2A 5IVIA 4YUAA 4F9TA 4UQLA 3L4KA 1JEAA 2UUAB 5IKXA 3GDWA 3M6LA 2ZYSA 3NOVA 4RMJA 1KQNA 4QU8A 2C9BA 1I18A 1FNCA 4CLXA 2DH6A 4GMFA 4P84A 5BSHA 4RDCA 3G2MA 1OGIA 3I2GA 4EHIA 1GRNA 4DY4A 1VG0B 1UJBA 2WOJA 5A3VA 1H6BA 4YRDA 5AVSA 1HZZC 2FPSA 1A5SB 1VBKA 2AMLA 3AJDA 3V1MA 3JVIA 5L9AA 2QYSA 1UMDA 1M2KA 3I05A 1UD2A 3N2LA 3ZYZA 5JSHA 2WKPA 3SYNA 1WAMA 3FGZA 1NFRA 2P2SA 9GPBA 3OE1A 2EEZA 1GJRA 1V7PC 1WP4A 1F14A 1U7WA 2NXWA 2ODPA 4QRDA 4YUVA 3WY9A 4RFLA 4E2YA 3FMGA 2F1IA 3AOGA 5HBGA 4BNXA 3R41A 5JNLA 2BHLA 2OFOA 1B2LA 2PCJA 3E1SA 2AX3A 1DIOB 1J2RA 6GPBA 2G6BA 5AUNB 3FOEC 1INLA 1XXHE 3U4IA 1JEYA 1XVAA 4XGIA 4MCJA 5FWXA 2IYFA 3C3YA 1Y9JA 2HXYA 3K9NA 3L0YA 4XLHA 2PRJA 2WM3A 4I9UA 4XCVA 4NFSA 2MHCA 3HNRA 4LI3X 1XNJA 3K70C 3D6UA 3JQBA 1NF3A 3UBTA 3H5LA 2EATA 1CJMA 2ATIA 3L1IA 4OHUA 2P2CA 1RQNA 4R9RA 1YJXA 1BG6A 3FAKA 2PVPA 1NBMD 3MCZA 4NPHA 4H7IA 3R5KA 1QHIA 2OCYC 1EFRA 2RFLA 3NHSA 4KYTA 3ZJTA 1DRJA 2DF8A 2HA5A 2XKAA 3ROFA 4EI9A 3ANYB 1CE8A 1QWSA 4EYEA 2CD9A 4YUZA 1PNQA 2BMVA 1H4VB 4NL4H 3RTGA 3IVGA 4I4CA 2H31A 5TS2A 3F97A 3T94A 3FYTA 3ZS9A 3JQ9A 2DY0A 5JZOA 4XWWA 5HM6A 5FTNA 2W48A 1ZINA 2IFTA 3HDTA 3HXMA 4X93A 5CJJA 3NDIA 4RTPA 4TN5A 4X07A 2WWYA 3K0BA 3LNNA 1JWBB 1QXSA 2XGMA 3AHDA 2HBYA 5FI1B 1R10A 1TQHA 4BBPA 4X5OA 3IL2A 1E3EA 2X76A 3VBEA 4S04A 3GMSA 1R15A 4D1YA 4B7CA 3BIOA 2EX0A 4FC7A 3NO4A 1KYQA 3W5VA 4JI5B 1O9GA 2WIGA 2ZJAA 5BW6B 3NTVA 3WISA 2BLLA 4F1JA 3UJCA 4UOQA 4R2WA 5SZJA 3G9UA 4AI6A 3ZZUA 1G9XA 3FN4A 1A9XB 4IGAA 5FI0B 1OROA 3EZNA 5EI5A 4QDXA 2GREA 5HKAA 1MOPA 4U8HA 4YH1A 4B7ZA 3AEZA 3CVWA 1YS6A 3CW8X 3OIVA 3R5FA 5A4JA 2O8EB 3EHDA 2PSHA 1KJQA 1QYRA 3EF1A 1YHNA 3E23A 5M3BA 4O2AF 4X1IB 3NTOA 2NSHA 3D7KA 1JDBB 3O8QA 4CF5A 5JZ9A 5AOBA 2DYIA 1UJ4A 1OU4A 3M33A 4KPYA 4BLWA 1EDOA 1RAIA 1AZWA 2BGLA 3Q98A 3URMA 1NX6A 1MGOA 1BD3A 2DT5A 2HA7A 2WM8A 3M0EA 5F1PA 1U63A 4GW3A 1ZH0A 4WTOA 4EIWA 1VQNB 1E1NA 2JN9A 1TT5A 3F3KA 1XTRA 4KO3S 4N5IX 3QXSA 1DMSA 1ZJ4A 4ER0A 5B7NA 4CKZA 3AHFA 1H3NA 1GGVA 2HLHA 4JP5A 3W8EA 2VJKA 3B2NA 3FFTA 4N5NA 1JSRA 1ONOA 1UKAA 1ST3A 4Q4CA 4E5PA 3O92A 3U3OA 5KAPA 5FBQB 3MXTA 4RZHA 4AQDA 1HA3A 1O6ZA 3V2UA 2XVMA 3SEAA 4CIAA 3MUFA 5FTJA 1EAMA 4PIMA 4QDKA 3HA3A 1NVVR 5CCEA 2VEDA 2J5XA 3GEPA 3BCRA 3OUZA 5E0KB 5CFNA 3KALA 2FOLA 4ZV4A 1Q0LA 2AFRA 2GPTA 4MWEA 4NAUA 2YVAA 1KSFX 3FNHA 4OM7A 5U9CA 3MNFA 4I36A 3PFFA 4U2EA 5KJCA 5LQKA 3IILA 1E6LA 3QYAA 1SIBE 4K9DA 4NH0A 1U3CA 3VPBA 1OC2A 1OIXA 2ZIFA 3VR3A 4BO5A 4QXAA 1UBLS 4MYDA 2IHNA 5SY9A 3E5HA 2FPMA 2FX2A 4RQBA 4B8WA 1DQPA 1EHIA 4HNVA 4KPUB 3RFTA 1ZESA 3CUVA 4EHKA 4PVDA 2IW3A 1AQLA 4D42A 1Q7TA 4I8DA 1UDWA 1BCSA 2OO5A 2ZS7A 2AUNA 1EUDA 1K8YB 3GAMA 3AY6A 1PZXA 4MGYR 2SECE 1LZKA 2KB0A 1JDBC 3EBOA 4HEJA 2XOKD 2RIPA 3WRWA 1QYXA 2BGUA 2HA2A 1PHPA 5K0TA 3G8BA 1Q3KA 1CRWG 3GPBA 2XECA 2R25B 2Z4SA 3IBFA 2I91A 1VE1A 3WGIA 4BKRA 5K3DA 1DLIA 2IYEA 4WFIA 2CV2A 1BIFA 1Y1PA 2P2DA 1YRLA 5K7SA 2QLMA 1OXTA 4CLOA 4DQVA 4MWBA 3G0IA 4NU8X 1ZM4A 2PVCA 2YYYA 2QOEA 1C3OA 3SNHA 3TW8B 2E4UA 3E7FA 5F2KA 5BOVA 3A2NA 3JALA 2WAXA 3H5VA 3UANA 5FI5A 2QN7A 3WL3A 2PNFA 3QWAA 2DIEA 4BPRA 1JFLA 4ISCA 1N7GA 3R3ZA 1NXPA 2N47A 4LZAA 4AO6A 4KMOA 2OGZA 1BXRB 3DWEX 4RVCA 3VVCA 3ZK9A 4AKSA 2EFEB 1KMQA 2NTNA 3IS3A 3O9VA 4I5DA 2PE5A 2GSDA 4DV2B 4CEJB 3BFKA 2VDWA 1XVIA 3NP9A 5DCUA 2EWWA 1UEIA 4OQPA 1PGOA 4JT9A 2RHGB 5DXAA 4B5KA 1C7ZA 3AM5A 4G56A 4O4LF 4Z4SA 3EG5A 2P9BA 2OLEA 3PENA 2QROA 3H5RA 4YJ2F 5JO9A 2FY8A 4GICA 3JWEA 4CKCA 3N2YA 1CNMA 2CXRA 3WBKA 4MO2A 1H0HA 2MSKA 4QG7A 1YDGA 4XASA 2HJWA 4PFKA 5LMNB 4FBGA 2IEAA 1GA1A 1JIVA 1VP3A 1QRTA 1XK6A 2ZANA 2B61A 4FINA 4TTTS 5AUOB 3AXTA 2POQX 5H5JA 2RK6A 3ANSA 3ETJA 4H7FA 2PT6A 5ETJA 1UC9A 1I4DD 1WW2A 3K0AA 3H5IA 4L15A 4NICA 1C4WA 1YDEA 1JJFA 1C3JA 1ZIDA 2IZZA 3UG7A 1P5HA 2IF2A 2LWIA 4X6UA 3Q3GE 2RI6A 3VSDA 3IUPA 1SVNA 2HEGA 2DOKA 3LD9A 3D6FA 4PFJA 4OKNA 4XLEA 1SELA 1RAEA