1SM4A

Crystal structure analysis of the ferredoxin-nadp+ reductase from paprika
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
296
structure length
296
Chain Sequence
b'ISKKQDEGVVVNKFRPKEPYIGRCLLNTKITGDDAPGETWHMVFSTEGEIPYREGQSIGVIADGVDANGKPHKLRLYSIASSALGDFGDSKTVSLCVKRLVYTNDKGEEVKGVCSNFLCDLKPGADVKITGPVGKEMLMPKDPNATVIMLGTGTGIAPFRSFLWKMFFEKHDDYKFNGLAWLFLGVPTSSSLLYKEEFEKMKEKAPENFRLDFAVSREQTNEKGEKMYIQTRMAQYAEELWTLLKKDNTFVYMCGLKGMEQGIDDIMSSLAAKEGIDWADYKKQLKKAEQWNVEVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords chloroplast ferredoxin-NADP+ oxidoreductase
publication title Crystal structure of paprika ferredoxin-NADP+ reductase. Implications for the electron transfer pathway.
pubmed doi rcsb
source organism Capsicum annuum
molecule tags Oxidoreductase
total genus 99
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2004-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1sm4A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1sm4A02
1S0UA 3CCLB 1S72B 3OJWA 1QFJA 2RC6A 3I1FA 3ZBUA 4DQLA 4ZGQB 1QUFA 4P3YA 1G7RA 3W2FA 1ZM2A 2QEXB 3VO1A 3P26A 2OK8A 1W35A 1IB0A 3ZBTA 3OZWA 3WNBA 1JJ2B 4Q7JB 1FNCA 4MYTA 3U2QA 1EWYA 3CCSB 3W5HA 3WBKA 1IJEA 3CMEB 4UAJA 1FRQA 4M2LA 1OB2A 1Q86D 4B48A 3U6BA 2BGJA 4RD6A 1VQPB 4M1KA 3J81k 1CQXA 1EXMA 1EFUA 1GO2A 1I7PA 3PENA 2PMDA 1ELOA 3ZZTA 1E63A 3JQPA 1QGZA 4B44A 1EP1B 3MHPA 1KD1D 4ZCIA 2VNHA 5JBQA 3QFSA 3OZVA 1DARA 3JQQA 1W87A 2OTJB 2C78A 1EFTA 4TMZA 4ZCLA 3U6KA 1KJZA 3CCVB 4YAFA 4ACBA 5TY0A 3QSYA 1KK0A 1BQEA 3AVWA 4TMTA 3SJZA 4RD0A 4PC2A 2VNIA 3QFTA 3CCJB 4PGOA 1SM4A 4AF7A 2E1RA 1B23P 4RCZA 1W2BB 3W5VA 5TV2A 4G1VA 1VQKB 2R6HA 1KRHA 1VQ6B 4P6VF 4LBWA 2BM0A 1CNFA 2YWEA 3P27A 4RD4A 3W2GA 1YJ9B 4RD2A 4HE5A 3JQRA 4N3GA 3CXCB 1JB9A 1QG0A 2ZITA 1UMKA 3QFRA 4AC9A 3VMFA 1FRNA 2BV3A 4FK8A 3ZC3A 1YI2B 3W2HA 2QN6A 3CCMB 1XE1A 4NCNA 2BPOA 2YWGA 1TTTA 1D2EA 3B8HA 1F20A 1VQOB 2BVNA 1FNDA 4ACAA 2GQFA 1N0UA 4MYUA 1J9ZA 1TLLA 2VNJA 1OGJA 2HDNB 1OGIA 3V76A 1DDIA 3G71B 2EIXA 4DQKA 4WQMA 2DEUA 4EH1A 1G7CA 5KSWB 4BPRA 4RJLA 3CD6B 1K9MD 3I55B 4N3NA 1QVFB 1DDGA 4LBVA 1E64A 3A1FA 1R5OA 2BM1A 2DERA 3OZUA 3AVXA 4QHYA 2BMWA 2PIAA 4Y9RA 3AVYA 4Y9UA 2CNDA 4K1XA 2DETA 1VQ5B 2OTLB 1E62A 3ZZUA 3WYAA 1EFCA 1YJNB 3LVBA 4B47A 1U2RA 2VNKA 3CCUB 3FPKA 2BF4A 4B3XA 1YIJB 1EP2B 4U9UA 4ZV4A 2DCUA 4J0QA 1KK1A 4PC3A 2C77A 3E20A 3CC4B 3LYUA 1JA1A 4F7DA 3VNVA 1KK2A 3CW2A 2B7CA 1KC8D 5DSZA 3G6EB 5FA6A 3AVTA 3OW2B 1OB5A 4LBYA 3W2EA 1B2RA 2B7BA 4YAWA 1VQ7B 1NJID 3CB4A 1VQ9B 4Y7CA 4M0LA 1JNYA 2BN4A 4YAOA 4LBZA 1VQ4B 1QGAA 3ZZ0A 2NPFA 1N8RD 3LO8A 2DY1A 4M53A 1QX4A 4TN1A 1KK3A 2J7KA 1VQLB 3VO2A 3CC2B 4AF6A 3FJOA 3B82A 3CRZA 4R71A 2HCJB 4B4DA 1ZM9A 1JA0A 5H59A 3CMAB 2YWHA 2PLFA 3AGQA 4TMVA 1M90D 4G5GA 1H85A 1YITB 4G1BA 2RC5A 3WNDA 3CCRB 3AVVA 3AVUA 2OK7A 1EP3B 2QA4B 1QVGB 1DG1G 2VYQA 1Q82D 3CCEB 4FN5A 4YHBA 3AGPA 4H9GA 4PC1A 1D1NA 1AIPA 1TVCA 1BX0A 1HA3A 1IJFA 1QFYA 1QGYA 2FX3A 1N0VC 2XNJA 4RCYA 3W2IA 1Q81D 2AHOA 1ZM4A 3QE2A 1FDRA 1VQMB 1F60A 1YJWB 3WXMA 1W34A 4FWTA 2QTZA 3WY9A 3G4SB 1H42A 2BSAA 1VQNB 1R5BA 5THXA 1FNMA 1G7TA 3W5UA 1K73D 3VNUA 3E1YE 4YAUA 3QFCA 4ZGNB 1GR1A 1XB2A 4IW3B 3WNCA 1TUIA 1SKQA 3OJXA 1ZUNB 1QUEA 1YHQB 5HXBA 4ZCMA 1NDHA 1WDTA 2QDXA 4QFMA 4C0SA 4PC7A 1GAWA 3CPWB 4LC0A 3ES9A 1QH0A 1KQSB 1G7SA 2HMAA 2VZLA 4NBSA 5H5JA 2X3UA 1Q7YD 2GPJA 1K8AD 1A8PA 5GV8A 2D74A 4C43A 1VQ8B 2QMUA 2YWFA 4RD1A 4B43A 1FNBA 1KTVA 5AN9A 2EFGA 5TR9A 1BX1A 1BJKA 4TMXA 3B78A 1GAQA 3MCAA 3I56B 4TMWA 1GJRA 3CC7B 1AMOA 3WBJA 5GV7A 1QFZA 1D8TA 1ZM3A 4HE6A 5EMNA 1CNEA 3MMPA 2QTLA 2XNCA 2XEXA 1GVHA 3LRXA 1R5NA 4YALA 2B5OA 4M4SA 2BGIA 4PC6A 3CCQB 4RD3A 1M1KD 2CRVA
chains in the Genus database with same CATH superfamily
1YBAA 3M83A 4R98A 4REQA 4MS1B 1MJ5A 3G68A 1UKCA 1KMIY 4QUBA 2G4LA 1Z4QA 1DCKA 1K7FB 4MA0A 2A92A 1WZNA 1QDEA 1EFPA 4JHLA 4JIMA 2QRJA 2UUBB 4MTLA 3JQ9A 5ALYA 4DBZA 2MYPA 1XZDA 3LZ6A 4U2FA 2ONKA 4PCLA 3IYLW 4KXQA 3GFQA 1X6VA 2G1KA 2Y0CA 5E6SB 4ER7A 2NO1A 4WOBA 4ILKA 3BHMA 3EJWA 4A0FA 3K6SA 3I01A 1XK7A 3FTCA 2VPPA 3FGNA 2QEXB 2YS7A 4WKGA 4B7CA 1PS9A 4CKYA 3KD2A 1JQ3A 5MGNA 3AOEC 4YCNA 1I3CA 1MUUA 2WJAA 4MQMA 1W35A 1X1TA 2FEAA 2PGJA 4INZA 4JP2A 4EHLA 1F0YA 4JQCA 1N32B 2I4LA 5FBZA 7MDHA 1CFJA 3E1SA 4RHUA 4RLQA 4B3GA 2W8BB 3O6VA 3RE1A 4RAQA 5IF9A 3GUZA 1P2GA 4K9QA 2JLBA 4GMXA 4O4LA 3GRRA 3DE3X 2AXQA 4RVGA 2HSDA 2QSUA 2TS1A 2A9KA 3H5OA 1ZK1A 4E5UA 4BNGA 3A3BA 2HK6A 3LT5A 3N9IA 1RNLA 1IJEA 1TKRA 1GUAA 3AT1A 5GZ6A 4P3NA 2E7ZA 4K6MA 4MVJM 2I3GA 3ZXUB 4CEHA 1UKEA 3Q9UA 2FKAA 5IC6A 1GYRA 1J0AA 1NUSA 2OV4A 4OGLA 1LWNA 3CKYA 4XQ9A 5CA1B 1IB6A 3KQTA 3J81k 2FPGB 2QT1A 2C0QA 2YFQA 3DWEX 4I36A 2AXEA 1G2IA 1RXEA 3ZCVA 3CO0S 4KQJA 3KYCA 2QTNA 2NQTA 1YONA 2D7JA 2JIRA 1QK5A 5BWCA 1U2SA 4KQCA 1E63A 3RWMB 1W8DA 1COWA 1GL9B 2ZAMA 1JR3A 4MUAA 4RC9A 3GNLA 1DELA 5JJ5A 2VAWA 2JIDA 5LC1A 2RIRA 3F5MA 3K9BA 3O03A 2V59A 2X8WA 3HXTA 3DJYA 4C4XA 2X5XA 1V8BA 2X1VA 4KVAA 4BECA 2VNHA 5AW8A 4JH0A 1PEAA 3BD9A 3EG9A 4AICA 1NZJA 1IU9A 1W2WB 3N87A 1GZHB 4YRLA 1RXUA 2YXDA 5G3ZA 1UJCA 5F73A 2EQ5A 3LXMA 4ALJA 3U7GA 1RAFA 1AHPA 3KEQA 4DY6A 1AN0A 2RGNC 5KKAA 1A2OA 4UEQA 4G5QA 4TMZA 1RAAA 4EVQA 2V4MA 2VNSA 1KAQA 2XCSB 2CLDX 4ZT3A 1MRZA 2C94A 1F4VA 1SCBA 2WMYA 5K5EA 1KJZA 1NW8A 4C4PA 3CCVB 1H2YA 2F3TA 4GQAA 1ZCFA 2LD4A 4Z8XA 1FQKA 1WAMA 2QM7A 1QG6A 2GO7A 2CLFB 3CXRA 4K9NA 4LI3X 5CK4A 3SBXA 5CCEA 5DN6D 4IDNA 5ALUA 3ASRA 1ML4A 1U2TA 5I9BA 1GKIA 1XD9A 3QFTA 3QUAA 3RFXA 3H5AA 4BGEA 1GSAA 5DK4A 4JLDA 4DLBA 4EPXA 2GM4A 4O0LA 3WIVA 1LPPA 1R6DA 1NBME 2V97A 2PDAA 3EA4A 2QMHA 3R3HA 3S28A 3BA6A 4A7PA 2AN1A 3KZNA 3SJAA 1F06A 3EGIA 4RTSA 4PBSA 4FOTA 2Q1XA 4KQ1A 1NRJB 2XT0A 2EP8A 2AG8A 2FX5A 1PJ4A 4DUZB 1TL7C 3DH0A 4K7JA 1Z34A 4OF4A 5C4MA 2HXGA 1DC5A 3II6X 3I30X 1RHKA 3QUCA 5HJ2A 1YCFA 5EHNA 1SCNE 3KQVA 2ID7A 3KALA 3SLNA 5LMZA 3TSAA 1NFQA 3VR2A 1FFAA 3CLRC 4DNQA 2G1PA 1EWTA 3D4OA 4YX9A 3ZJYA 3B89A 3GG9A 3V42A 4UHEA 4XVRA 1HMPA 4PANA 3MUOA 1ZD9A 3Q8MA 3GWZA 2ZIVB 2Z1NA 1MC8A 4DDTA 4J76A 2EQAA 4LJSA 1T4CA 1GCAA 1WLYA 3K0HA 3LD9A 1FX0B 4NLLA 3ZV5A 2O7RA 1O08A 2A5GA 4DSNA 2XZLA 2O4UX 5JWHA 3CXCB 1QGDA 3BTSA 3PRHA 5IAJA 4CU2A 3FLEA 1TF7A 1E6WA 1JEJA 1TF5A 1FTNA 2E49A 5GM1A 4LXUA 5BPFA 4DCOA 4RL4A 4B6JA 1YL5A 4LYHA 4D8WA 4Z4QA 2JRLA 2IEZA 2Q5HA 3WQRA 3I42A 5LQJA 1FW6A 1JEOA 1EK0A 1RWMA 2H1SA 3AI2A 3WSWA 5K4HA 1J42A 1Y37A 3EXFA 2BPOA 3HI4A 3NHLA 5TQJA 3FZQA 4YJFB 5KTRA 1WKVA 3UHOA 4DUPA 2B1GA 1EXNA 1F20A 2GVNA 4G01B 3RCBA 3SDZA 4MW4A 1JKFA 2JFOA 2JJ2D 4IGIA 4KJZA 3R5JA 4H3HB 4L8WB 4MZXA 3OBIA 4RJ2A 5GJVC 1NUQA 2CF4A 1KJJA 3MXTA 3ZE7A 1N0UA 4J49A 4HR7A 2P5YA 4LXYA 4FI3F 5TF0A 2CNWA 2CL5A 5BN3B 4NXNB 4P4GA 1OSNA 3JZMA 1N34B 4IDEA 4KQMA 2P0AA 3B51X 4I9NA 4RLZA 3H19A 4UPDA 5E6RB 1DWPA 3PKJA 4E70A 4F45A 2QUZA 3A2MA 4NJMA 4O3FA 1YOBA 3OT1B 3U4GA 4BASA 2Z8XA 3E3LA 5M7EA 2I8CA 3D7KA 4OB7A 4QUZA 3GDWA 1IOVA 3LT4A 4FE3A 4JITA 4ZO8A 2EGHA 2VXCA 4MIOA 4WZEA 5LXTA 3A9RA 1ZW1A 5AHWA 4RJLA 1EH5A 1K9MD 3T7SA 1C3JA 2PFSA 3JPWA 3TX2A 4HAUA 1PKVA 1YZQA 1CP3A 4WTOA 3CO5A 3IAFA 4RBNA 1X0XA 5L3ZA 3UGJA 2CNNA 3EQ8A 4MUXA 3IPXA 2HF2A 1U3VA 2VWHA 4KEAA 2EERA 4JSTA 5H9VA 4V03A 5EJ7A 1H93A 1VL6A 3C5EA 3TQTA 3DJFA 1EGQA 3BGSA 4MS3B 5BQOA 5L3RA 1AZTA 1TVKA 3ENVA 4R1SA 1PLLA 3T4EA 1ZISA 5I7WA 1ZXLA 3NTXA 2JCSA 3DEHA 3OX4A 1PJCA 3QQ5A 4ZI7B 3EW7A 4IXDA 4X95A 3B7WA 3TKLA 1RI5A 2J3LA 1GPLA 1IEVA 3CLTC 1Q74A 4FMPA 4D4HA 3QTBA 3FPLA 1S1CA 1SURA 1SULA 3ICVA 3D3EA 5FORA 3SQWA 4U39A 3KOYA 2AF4C 3KWMA 3RLIA 1PS0A 5EJ4A 5HTKA 1CY2A 2Z6VA 3AUFA 2WJIA 1D6JA 3BDIA 4E5VA 3EWAA 3KR0A 2ASVA 2I66A 3GBVA 2FW0A 2GARA 3HU1A 1Y82A 2VNKA 4EQ6A 1I94B 2NP6A 5BYAA 1TJNA 4Q4JB 3BA1A 4P93A 2W0MA 4BWYA 3SYNA 5KVCA 3NIDB 1QPZA 3EVNA 4CTKA 4EW6A 4YAEA 5ENDA 5IT4A 5DN9A 5AR1A 1S2MA 2P3LA 5L9AA 4WN9A 3C6QA 5ALOA 1KJQA 1PJRA 1USIA 1KK1A 3D54D 2FP4A 4RPCA 1RFLA 2O8BB 2OEPA 3EHEA 4R8SA 4O2AF 4CTJA 4RDKA 4D0SA 3S1AA 1NVEA 2NVWA 3V1NA 1K2VN 2WWHA 3WL3A 3WNQA 1JJBA 1QC5B 3NGXA 1X7XB 2H7YA 5J4YA 5CDFA 4I9GA 3BWMA 5JISA 5ALVA 2WMNB 3AVTA 1V5IA 4IGKA 4M49A 5AIAA 2EZUA 3W2EA 1G66A 3LSYA 4H6PA 4HS4A 2CVPA 4X05A 2R8BA 2YY7A 1EVLA 3W05A 4AJ4A 2LKDA 4KXFB 3K4PA 1X74A 2NZWA 1Q3HA 1BLIA 1XNGA 2VTBB 1N8TA 1QU3A 1HYGA 2VXOA 3PWZA 4X1OA 2Z57A 5EZYF 1Z68A 4BFTA 1NBAA 2R1ZA 2XGOA 2HIMA 3F71A 2PJUA 4RZQA 1SUBA 2RE8A 3T3IA 5ALXA 2XQKA 5C81A 1O0SA 2D1YA 1GAJA 2GD6A 4YRJA 1CE8B 4QXRA 1W0JD 2G09A 1P4MA 2CL0X 2AMJA 2YWJA 3KPVA 4K1LA 3WGNA 2Q27A 4K0KB 4BATA 4J0GA 1DUIA 1N9GB 3LDFA 4OHVA 4DPMA 3EZ9A 2ZEJA 4NPHA 1BS1A 4JBXA 1X15A 5DV9A 1TGYA 1XVAA 4WXYB 1L3IA 3X1DA 3AKYA 3FXAA 3B82A 3QEOA 4AM8A 4Z4UA 2AS0A 4GI5A 3W3ZB 4JYBA 1AOXA 3B2EA 5D1NA 1I4WA 2G4CA 2WM8A 3IEPA 4GHWA 5HK9A 4N5DA 4F1WA 3VPBA 3GGDA 4QREA 2XGMA 3VMMA 5DMXA 3SZOA 5KJ1A 1T5DX 1NLZA 1ZM9A 2RK3A 2IZOA 2BMFA 4P3OA 2QNRA 3A1TA 2QJWA 4G1UC 5DSXA 1HDYA 3RIYA 1KDPA 2TECE 3DL2A 2HWXA 1X3LA 2IU3A 5JS1A 5C18A 4E5PA 1H85A 5KWVA 2NACA 2I3DA 2PMFA 3HHPA 2UZ1B 4QYWA 3JCZA 2WC1A 3DZJA 4O2BA 2O1WA 3PF9A 4NARA 4JLSA 4Q18A 3AVUA 3ZKWA 4PXSA 5CYOA 1CS4C 1VLLA 1E9BA 1E2KA 3CRVA 2UAGA 4GPBA 1YBMA 1QO0A 2JKYA 2FF5A 1KJWA 4FXPA 3KBOA 5FBWB 4ESHA 2QNBA 2X1LA 3PC8C 4G41A 3K9HA 4G4IA 4M55A 1CZLA 1P8JA 2OKCA 2SBTA 1HDOA 4MPDA 4D4JA 3WNZA 4CMAA 4JJKA 5TT1A 3PQ2A 5U9CA 1BWRA 1XZGA 1XJQA 3WL6A 3MIZA 5JQGA 5TQ2A 4OOVA 1P60A 3ABIA 1BFDA 1P77A 2J5BA 2VP3A 3UC9A 1PAUA 3LUAA 4XYEA 3U7QB 1TVCA 2D3NA 2V6GA 4ZDKA 3ZK9A 1U6KA 2GEDA 1Z0DA 2OD7A 2WAAA 4D0LB 4AUNA 5KINB 4IQFA 1TLFA 1LJLA 3WIBA 1NVAA 1QGYA 4AJ9A 3IOCA 3ELYA 2HEGA 3PDIA 4KKVA 1LEHA 2R25B 1E1QA 4J91A 1PLJA 4U7PB 1NQXA 1M33A 3EDYA 3F67A 4KU4A 2PBLA 3L0DA 1T9KA 5FFMA 1A4RA 4JJ8A 2BI7A 3L5OA 1FTQA 2GA9A 1SXGA 1Y5RA 4R40A 1EFHA 4F04A 3EAGA 1BOOA 3ZWPA 4RTKA 1ISHA 3LIPA 2PV0A 1T5TA 3SX2A 1UPFA 1GPWB 3DLIA 4H7HA 4QSMA 1EUZA 5C8DA 3P2MA 1Z4IA 4LQDA 3DMDA 4BQIA 5HYVA 2I6UA 2VDWB 3KOWA 1G16A 2P6UA 4B6EA 2Q5QA 4F06A 1QV6A 2IE0A 1Y33E 4EG1A 2QENA 2PWBA 2PG3A 4FNOA 5F78A 2PRSA 1GEGA 2D5AA 1P72A 1J6UA 4ZGNB 2G0TA 1Y9DA 2QR3A 3MPOA 3WKEA 1FFXB 2VYFA 2FVXA 1XB2A 1K06A 1Z62A 5C1OA 1W75A 2CHVA 3N75A 1FP6A 4Y2TA 1CP2A 4R1UA 4C7MA 1NYTA 1TYBE 2GRJA 1BCSB 2GCIA 3QX7A 5CM9C 1L0BA 1SKQA 3BXGA 4I4IA 2WSLA 3OJXA 3SSOA 3O4VA 1J1UA 4G5FA 4DLTA 2XKAA 2FN3A 1QUEA 2XRYA 4Q1BA 1EJ0A 2Z2YA 3TH5A 4ZOAA 2RBKA 2O2DA 3L4EA 3RR2A 3M6MD 1XQYA 3MHTA 3BSWA 4QBHA 1YA8A 2X77A 3NBXX 2WJJA 1Y0RA 2WJPA 4OM7A 2O3QA 1JX6A 1PP4A 5ALGA 3VC3A 1BSVA 1IC6A 2Z2XA 3PEYA 2Q4DA 2XVZA 3DOFA 3DT6A 4KDFA 1VRCA 1AY0A 3E7WA 1RT9A 1AS2A 4QRDA 2XD9A 4IIVA 4YTEA 4CCWA 5ITZA 4NICA 1IZYA 2C0CA 2FZWA 3LBNA 3AIOA 5EXDA 5JCJA 1D4OA 1NTOA 1GNLA 2ZT7A 3R5TA 3QW4B 3G0OA 4KHPB 1KPHA 4P6YA 2J6BA 2P9YA 2ODTX 1X9GA 1JDPA 1NVDA 1QGUA 2WHPA 2QN7A 1SAYA 2VXBA 1PF7E 1EGHA 2VEOA 4FGJA 4X1IB 3I8SA 3OU2A 3S68A 3LPCA 2JARA 1C1XB 4DN6A 3K70B 1ZGBA 4K87A 1E1RA 4MV0A 3UXHA 2DF8A 1Z6YA 2UUOA 2EW1A 5F21A 5CFLA 2WTXA 3AR7A 3JZFA 3IFSA 3EWSA 2EFGA 2ADFA 3BF7A 2HJ9A 2FPSA 2SECE 3DUWA 4UC0A 4BTVA 2NP7A 4F3NA 1UMDB 1WULS 2XXAA 1XEXA 4DRYA 3IDAA 3NV9A 1JTFA 5C0OE 1MA0A 1PZGA 1JG1A 3H84A 2BEJA 1VC2A 3FSRA 1DQRA 1V25A 4H0NA 3GRPA 1TB4A 1PJAA 4RSHA 1NUHA 3CH5A 2CLMB 1Q77A 2WIAA 4JL6A 4LYJA 4HE6A 1LNQA 1KYTA 2IIQA 5A5FA 3ERCA 2X2OA 3FY4A 1MRSA 4ZAWA 3ZIAD 1RRPA 3VI4B 2JCBA 1N2CA 4Y2JA 1X77A 1JW9B 3JALB 2QTWB 1W30A 4X84A 2NVUB 3IV9A 2VJIA 1SQSA 1T3HA 1VKHA 3O3CA 2LBPA 3DW3X 1YKFA 1IIRA 4FR5A 3ZHSA 2B5OA 2GLUA 3ORSA 2J0QA 2A14A 4FDAA 4ZAGA 5DRYA 3FTEA 4JUBA 4P98A 2BGRA 2P2GA 1HF3A 2FNAA 3A4YA 3T7CA 3EXG2 2PWPA 3FCOA 2SKEA 3K20A 2OCLA 4NAVA 1DPFA 4TXLA 4WCFA 1R6VA 3QENA 3R76A 2ZQYA 3B5IA 3SWWA 2C9BA 2O57A 2VN8A 1FP7A 2Y4OA 3PUKA 3PSHA 4P7BA 1BZYA 3ZR4B 2OC4A 1RLUA 3GUYA 1BMTA 1CVIA 1SCQA 4I8DA 3GP8A 3NU1A 3LLMA 4JVLA 1PEDA 2B99A 3RWOA 4ZK6A 1N77A 3H3XA 4N0DA 4TRMA 5A3SA 1GLNA 1U3TA 5IULC 1N3IA 1AHNA 1ZD1A 4DV1B 1WJGA 2I65A 1QP7A 4KGXA 4LC1A 3LH5A 4G1MB 3RBVA 3LY5A 1NJ5A 1MHTA 3OKPA 3WJ1A 4BQFA 4U7GA 2HHJA 3TFWA 1NVTA 4IVNA 4B8YA 4UEOA 3A6FA 3UQZA 3G6WA 5DBFA 1PQYA 1I1QB 5CJJA 1FNCA 1ZCJA 3CONA 2P78A 1UFVA 2MU1A 4XI9A 4B45A 3T3GA 3CM0A 1KYXA 2VF2A 4OHKA 4U2CA 1QV7A 3ZCQA 4LISA 1EWYA 1ZK2A 2ASEA 3U5ZB 4HX9A 1RQGA 3EFBA 5AW5A 3EDMA 2I6FA 1YC5A 1AKNA 2O8NA 3AFNA 3I9MA 3IJ5A 2WUFA 4X93A 3SX4A 2CJXA 3PB3A 2CUKA 1HV8A 3G5LA 3G7UA 4IJ5A 2XWBF 4RE5A 2WB2A 2IOFA 1RRKA 2IBMA 4QM7A 3D6JA 2HT6A 2VDLB 1BKDR 4P3KA 1X3SA 1CRWG 1ICIA 1VCMA 4TZ0A 4NV0A 2BEVB 1SKBA 3FNRA 3PENA 2PMDA 1W4LA 3IQDB 2WYVA 4MIEA 2G1JA 1YUNA 5LQNA 1JSXA 3N3AC 4HBGA 2HSEA 5D00A 3PUJA 3WNVA 3R9XA 1NRXA 3O26A 2B1IA 1C4XA 1XOIA 2JS7A 3ROFA 4BQSA 1E4YA 1GRRA 5IM4F 3O2JA 4QBIA 4BGVA 2CNLA 3SQMA 3GI1A 4UM8B 5A03A 4F1KA 1X1BA 1QF9A 3A58B 3FBGA 1K7SN 1VCIA 4KO3S 4D9NA 4ZA2A 4DUGD 4YRQA 1HQCA 1MO6A 4ZAVA 1M0EA 2VTVA 2FR8A 4P83A 1B16A 3AKCA 3WP0A 3ZLBA 1Z25A 2JCXA 2D3TA 3NTVA 4BDTA 4JUFA 1L8LA 5FDFA 2NMVA 3ASPA 5I48A 3SHFA 2ZUSA 3P7MA 1Z5VA 1E6CA 1J8QA 1Z3IX 2FK8A 5MFPA 2N9UA 3JYNA 4S3MA 3HNRA 4I3GA 1NX9A 5IW8A 1WV0A 2AL7A 4M9SA 2IFTA 3CF0A 2QGZA 1XVUA 3H16A 1IWOA 4JBWA 1FS6A 4FB5A 1KR2A 4HB4A 2WVGA 3TLKA 4H7IA 4I46A 4DDMA 3QKSB 4B4UA 2CB0A 4Q12A 3N6XA 2I6SA 3CNBA 4MQLA 1NHWA 3UAOA 1BE0A 1W1UA 3VDNB 4PGOA 1JZTA 1RYHA 2ZTSA 4C3UA 1TI7A 2EDCA 4D8TA 4Y3UA 1IVNA 1M8KA 3VU1A 5I8ZA 4CF3A 1XMIA 3GGOA 4L8GA 5KYWB 4Z0PA 5ILGA 1HTTA 4U7FA 1CHDA 4FFPA 5JCJD 1OXUA 1QBGA 2R48A 5IHPA 2R8YA 5F1KA 3K70C 5EE0A 4DV5B 2J7PD 2QI9C 1YRYE 1J90A 1VJ5A 4HDRA 1VPTA 1FFCA 3HMKA 1DI0A 1YR6A 5I5EA 5GOTA 4L9SA 3OOYA 1IIBA 4CL8A 5IHXA 2FJ0A 1QFXA 1G63A 4J0HA 3ZY5A 2ZB4A 2XUGA 3JPYA 1ZNXA 4AB1A 2WFZA 4ZU6X 5E2BA 5AKYA 4I1IA 3I73A 4PW0A 2JJ2A 3C15C 3E70C 1S5PA 1YFKA 1E1NA 2ZRKA 4QUAA 3ZV6A 1M83A 2DUUA 3A2LA 3R5FA 1WRBA 4NDNE 5I5GA 3MBOA 4DKJA 1KI8A 1E5TA 1S2LA 4YV7A 1Z2EA 3BFPA 4GGOA 3PC7A 2ZITA 4QSHA 1ORHA 4MTCA 3ONYA 1DO2A 3QV1A 1K97A 2X0JA 1UBJS 4FSDA 4IIEA 4R6XA 1UBLS 2IIPA 2QLBA 1L5LA 3GZJA 5IWAB 3GVJA 1F0PA 1O1YA 2AUNA 3DM5A 3CT6A 5BQ5A 2TSYB 3N86A 3NDPA 2HYIC 1LW7A 3NT4A 2OGUA 5AH0A 1FFHA 2IIBA 2JIMA 3GMSA 4FX5A 4RO0A 4D74A 2VZ0A 3UICA 1WXDA 3U9SA 3T1YB 3FB4A 3EA0A 3I04M 1RXVA 2DAPA 3AP1A 4BGIA 1DCMA 4D3YA 1Y81A 4B4OA 2CJWB 1YOVB 2D13A 2ID8A 2AUTA 3LXRA 1T5HX 3O82A 3PFHA 4HH4A 4O2LA 1OMOA 4DY4A 5GJBA 2ZBUA 3T06B 3DMNA 3VHLB 4ZZ0A 3AY3A 1KF0A 4CM4A 1I2CA 1U4SA 1J9ZA 2VQ6A 3GXBA 1UP7A 1NRIA 1O87A 2KWIA 2V55B 1EM8B 2WYWA 1P80A 1VHEA 5CJPA 1G64A 3SI7A 2XMSA 1U9CA 4OFBA 3BS4A 4OQPA 3RIXA 4EDHA 1EINA 3PFCA 4FE4A 3FJYA 3PVZA 4OP7A 2BTOA 4B74A 1DG3A 3KDPA 4TL6A 4ZI7A 1HTBA 3ZVKA 1D6SA 3W8EA 1V47A 1II9A 1KU0A 2X9QA 4TTQA 1Y0YA 5CXQA 2ZUVA 4EAAA 2DEUA 2CVZA 3FNHA 1G7CA 2PZAA 2CHFA 3DFIA 3MRTA 2QY6A 3NKFA 1NA5A 3NWPA 4HTFB 4WHMA 1HGXA 3ORRA 5FCDA 2V9PA 3UAGA 2QTVA 1U99A 2KM1A 1HEYA 5DGCA 3RBXA 2PR7A 2WG0A 1SUIA 2V7EA 1IHYA 3PNLA 3EE6A 1R5OA 1U3CA 4H1TA 1EAYA 1MT0A 2K6GA 3DE1X 3U3DA 1XIVA 3Q0EA 5BT9A 5T3YA 5SZKB 2RH8A 4DVGA 1Z4LA 3CNOA 4Q3NA 4KOAA 4PGAA 4ZCPA 4TZ6A 4RETA 5LDDC 2BTQB 2GT1A 3IEXA 2XBUA 3PFBA 1EM6A 3WFIA 3GL9A 3E05A 4LOKA 4CLDA 3LO5A 3A9SA 3WADA 4AMVA 4QTTB 3OLYA 4JBYA 4DCUA 4L02A 2DETA 4XYBA 2JFWA 2QVGA 2X40A 5ALJA 5KYUB 1NF8A 2VSYA 3DMHA 3R0IA 4DG8A 2OO5C 4KPUA 3HZZA 3VU9A 4IQ4A 4XLLA 2NU6A 3BRQA 3H42B 1U2QA 5IDWA 1YJNB 2F67A 5F7OA 1CQJB 3BWDD 4D9BA 5M34A 4B3BA 1N2XA 1R8QA 4GR5A 4NEHB 3LQEA 1M2OB 3LPDA 2R6AA 3DE7X 1M66A 3CV3A 2ZSDA 3CF2A 3RSZA 3T7EA 3TL2A 1R6XA 1D09A 4YP1A 1RW4A 3KTFA 4WADA 1Q21A 1A8UA 1FXWF 1GGNA 1SXHA 1JG6A 4Z1MD 1KWKA 1NYQA 4YCJA 3AESB 5IH3A 1QMPA 1DP4A 3PGVA 1OAKA 1CR4A 1W0JA 4PC3A 2CHGA 4XQFA 2KHZA 2Y76A 1CQPA 2Y66A 3ONNA 4PLYA 4PV7A 5EWJB 5FFFA 2BC9A 4G1FA 3WXBA 2BH2A 1JA1A 3R20A 4LXIA 1A77A 3TGLA 1SBHA 3DXFA 2CYCA 5DULA 2QRHA 2BFAA 5IJ9A 3C8MA 2W0SA 4O4HB 3R6KA 1SG9A 2BGMA 4W1QA 3RTEA 3V3KA 1NLMA 5F52A 1PR5A 1YAHA 5HZMA 3M6IA 3OZGA 1HH4A 1LF0A 1ZEMA 2RBGA 3ZNOA 4ZARA 1KEVA 1KI7A 4YV1A 4CYMA 4YT8A 2IV7A 5A2QA 1Z08A 2NNLD 4JBHA 5TSDA 4EMUA 4Q34A 2ZRNA 4MS4A 4RA9A 4YV2A 3K6JA 3CRNA 3NHBA 4XSHA 5TDHA 3P0IA 4MCJA 4QPJC 4RH1A 4ZI3A 1Z7YA 4BNLA 3NS7A 1QR6A 1OLUB 3SVLA 3OQPA 4ETMA 4ZYTA 2VHXA 4GOLD 4OHMA 2XWJI 1QGAA 4YWJA 2CJFA 3HJGA 1CZKA 2GDZA 2HA5A 4Y6GB 3IIJA 3PEEA 5CNIA 4CG3A 1UD6A 2NPFA 1Y48E 5HIMA 2WAOA 3A28A 3E8XA 3G17A 4MIYA 2ZI3A 4M53A 5TT0A 3NJ4A 2ZE7A 3AMVA 4JB3A 4OMUA 3W6OA 2PXCA 3DNPA 3ZHYA 2EJVA 3VI3B 4F6RB 1YMUA 3VOSA 4DCCA 4C0AC 1OX4B 2JKVA 2UZ1A 3UUWA 4R6WA 1XPJA 5KSPA 4QVKA 3DHNA 5C3MA 1RTTA 2BHLA 2W42A 3Q98A 1JJIA 3FJOA 1G38A 4UMEA 2GEUA 1UFQA 4CV3A 4EJ2A 5K6TA 1ETHA 1PJSA 1XF1A 2WYIA 2I80A 4E4YA 4I1PA 1XRRA 2DPLA 1MW9X 2XCQA 1C2YA 2PN1A 2XRMA 2FTKE 1A88A 1K5GA 4LZZA 1V26A 1XXLA 4K9OA 1JQ5A 2PY6A 3FUCA 1E2MA 4IIYA 5TGTA 4B09A 3F98A 5KUTA 1EDOA 2X6XA 5CIQA 2W6QA 3DTYA 5AOCA 4ZOLF 4CLRB 4MKGA 1N8KA 3WYGA 2XDAA 3IULA 1Z5PA 1B0UA 2Q7OE 1DOZA 5HNKA 1IHUA 4HFMA 3D0KA 5LKRA 4NQZA 2AN5A 4E0BA 1VLMA 2D7DA 1OH7A 2C4TA 1CW2B 1I3OA 1LBIA 1NKVA 3X3HA 2BEUA 3DE5X 2NT4A 3GD7A 4W7IA 2OK7A 1QP8A 2Q2QA 3R5KA 1RQ2A 1GNSA 4G0XA 1GTMA 3WIDA 4EHIA 1VE5A 4MUEA 4V39A 1DSSG 2FPIA 4ZRMA 3RS0A 3PU6A 2EP5A 4YBZA 3VDRA 1XFOA 1S3IA 4B17A 1CPYA 1GQ2A 5C8YB 4HVCA 1RVDA 2VCEA 1MC5A 4R1NA 2QMOA 2OGWA 2WLSA 3LCMA 2PT7A 4H7PA 1RRCA 1J8MF 4URXR 2IKSA 2L18A 3G2PA 1G8FA 1WCXA 2J4CA 3CURA 4QD3A 4DKXA 2Q1WA 1UL1X 2DKOA 1JALA 2IYQA 1Q1EA 3EF3A 2AJ8A 3PA6A 3U37A 4LFAB 1ZU4A 1RYDA 3H13A 1J1IA 4Q3CA 5LIPA 5ISMA 1NKSA 1EGVB 2ZRIA 2NXCA 2PBZA 1CJVC 5KYTA 2F59A 2H1OA 3I05A 3U48A 5F4JA 4XN3A 5H82A 4E2FA 1KEZA 2ERCA 1RM5A 1QONA 1PFQA 4JLOA 3RTAA 3L8CA 3E9RA 3TI9A 2YN4A 5HQ3B 5B6PA 1ZM4A 2O7NA 1JP7A 2VLBA 3FYUB 3CUTA 3PKZA 1ULHA 4TXMA 2IXEA 1OW3B 3CMCO 4H60A 4UMFA 1E9DA 4ENTA 3UOWA 1XEAA 1FJHA 3M33A 1PJ5A 2PZJA 5REQB 3TZHA 4ZO7A 1A4XA 5J2TA 1MLDA 4FFMA 2ZRPA 5LMNB 4YC7A 5KNCH 4AQYB 3MS4A 5G4KB 3G4SB 4C4ZA 4DIDA 4H3SA 1G42A 2BE9A 2V98A 2VP6A 3DE0X 1T3ZA 4IV5A 1D2AA 3IC5A 1R6AA 3KTOA 4MR8A 2PS1A 2VHTA 5THXA 3WGUA 3GBSA 3HKEB 3P0RA 4L6CA 4M7RA 1EFVB 1CDDA 1K6JA 5AVJA 5ADWA 1YBFA 4WFKA 1OPXA 1XCJA 1LGYA 4HZIA 3MT9A 3E3AA 5C1IA 3LC1O 2HMVA 1Z38A 3G9UA 2Z4TA 4U5XA 1Y8CA 3CVOA 3GLKA 3TN7A 2FUEA 2NZYA 1JG3A 2I03A 1I4TD 3ZDYB 4OJMX 2W83A 3V7YA 3EOZA 2P7IA 3DZDA 4XQCA 3DTVD 4HLUA 1BGVA 3PGA1 1P9RA 1PSWA 3H5RA 4O4IB 2GN6A 3RS8A 2EBWA 4KE8A 3JZIA 1V7CA 2H2AA 1V5EA 2X86A 3STVA 1PCXA 3G9TA 3HDTA 4L22A 3I58A 1FUYB 5FAXA 2JJ8A 2XB9A 3EF1A 4C7BA 4EUKA 1RCUA 3GEPA 4B79A 2ZZNA 1VKOA 1LI5A 5IABA 1E2IA 1ECFA 4JELA 2I7TA 1GUDA 2W9XA 1FNSA 3GCGA 3K3PA 1PG2A 4IINA 1IE3A 4OH7A 5JU6A 1OIWA 2XEDA 2BGKA 3ASYA 4L5JA 4DREA 1GQOA 1ZH4A 3HHEA 1NMEA 1SUFA 1WMSA 3FDZB 4MJ7A 1MOZA 3DVRX 4HYQA 3UB3A 3KB2A 4ZHQF 3WL7A 3R3XA 2Y0BA 2D5BA 4IZ6A 5CVEA 1V7PC 3ZIAA 1UBTS 1B14A 4W5TA 3IO5A 1ESEA 4HDKA 3KNZA 1A8PA 5AM2A 5KIAA 1VRVA 4KL8S 3HSKA 2C5GA 4XYGA 3WICA 3ZQJA 3IIKA 1GGKA 1PL7A 2JAWA 3KCQA 4DJ5X 5CDTA 1DKPA 2VHYA 2HFKA 2A5JA 4RV5A 1NVBA 3SMQA 1WHSB 3VAAA 1G41A 4KWTA 1QE5A 5HX7A 4G7XA 2AFIE 3K0EA 5CPBA 2OG2A 5BRAA 1KTVA 4JB8A 1SA0A 4C5CA 4QXQA 2ZBQA 3TRDA 3F4LA 2FGJA 4TMXA 1NXQA 4U6NA 1TRKA 4E1VA 2I4TA 1AU9A 1DLJA 1GZ3A 2W4IA 1ONPA 1VE7A 4G07A 4J0JA 4PCUA 3KZKA 3THWA 4ZVQA 2G8LA 3KEMA 5GPBA 1E3SA 3DGEC 1U5BA 4EW2A 3UJ7A 4YRZA 4X00A 1M7HA 3UK1A 5I01A 2WYOA 5HDBB 3L4BA 2APJA 1BU8A 3PNYA 4OFZA 3V6MA 3HQ4O 1DXQA 3CKLA 3EZGA 2XSZA 4WCDA 3VZCA 1KZ7B 2BWJA 3G0BA 2PKXA 2W2OA 1NI3A 3M1AA 2XNCA 4OEHA 1Z7EA 4Z0NA 2MJLA 4OYYA 2XTJA 3N8GA 3UKOA 3I61A 2QZZA 1V5VA 4TTJA 5E7QA 3DYIA 1WNTA 2CE7A 3NBMA 3DP7A 5KTPA 5ICGA 4BX3A 1R9GA 4BLWA 3ZCUA 2JAPA 4RWEA 3UK7A 5IYZB 1WXWA 1E6MA 2W90A 4IVRA 5FOVA 3DKKA 3I2IA 3FTQA 2A30A 4U2GA 4YCAA 3NYQA 2BZ0A 1UXJA 1CLUA 1ZGAA 4I5FA 4M0PA 2M5SA 4NPAA 1F2VA 2BDTA 5KQPA 2PVCA 5CAEB 2FJPA 1YIDA 4MPRA 3OWXA 3JY6A 4UUQA 3VISA 3DDHA 3PLRA 4ZT7A 5B6JA 3T3EA 3O8DA 2VBGA 3O8RA 3ZI0A 1U65A 2AFIB 5A62A 3I1FA 4RQUA 3LU1A 1Y9ZA 2CSUA 1H5QA 3R09A 3A37A 1E1CA 2VZ8A 4KP7A 1WSVA 1XTIA 1G7RA 2OAP1 4F5WA 3QBDA 4GMDA 5DNYB 3C8DA 3HUEA 1IZZA 1O9GA 3QVGB 2C2BA 2UYCA 1SZJG 1Q91A 2XTZA 1UZAA 4RKWA 5C7IO 2H9YA 2ZS9A 4Q1CA 3QRWA 3L18A 4QE3A 1JHYA 3WZMA 5CB0A 1VQ1A 1YQEA 5E1OA 5K9ZA 4J16C 1E2EA 3QBVA 1DKQA 3ZKAA 4Q7JB 1V1MA 1JG7A 3QVTA 4Q4CA 4OL9A 1B26A 3QPVA 4O1IA 1E61A 3IHTA 1VKJA 1Z2CA 2X9NA 1EXVA 2GZ1A 3DBIA 1NQUA 1Q44A 3GQVA 4BE4A 2BP7B 1XCMA 3FR8A 1E3TA 4IL5A 2XVAA 2JFGA 4R69A 2QPOA 2JGNA 2CSXA 3F46A 1FA9A 5F4ZA 5CEEA 3MWGA 3MRXA 4AZ3B 2E9SA 5DHAA 2JHPA 3I1IA 3JD3A 4YMIA 5LB4A 3OTHA 3UCEA 2HNBA 5FLEX 2Z8YA 4RSGA 4UBJA 2WSYB 1F0NA 3N07A 2OWEA 3LF1A 4LCEA 5FL3A 1M6EX 5B5SA 4I55B 3KC2A 4R9SA 3HUDA 1DRUA 1EXDA 1XD2B 2HIGA 1J20A 2HPHA 1WW3A 2W43A 4FEGA 2BAGA 2IHUA 3L1HA 1XN1A 5IAEA 1VXRA 3DCYA 4I5DA 1J9GA 3C98A 4EI9A 3QTLA 2FMFA 2ZVDA 3EODA 1IWPB 3A4LA 3HWWA 4ND7A 4H1HA 2R1VB 2R0QC 2H51A 4L5AA 4LIPD 2OC9A 4BFLA 5JUWA 4IVQA 4WJZA 5JBQA 4BIIA 3GIRA 2R8XA 4KRFA 5CGZA 1EIWA 3ZYCA 3DO6A 3FYTA 1QIHA 3GVHA 5J5VA 2C3PA 2ZE8A 3RRJA 3VH4A 1OI7A 2J30A 3L0ZA 4A2PA 1J33A 4I4TB 4DTIA 4RJIA 3HSSA 3KEGA 5BUSA 3CRRA 2HJWA 3JQAD 1CG6A 4TXJA 2J7PA 3IHKA 1R8YA 3EGOA 1K6XA 2ZXFA 3JAWB 4GLBA 3DEYX 4NKRA 5TARA 3W6UA 3ZU2A 5B7GA 3DEIA 4JEMA 5J2UA 2GVDC 4RWZA 1QHIA 2PGIA 3WGYA 3U6KA 2LGJA 1VLHA 3PQEA 5K0BA 3AJDA 1OJLA 3OLZA 4WACA 5LLDA 3B1KA 3RSOA 1L5ZA 4FGSA 4LQCA 1NVWQ 4BX0A 2FMIA 5HUHA 5E3IA 3RRFA 4CR6A 3HPQA 3OCJA 2FVGA 1IFXA 1KS2A 3FWNA 4MEBA 2E89A 4PYJA 2WABA 3PE4A 3T41A 2VNIA 1GG5A 3FNBA 3A4MA 3L8GA 3MT8A 5IUKC 1QGED 2J41A 3ESRA 5ADUS 1Z26A 2C0PA 2DLNA 4MGKR 5IYRA 4AQDA 4CFSA 4GOJA 4U2EA 3OH8A 4NE9A 4F3CA 1NXPA 1V7ZA 3CFYA 4GL2A 1E1LA 1YB1A 4MAFA 2J3KA 5AI6A 4EENA 1XELA 2O48X 1X13A 2Q49A 5IC4A 5AUPB 4EA9A 4GW3A 5TV2A 4JUDX 4V0KA 4ECAA 4CV1A 4XVQA 2JHCA 2O8FB 4QXOA 4A2QA 1QRUA 3ZXXA 3KUCA 1M8PA 1F6DA 1JF8A 4RM3A 3LQFA 3QTTA 1M2EA 3W5IA 3U1TA 3K53A 3VHXA 5JXHA 1P44A 2RH9B 4IG4A 2B36A 3FHCB 3OA0A 1FOEB 1NPTO 3U9TA 1A5SB 2GYWA 1EWKA 2CJWA 3FOBA 3WMEA 4HXFB 3SEJA 1U8YA 1E60A 1OV4A 1R66A 3SIWA 2W5UA 3R0XA 4CMHA 4Y6PA 4O3MA 3JQRA 1IY1A 3C6ZA 4KZKA 2E4WA 4N1AA 4L72A 1CJKC 1V71A 2REBA 2QORA 1FQOA 3OZ7A 2XCOA 3JARB 3H65A 1CUIA 3A32A 3TW8B 1N5RA 2QV7A 4RTMA 3G2NA 1YHNA 3W5JA 1MX9A 3HMQA 2FLWA 3OBBA 4XWAA 3BMOB 4IOKA 1E2PA 3SAJA 4EPTA 3KSBC 4G97A 3CCMB 3ZCPA 2OHIA 2DHQA 3NBUA 1JH8A 2F43B 2G28A 3ZWKA 2R84A 2FZEA 1Z0IA 5LJLA 4DSAA 4KGZA 4ZTUB 2J33A 4IKPA 3VZBA 2YV5A 4W63A 1GGMA 5T41A 2PRIA 2GN8A 2G3YA 3DNMA 1JEYB 1Q84A 4X06A 1T5BA 5FWAA 3R2JA 4PQRA 1X70A 3ILYA 1NY6A 4UZUA 3IOEA 4ACAA 3ONDA 3SOPA 4FEEA 1GPAA 1H3NA 1OXVA 4PZDA 5AIBA 3ND8A 1WOSA 1YZTA 4P32A 3IURA 4MDHA 2C95A 1ADYA 4PG8A 3H5WA 4LYYA 2PNJA 3X2SA 3BBLA 3ORHA 2BTQA 3JATB 1OWLA 3QI2A 1SU4A 4G81A 3QE9Y 2O2SA 3LQRA 3CBGA 4K9KA 2CV1A 4KR3A 1T43A 3AHDA 3UJHA 2P5UA 3CKMA 3ETHA 4XSVA 4CW7A 4EH1A 4DMFA 3KU4A 2ORVA 3LWZA 4NONA 4WEQA 2N46A 3KTAA 4BPRA 4DEXA 1XPRA 2J4DA 2RAUA 3AL2A 4MROA 3DFUA 5MDHA 1NPDA 3M9XA 2F9FA 1XNRB 5K3DA 1Z4NA 3PA2A 1A9XA 3KQLA 2B4AA 3CU5A 1Y3AA 1DS6A 2F1KA 2VH1A 4PPYA 3CPHA 1Q7CA 2HBRA 2JIPA 5FOSA 3W8NA 1X7YB 4ZMRA 4EDFA 3WS7A 2FWPA 3Q8KA 5FUMA 2QNIA 3IBYA 1QVRA 1NN0A 3HU5A 4BBZA 1X39A 5KTYA 5JSZA 2JJ1D 2WTNA 3Q9SA 4ED9A 1Q5PA 1PQ4A 4HD8A 4JN6B 4K1XA 1T3TA 2G17A 3EDCA 3GCXA 4U7TB 2RD2A 1KPIA 1D2RA 4MVJH 3WHPA 2IEYA 2P30A 4QUDA 1HZZA 3AEQA 2GTHA 1J4AA 2QJOA 1EFCA 2DHRA 5I7AA 4R84A 3PUMA 1P1CA 2G9ZA 2GDJA 4ICIA 4UMDA 2RGYA 2D5IA 3UYKA 3ZJ5A 2B4KA 3S27A 2XMDA 3PFWO 5KQRA 2C7RA 4NABA 4H1UA 4CEJB 4L7QA 3K0CA 1PLKA 4J9VA 4G0OA 4EO7A 3NTUA 3FPKA 1J1ZA 2FQWA 4B3XA 4RK4A 2DFKB 5AWFC 2Z6AA 4ER0A 1ODJA 3B12A 3V4OA 1OLUA 2QMQA 3A9TA 3QLUA 2FUKA 3CUWA 3HDJA 3P32A 4GM1A 2WU1A 1BEUB 4AMGA 4QUJA 1ZONA 1JDBB 1ZGHA 3HLYA 3RHTA 2WNSA 4M9QA 1HFKA 3LYUA 1WUIS 2G72A 1P2BA 2QBYA 2C7OA 1KK2A 3PUIA 4YJHA 1MB3A 4GSLA 4X1YA 1TJ3A 2A57A 1OB5A 3PFKA 5ELMA 3ZI4A 1RM4A 3OTGA 2P9FA 2Q3JA 3F8SA 3N5CA 1OLXA 2Q6IA 2CNKA 4WZBA 4HC4A 1KAGA 1QIJA 4O2RA 3TNFA 3BIWA 3RYIA 4BDSA 5JADA 4KUHA 4TTPA 5U1PA 3CB4A 1U8UA 3D5EA 3E5HA 2AD1A 2R3SA 4BAGA 4AUMA 5BV8A 4ZJUA 4OPOA 3CLRD 4MLDA 3U81A 3JD1A 4EJSB 4UBIA 1GZUA 2TRSB 2AC2A 1MIOB 3FCXA 3U26A 5IXYA 5L6MB 2PXXA 4XM0A 2PT5A 5SICE 1PJ8A 4CLRA 1QTNA 2C8VA 3DVAB 3RUIA 4JP8A 4MQEA 2X3YA 1SXJE 3CR8A 1Z4KA 2FWBA 1UJ4A 2X15A 1CB7A 4RDJA 1Y6RA 2WRZA 3G88A 1ODFA 1Z22A 3Q40A 2IX3A 5L6LB 1Y8AA 2WICA 3BJZA 3MOSA 1IBCA 1S8FA 4QO7A 4ZMSA 3N2EA 1K66A 3B48A 4DSOA 5JXIA 1PK8A 5DWDA 3LFHA 1PFGA 2ZZEA 5HIAA 5L3QB 2F7SA 5ED0A 4NFYA 4Y1RB 4BFXA 1VI2A 2QRNA 4MQUA 2YW9A 4QVGA 1P1FA 4MV8A 4RVHA 5EQTA 2P6OA 4ZU3A 1S2GA 2BFDB 2ZTMA 3RIGA 3H1PA 4MWOA 2ZE5A 4Q9KA 1YMVA 2FCAA 3G0HA 2VK4A 2QTAA 4V02A 5EIHA 4D4KA 4C2TA 1N1DA 1XKQA 1ZLYA 2C57A 2RHCA 5D6OA 4NVRA 1Z6QA 4LF9B 3R8FA 2KPOA 3F96A 1A1SA 2H5JA 2HY7A 1M90D 4OXQA 3SC6A 2JAHA 3CLHA 1EBFA 3KVYA 1BFKA 3LVFO 1B6TA 1NP7A 1GYPA 4V2UA 2OBBA 5BORA 4C3VA 5KTSA 3AM1A 5KNCD 3SLKA 2GK6A 1LSOA 4K2AA 1CYDA 3IKJA 3PHBE 4RVSA 2J67A 4ZEVA 2JLWA 4Z4VA 1V6SA 4UTZA 2H0RA 2UYYA 3BMCA 1LS6A 1P4HA 3EGXA 3SJCA 5KMGA 2TMKA 4OY3A 1IBRA 2J59A 1JR4A 1P19A 1GCOA 2AFRA 3ESQA 3R6LA 3RT9A 1L5SA 1U2GC 1YS6A 1N2IA 4V0ME 3WGTA 4MV4A 1EMDA 1BHJA 1FUKA 1TRHA 2FPXA 3ESAA 5EWMA 3A9CA 1EE1A 3PDJA 1SXJB 4BWGA 4YR7A 6NULA 4YLEA 4I9UA 1DHRA 3K5HA 4JCOA 3SFZA 3FWPA 3WSTA 4CGYA 3K5WA 4PZLA 1SXJD 1RRMA 4XWTA 1GUFA 4W5OA 3RK1A 1T1GA 2NSYA 3RSGA 3ZPNA 3WGGA 1JIIA 4E07A 4YAGA 4WKCA 3A14A 1XKTA 4TL9A 3VR0A 4BP1A 4C4YA 1GA1A 3H4VA 3RC7A 4QBTA 3B7PA 4QYIA 2GBPA 2I87A 5BNWA 5B1IA 3DHWC 4PRKA 1HT1E 2IP2A 16PKA 3ACDA 3FVWA 3DTVA 3BOSA 3C6XA 4I2NA 4L3OA 3P9PA 2E2WA 2V6FA 1YJWB 4FS8A 3WMFA 4DA6A 5EKXA 3FOWA 1H2XA 1H05A 1MVOA 1VLOA 4GZ6A 5CFNA 3E9ZA 5ULLA 4IRXA 2W71A 3QY9A 2HO5A 3OQHA 5K45A 2QOEA 3O47A 1VQNB 4AMUA 1JDZA 1LRKA 1NLUA 4G5HA 1UBOS 4PXYA 2LW7A 3VNUA 3ODPA 3TVTA 3O2NA 3UGTA 1DEAA 1M1UA 1UFKA 1KAOA 3JD0A 2BM9A 3QFCA 3D3QA 1HDCA 3HB0A 4OBEA 4HZGA 4Q01A 5GMOA 1QNFA 1P3JA 3UJ3X 4QVJA 1D5CA 1SVOA 4YEJA 4Q3BA 1ZR4A 5JOQA 2R68A 2DFVA 3GAFA 5LBTA 2JLRA 3OURA 3M3PA 1G5IA 4IEFB 4CKXA 3WWCA 2BFPA 3ZE9A 2CC2A 3DEJA 2W6ZA 4GIBA 1G0OA 4PHHA 4A8PA 4HEA6 1I7SB 4J0DA 3O8QB 1F51E 3HKDB 2CN1A 3E7DA 4HY3A 2WT8A 1YL7A 1M2GA 1VMEA 2H1WA 1PEKE 2XNSA 2OGZA 2P41A 5IAOA 3HN7A 4EG5A 3JVVA 8OHMA 1IM5A 1JDBC 4HIZA 1MQ9A 2PKYX 3GUVA 3MCWA 2SNIE 1JI3A 1UJBA 1Q0QA 1DEKA 3A27A 2WUGA 3QPWA 5K8LA 4ZOEA 3SIXA 5JS2A 1UMCB 2XE7A 1NASA 4IFBA 3NWEA 4CKZA 4DT1B 5IDVA 1G3UA 4EY7A 1RLMA 3NVDA 1WQ4A 1LXCA 1L1EA 1J2UA 2G70A 2HU8A 1SEPA 3LQ6A 1RADA 3EXEB 3U40A 1QH8B 3V8NA 1DTSA 3VJRA 3KV1A 3DAYA 3LLCA 4TQUS 3BUSA 1HYBA 3NFYA 4MWSA 5CJ2A 4OHZA 2GD1O 5I7VA 3PHHA 4YMGA 1N05A 1PS8A 2CYAA 1ZH6A 3RD5A 4DAOA 3KTDA 3SQLA 1X7ZB 3EVDA 4G23A 1BDIA 3L0PA 2HYDA 4LGVA 3F3KA 4UKDA 2X14A 3ZVRA 3O9ZA 1H2WA 1RP1A 5CYGA 3L6DA 3LUKA 1A8HA 1XHEA 4BAUA 3Q3AA 4CDGA 4J75A 2W2KB 3S81A 2OBTA 5M5BA 2BELA 2AN9A 2UVPA 4G56A 1LCIA 3I12A 4UE6A 5DFAA 4CR8A 8ATCA 1K98A 1KO8A 1XVVA 2CUNA 1M2HA 4L57A 1DEOA 3RIHA 3EPHA 1RLTA 2AUMA 2IHVA 2ZJBA 1F8FA 3L6EA 4M8LA 2NVOA 1GDDA 4F4DA 2QTLA 4M36A 3NHAA 4YCSA 1GVHA 1M2NA 2NU7A 4K03A 1LLCA 3AEYA 4PYQA 1M5RA 1NVKA 3QHAA 1CUUA 4CLOB 2C7GA 1JMYA 2YUTA 3INRA 2J3MA 4J7UA 1EX7A 2Y2VA 1YQ9A 1Z4PX 4JP5A 4X94A 1I6KA 3UCFA 3CRW1 3RVRA 3M4JA 4Y2XA 4LYAA 4OD0A 2BGIA 4RENA 5CXSA 3SF0A 2FRDC 2J46A 1WBBA 2JLZA 2CL6X 5HEKA 5C1DA 5CT5A 3EHDA 4NYJR 3ZEAA 3D6VA 1YDWA 4S2EA 4I7EA 2XX3A 1CKEA 3CJTA 1I0IA 3RYHB 1XZNA 5CB4A 4RZIA 4QPDA 3WYEA 3L93A 4ZQEA 2MYTA 4Q9NA 2VPYA 1S72B 4JU9A 4XUDA 4YMTA 4JI4B 4HH1A 5AUNB 3NBQA 2PZMA 2P7HA 1CUWA 1JFVA 2IOFK 2OENG 5I9TA 3FPHA 1FYVA 1Q1ZA 2DBQA 4JVSB 1JPJA 3T4PA 5AM0A 2QMZA 4KQFA 3QEBZ 2XDWA 2C2WA 2AYYA 2WJVA 4TOIA 3STTA 3HKBA 4MSUA 3IALA 3DC7A 3F6RA 4X62B 4LE0A 3SU8A 4NNPA 2HA6A 1OFHA 2GERA 2VUTA 1QHXA 3E84A 3TZEA 3U3XA 1MH9A 3FPBA 1NU6A 2OK8A 4R9UC 5AT1A 1QBKC 2PSDA 2ZAIA 4YDRA 3OZWA 3AY0A 1SHJA 1VHDA 3G3EA 2AQ8A 3R0JA 4S1OA 4FW8A 4CQMB 1YA6A 3CS3A 1BIFA 4MYTA 3JVUA 4D4GA 1YQUA 3B1XA 1H2AS 4R1MA 2JCVA 4R2MA 4NHOA 4D0NA 4N5MA 2JFFA 4YJ2F 3BB1A 2GNPA 3ZUPA 2WDZA 3THRA 1TJYA 2H2IA 4MRNA 4Z6KA 4Q05A 1LF5A 3IKLA 4RVUA 2DYKA 2C07A 3JQAA 4YK7A 2VT7A 4AG6A 4FFVA 4I4TA 4FHFA 5BQFA 1J97A 1V11A 3U6BA 1KQPA 1V16B 2NUBA 3E81A 9LDTA 3PEUA 1JL3A 3HFRA 4IOJA 3K1AA 3ZZMA 2R5NA 4CI9A 4EO9A 2GJ4A 3LECA 3UUFA 4TYYA 4JLJA 3ZHOA 2XYGA 1EVYA 3O92A 4ZCRA 2Q4OA 4YRPA 2PTGA 3L1VA 3AOGA 4ZT4A 4G36A 1QCCA 2AJCA 3TBFA 4ZXPA 1NE2A 4J8PA 1BS9A 4WBNF 4JNCA 1ORRA 2NXEA 4FMDF 4HNAB 4OJKA 4PO1A 5AK6A 5TRTA 2GXUA 5KTNA 4CXMA 1ULBA 3JQFC 5EVJA 1QKKA 3GVLA 1U0GA 3KO8A 3PNQA 3JQ8A 3BCHA 4Z86A 2X0EA 3RQIA 1H2EA 1YB2A 2H31A 3PQ3A 5J1TB 3V34A 3VSEA 5JZVA 1XVTA 1CF4A 3DOCA 1UJ5A 1BDMA 4DSTA 3QE3A 2Y9MB 4HQNA 1QRSA 2BJHA 2C99A 1GTZA 3PNBA 3PXGA 2QW0X 5EIFA 3NEYA 4YACA 3AVPA 5COQA 1MEOA 3MCZA 3CEAA 3OFKA 3IE1A 3UQYS 1M1NA 4IEIA 3O4JA 3GT7A 1KEEB 4GF5A 5K3CA 2WZDA 4YRKA 3DNFA 4PYOA 3UJ8A 4J6FA 4KBGA 4XAQA 4O25A 4COOA 3BM5A 4DEVA 5JD4A 1HMYA 1TMOA 1ABEA 2AIRA 1JMVA 3MLBA 3NZEA 4MWEA 2QQ5A 5H70A 3IDFA 2RB4A 2YASA 1LRLA 5J4VA 4QATA 5A5VA 1GCGA 1KMHB 3R77A 4KAJA 2VJDA 1JYFA 2X42A 1XO1A 5CVJA 3JR3A 1E3DA 1O0CA 3OKXA 1DAOA 3JZDA 1O7JA 2VLIA 1Q7RA 3ZNQA 5KW9A 1QZXA 2X9VA 3FOAA 4NZMA 3R7SA 4PNEA 2ERYA 1ZG3A 3LOPA 3DMTA 1Y0BA 2Q8NA 3KHUA 3KU1A 1PX2A 2ZB3A 3PUVA 1R2QA 3LUDA 3IILA 4KDEA 3AETB 4XH9B 2P9CA 3G1UA 4X5OA 1VI6A 2XZDA 4NCXA 2IU4A 4ZT6A 3NRJA 3U44A 1B0ZA 3CLSD 3QFFA 5EQJB 1KSGA 1POWA 3IAM1 4LE2A 5B4VA 5JO9A 421PA 5LP6A 5F98A 1AG9A 4CV2A 1UDAA 2H57A 2OV3A 5GIOE 4O29A 4DA4A 1T9ZA 2QAJA 3OG9A 1Y5IA 3LWBA 3MUFA 1Y4SA 4UHCA 1YJ9B 3W1WA 2IDKA 1M7GA 3NFRA 5DBIA 4N48A 1J23A 4KTTE 4BC0A 2DFPA 1BAPA 1TCVA 2P0EA 1DBPA 2GN0A 2VOJA 3L3BA 5EE9A 4ZK2A 1WB5A 1JB9A 3N2KB 4JBIA 1OBVA 4V0NA 4H2DA 4KWHA 3RC9A 2O2GA 3GVPA 4X8MA 3DFKA 3U4QB 4QQFA 4BNJA 1FRNA 1GITA 4HWRA 3FFBA 1V45E 1M6WA 2DWQA 1X38A 4R9VA 4AY5A 1QKJA 4I5EA 4MEJA 2IH2A 1K08A 3J7TA 2ECOA 3NTLA 1DKUA 3L9XA 5ER9A 1D07A 4JYZA 1ZD2P 2MR6A 3H7AA 3L8ZA 1ZJYA 3MPUA 3N8KA 3OECA 3WK4A 5EHQA 2RI6A 5J2TF 3AG6A 5AJVB 3UCXA 1HR0B 1G21A 4V3CA 4OV6B 1XZFA 4MVJD 4N8DA 1DRJA 1L7EA 1E6EA 1XLUA 5IG2A 2B0JA 2VATA 4Z9XA 2VNJA 4AJKA 5BOSA 3WRYC 3CSUA 2R6JA 3PJEA 5TPWB 4G1EB 5A2GA 5GVSA 4KNYA 3L0YA 4Z4EA 1NSYA 821PA 3ENQA 4MW0A 1T9DA 2DPMA 3NOOA 1MABB 2CUZA 3RQSA 2EX0A 3IUYA 2DPYA 3KKKA 1FQWA 1FZQA 1N8NA 1XL0A 3KOOA 1BXKA 3OP4A 4ZIRA 4CEIA 2GAAA 3UG6A 4PYRA 3VR3D 4IJQA 2FFJA 4XKWA 2CHUA 3P9CA 1RDFA 3K5PA 4NZNA 2WWVD 5BUZA 3K0FA 3LC0A 4IMPA 2IS6A 4PLPA 4JT8A 1VKNA 2QVZX 3GRAA 1W1WA 3D8SA 5FPQA 4IDDA 5FUYA 4XDGA 1Z6GA 2RHJA 5B7PA 4PICA 1VJ1A 1CBUA 2YXNA 3PXDA 1NV8A 4O33A 5LPNA 2G9RA 5B7QA 2HU7A 4CF6A 4C4OA 4TS9A 1MHPA 1IY9A 2QAGB 3VPGA 5E95A 1UOEA 2BFBA 4DANA 2XYVA 4XDYA 2D1TA 4KSCA 1T1EA 3R7WB 4Y9RA 3M4YA 2DPHA 4N12A 1OXMA 3RUHA 3A1CA 2P2YA 4GI7A 2IZ1A 3T34A 1D8AA 3ZS9A 4O0MA 3ESYA 1SC3A 2SKDA 5FKJA 4CKBA 5IWCA 2XUAA 4BNDB 3JQBC 4FCVA 5HJEA 1XEWX 2FZVA 1GRQA 1QHYA 5C5DA 4GUDA 1LSJA 1LLQA 1TEHA 2AYXA 2ET6A 2PL9A 2D2FA 3ADOA 5JPCA 3DV0A 2FZ4A 5I51A 1YSCA 1SFRA 5A4FS 4DK0A 4X3PA 1I8TA 1NX6A 1AQYA 1VRWA 4MWCA 2PUFA 4QOSA 2RSLA 4LV6A 1O6FA 3SDBA 4YT4A 1YZGA 5E9JA 5CGQB 5DTQA 3TD6A 2J6CA 4HNSA 5KBYA 4MYSA 4HTAA 4QLAA 1O4VA 2QD2A 3M0EA 3S2ZA 1QTIA 3STHA 4UZSA 4CKWB 4MVJI 5FNVA 5I9NA 4BKMA 2NTYC 4L28A 4ZV4A 1WQ3A 1Y7LA 2VHCA 2WUDA 3G89A 1EUCA 3ROQA 2GSWA 2R6DA 3RC3A 1PV1A 4R1OA 1B0AA 3T9BA 1G291 2GZAA 1KDVA 2YIMA 4CIWA 5JAQA 4J7AA 3GO4A 4RIFA 3ZLJA 2YZKA 4GBGA 3BMNB 2QTGA 3F7OA 5DSTA 4MV5A 4DBVO 1JQLB 1TA4A 2IEBA 5NLLA 1MPTA 1L8XA 1II8B 1N57A 1YB4A 3OCZA 4DJJA 1Q1BA 3AUKA 1JKIA 1LVUA 1TDJA 3PHGA 1XQ1A 1T3SA 4MI3A 4P1VA 2DTXA 3ZW9A 4JLWA 5TJHA 2HXSA 4F96A 1L7OA 4ZAFA 3SSAA 4C6RA 3GRUA 2M98A 2Q3BA 1Y7IA 5CA0F 1YR3A 1YTLA 3KT3A 5AOBA 1RLIA 1U28C 4AMYA 3UHJA 5IKXA 4IS2A 1KETA 3QVWA 3RKSA 1UPAA 3A4IA 3D9QX 4MR7B 1TXGA 1SKAA 1PO7A 3DTNA 4LY0A 5E2IA 4CCYA 3IBCA 4CN8A 4MGYR 1LQ2A 2C2GA 2CNOA 1SXPA 4OAOA 4QAQA 5J4LA 3LY7A 1PSDA 5KNCA 5IC5A 4UTPA 2X6RA 3D7NA 3LTNC 1QV9A 1AKRA 1RQPA 1TPZA 3TRIA 3GVIA 4O08A 4WGGA 1JHAA 2E87A 3L8YA 2C7BA 4BU1A 4OGWA 2ZRFA 3MBIA 5KHAA 3LXXA 4KQ6A 2DLCX 2PD3A 1JAXA 4GVPA 2A0YA 2C8KA 4AN1A 1C8VB 4M6WA 3TVYA 3QOWA 4Z0HO 3WYFA 3GB9A 2EG5A 2HCJB 3L7LA 3UFXB 3CUEF 2ODAA 4ISCA 1XCPA 3BL6A 3IMEA 1FFGA 4RHXA 4UD2A 2X0DA 3OZRA 3RYCA 3GLVA 4L0DA 4D43A 1X14A 2FY8A 3U4AA 2RB5A 1MAVA 3W4JA 3KJIA 4B80A 3TZBA 3EB9A 1IQUA 2CJPA 4MB2A 3KT8A 5DCUA 1KZGB 5DM70 2PRYA 3MWDB 3L1UA 2GQ0A 4A0SA 1A9OA 1W44A 3SKXA 1GZDA 2DHEA 3EBOA 3QF7A 4QDUA 3K30A 4AZ0B 3RVLA 2LNDA 2O8CB 2A94A 4IHJA 4QFBA 1FEZA 5P8WA 3DZ8A 1YV9A 4ZPXA 4HKTA 5K2OA 4DL9A 1C3OB 2BKEA 1P0IA 3LHFA 4EI7A 5HRUA 3H0EA 1NBHA 3DOIA 1BEZA 4W4TA 5KOJB 5FULA 5H02A 4IIJB 5I9LA 1TE2A 1UMBA 2G4VA 1ZIPA 3WVNA 2QXUA 3CNQS 1AXRA 4BOYA 4DCVA 4C4SA 3HEBA 5EXPA 3WV4A 4HEQA 3V7NA 4X0CA 1YZNA 2BHRA 2HBZA 4DMMA 4PS0A 4X6YA 2J08A 3WQSB 3GRFA 5UKDA 5D7NA 4YRBA 2ZZQA 4NU5A 3JWPA 3K0BA 3D4BA 3ZG6A 5JSUA 4OLBA 4KVGA 1USUA 1FW8A 3NETA 2ZJ1A 1X8KA 4MCIA 4HCJA 3U09A 2YV2A 4WNAA 4Z4IA 1RJEA 1WZUA 1ESNA 3KEWA 3WXMA 1ZRNA 2JGAA 2ZK7A 3GXOA 3KZXA 4Z9AA 3DLPX 3U13A 4FWTA 1P5FA 4MP8A 4HN2A 5BMVF 4CTNA 4F60A 4C0JA 4RFSB 2VQSA 2W6ID 4GVXA 1FS5A 3CZRA 1WB4A 3UTCA 3F5FA 1SHLA 3WLLA 4AX8A 2RHDA 3GH3A 1R1DA 3T54A 5IYQA 1JU9A 2QP3A 1GSOA 5BQ3A 1QORA 4X0EA 3T9AA 1Z6AA 3IJEB 4N65A 4NOLA 4ZHSA 1S96A 4N5LA 4E33A 1MCZA 4KR9A 4AKSA 1BOFA 2QMEA 1U7HA 1E5XA 1YS7A 2O2HA 4BN4A 2ZS8A 1CERA 3DD5A 3BEDA 2ZXHA 4ND5A 5T5QA 4C78A 2ZSKA 1N36B 3HVUA 2O1EA 3CVUA 1SK9A 1OTHA 1RC1A 1XK6A 2HCBA 2EF1A 1GL3A 2VPIA 1JEQA 4RU1A 3Q88A 3VHRA 4ZZIA 2Q9AA 4KQWA 1VPWA 2IC5A 2OQRA 4OXYA 2YY6A 5I8WA 5KNBH 3ECSA 5HXBA 2G9NA 3PX3A 1M1ZA 2NV4A 1SVKA 2H92A 4PX2A 5BN5B 3A6DA 2ZRAA 3LUHA 4MLZA 3KSUA 3RJ9A 1GEEA 3NIGB 2I4RA 3NUZA 4N5NA 1GG8A 1YZVA 1X7ZA 4F92B 2ZS7A 5IU6A 3WO1A 2A7QA 4C2UA 3ADDA 2R6R1 4BFYA 1F5NA 1R64A 2GOYA 1D1PA 1ONNA 3C3BA 1DTWA 4XLFA 1MP0A 1NMZA 3K9CA 5T57A 4JDPA 1UINA 3ETEA 4E5YA 2JW5A 4ENVA 2VHZA 1VE1A 4TYWA 3QELB 1E0AA 1B1CA 4D9MA 4ZU1X 2AJLI 2Y71A 3W8DA 2KBFA 1KQSB 1XMOB 1GCUA 4NULA 4BMVA 1MZPA 3FUTA 1M2VB 1U11A 3BFKA 3C70A 3P9IA 4Z4TA 3NDIA 3QEMB 5IBPA 1F48A 3Q2IA 2QAIA 2ZYAA 3KJXA 4WZZA 3AC0A 3JZAA 4BVHA 1HE5A 1KVRA 3VQTA 4DR5B 4XWKA 1X80B 2QRVB 5FHRA 2VJJA 3DPUA 5F2EA 2Q3HA 5DHTA 2VS1A 1J0XO 1PEYA 1V6AA 2NSDA 2VPWA 1SVUA 1W88A 2V9ZA 2XKKA 1JQDA 4F6CA 2YMPA 4TSKA 4TS1A 4OATA 3LT0A 3RVSA 2QD1A 3AHCA 3HYSA 3V4SA 4GDMA 2UZ0A 4ZVTA 3HYLA 5GV7A 1BRMA 1NYRA 2PKRA 4OXXA 5JXGA 4J0IA 1AGPA 2WD7B 3KZMA 5LDHA 1XDUA 1KI6B 2FHPA 2YHIB 2BFFA 1ZM3A 2G0AA 1D6MA 3FFAA 2WFLA 4ND8A 4FIDA 5GP1A 4HVAA 2ECKA 2O3RA 1HORA 4CQLA 3DA8A 3DO8A 1CUHA 4PXAA 4TRJA 1WBDA 2PQ6A 1GLGA 1EEHA 5KHOC 3NORA 1KJ8A 1VDZA 1RQXA 1O03A 3FNIA 4URVR 1QLHA 1S02A 1W4AA 4L3WA 4LG1A 4MB0A 5C5IA 3GFTA 2QPLA 3BXOA 5KYYA 3CCQB 2A5YB 4AJHA 4EHHA 3R9WA 3GPIA 3Q7EA 3GCWA 3QXJA 4KYIB 2XGGA 2KQUA 5EZ6B 1ZK4A 2FN8A 1ZOSA 4RMJA 4WXMA 3FYCA 4WUTA 5DBHX 4F4UA 5K3SA 1CY6A 1PKEA 2Z6BD 3I9FA 3TIXB 4GO1A 5LWHA 2HCRA 3CCLB 2ADMA 2BKVA 5G02A 1DC7A 3FIJA 2VK1A 1HXHA 3H5IA 4M0KA 2PL5A 4H7FA 1CUDA 1I6WA 5JD3A 3X2EA 4DIFA 1P5HA 2JRCA 1FP4A 3D8NA 2J3QA 1Y1TA 5KVAA 1O58A 1SPBS 3CP2A 1L5FA 4NYMR 4B7ZA 1ESDA 2D1RA 1KC1A 1ZVVA 1YZFA 4IUCS 4L2IB 1PR2A 5BRNA 3QUQA 2QW1A 4IIFA 3ZI7A 3CUUA 5CM2Z 1V1JA 2AOUA 3B85A 3NIBA 1F2TB 4N8EA 4KVZA 4F4CA 4C7OA 1NB0A 2Z6UA 3ZZ1A 3PVSA 3JQ6A 2FSVA 1RAIA 2XF8A 3KJFA 1KFEB 2AXNA 3L7OA 4HNAA 1VJGA 1E3WB 1UK6A 2FG7C 3U2QA 2GH1A 1C0LA 4OSEA 4QQ8A 3L5KA 2VA9A 5KAPA 3UT0A 1TECE 4QPZA 1UWLA 5A04A 4C88A 3GGSA 2O2XA 4I1UA 2JLQA 1FRQA 4M2LA 3KM0A 1TO6A 1Z6PA 1WOPA 1E9VA 3VAYA 3CX4A 1NR7A 1AKEA 1UQRA 4RKEA 4B3FX 5HCUA 4RQAA 3IEKA 4S0ZA 4S1WA 3K92A 2GB4A 4FD3A 4XRRA 4NZPA 4Q4HB 1NY5A 3ZWXA 3E82A 2HN9A 3WC4A 4L50A 3R9KA 4Y2SA 1G1MA 5K3EA 4GUAA 3LPAA 5L7TA 4EY3A 1KEEA 4PTZA 2HRZA 2IYXA 2D59A 2WNIA 3QEJA 1Q7TA 4CM8A 3QKTA 4RCVA 4HXEB 1NE7A 3AF5A 1XKXA 4JP1A 4X6UA 5DYTA 4BU0A 1AQIA 4GPD1 3CX8A 5U4QA 4LRWA 2P9BA 3RTGA 1BC5A 3AEUA 1SRRA 4YT2A 5JH7F 2HMSA 4XQEA 4BMCA 1RIIA 5E3HA 3R4CA 1Z4JA 1RJ9B 5IYPA 5FYDA 2YW2A 4MMXB 3EUFA 4RA6A 4OYHA 1ZZEA 1IXZA 4UM5A 1KI4A 4ZTBA 2OTJB 1BXGA 2ZJAA 5AKZA 4BXOB 4J29A 5JROA 1PTJC 3GAZA 4CF7A 5EI5A 2W6JD 1Y8QB 1H5NA 3EZ2A 2AW5A 4KIUA 4NCKA 2DJ5A 5AVXA 4LJRA 3RC1A 1G20E 2YZ2A 4O5OA 4XN0A 1N6IA 3AI3A 4YAFA 4KCGA 1LLFA 4OHBA 5E0OA 2VWQA 3D8TA 1GKKA 4JJ7A 4PZZA 2NO5A 5A0FA 5LLSA 4AY6A 3H94A 4UHBA 4JVMA 4OQNA 3IR6A 2AV6A 4DMLA 3HFSA 3WJAA 3GLGA 1R0RE 5LMCA 3MK31 2ZR8A 4AWAA 2VDRB 2P3MA 5C32A 3OZAA 5JVDF 1SQ6A 1V3QE 4DC1A 3BFXA 3CJQA 2VDOB 3ZU5A 4AFNA 3RFUA 3KPJA 2P1RA 2PR2A 2WE7A 2RG1A 1W6RA 2ZULA 3BE4A 4PO3X 5D6NA 3IVAA 1ADFA 3NYRA 3CF4G 1E2DA 2ATEA 2XMPA 3WLEA 1JTVA 3CLVA 3GARA 1EK6A 3H9UA 3HB5X 5C34B 3RY8A 3L8EA 3LS2A 3EZXA 3OT4A 4KNWA 3PCRB 3UWPA 4AYWA 1VQ6B 3LHDA 4BP9A 4XIGS 4BCCA 3MTBA 1VHLA 2C2KA 2ZE6A 1UKAA 3FHLA 2HK7A 2R2GA 3O95A 4ZPJA 1SUWA 4F2HA 5A6SA 1BROA 1GM5A 3RHZA 1PYGA 4MVJA 3S70A 3FHJA 2C1EA 4C4RA 2IT1A 4U6QA 4DM4A 3W77A 2HK9A 4UVEA 4N9QA 4JP3A 3T3DA 1PFUA 1DEHA 1YB6A 2HK8A 3SZMA 4E4TA 2W7TA 3SOZA 4DR3B 4LC9A 4LSMA 1G20B 3GNSA 1RVV1 1CRZA 1SU6A 3ZE0B 2YVKA 1YBHA 1B8NA 4NMWA 3VR3A 1V3TA 1RLJA 4HGZA 4PN3A 1T8RA 3SEZA 3Q3EA 1PNRA 1VECA 3FFTA 1OYWA 3EA5A 3EQ9A 4N0EA 4EEKA 1OFGA 3H9BA 5HZBA 2PEYA 5AW3A 1ILEA 5JDCA 3LP6A 5ECGC 1K75A 13PKA 4CUZA 2WJGA 1V8FA 3BJMA 4D2IA 4TKUB 1N1GA 2IJGX 4B4VA 4TVSA 4FHEA 4FZ3A 3INTA 3LKDA 2KX7A 4INAA 2AQKA 1Z13A 3ZWVA 4TMYA 4DVJA 4EI8A 3THXA 1UBFA 1RWOA 3QZUA 3TF5A 1YQGA 1XTBA 1U8EA 4N49A 4WCVA 3UUGA 1FLAA 2PUEA 2PZGA 4UD6A 1ZD3A 4EG8A 1NM5A 2X4IA 5K03A 1NU8A 1QFSA 4B6FA 4B9AA 2JNWA 3WLHA 3I6QA 2K7ZA 3M4ZA 4R01A 3H1BA 4PR3A 4EECA 1YI8A 4JC4A 2WWWA 3TNJA 1O96B 3KJQA 3PFGA 4Q9LA 2B1JA 4TRNA 4DM7A 4GRDA 1U9ZA 4LHSA 5HKAA 5HZHA 4UU7A 5A89A 3K8YA 3L6CA 3IOYA 1GTJ1 4RHTA 1YL6A 4RF4A 4ZC8A 1XPUA 2HB6A 3RVQA 5ALLA 4QNRA 1PU2A 5EC8A 3U62A 3UYLA 4QOHA 3SPXA 1Z5GA 1XLTA 4HZUA 1NUTA 1OXTA 4BMXA 3JXEA 1D03A 5JEEA 2C2OA 4OXIA 5JCOC 4A73A 2NV2B 4R0VA 3ZHBA 4HI0E 5K0TA 2ZQZA 2VOEA 1TJ4A 3IAHA 5FOTA 4GAEA 2GSDA 5TMDA 3ELBA 1JS1X 3TCXB 5B3JA 1CJTC 2C2HA 3U4CA 1KZYC 1LI4A 5ECDA 1EFKA 2MR5A 3CTPA 3IAEA 1N7HA 1FPQA 1M54A 1RWKA 2BUAA 2H18A 4L95C 1BKYA 4OU4A 5C2JB 3UJAA 3RFCA 5H68A 1KNXA 1JPVA 2IH5A 1P9OA 4NK5A 2CV0A 1U2RA 1FTSA 1XZBA 5A1TA 4DR4B 4PN7A 5IARA 1FC0A 2JZNA 4D57A 4D25A 3V32A 1GU7A 1KZHA 1IHPA 2YC4C 3BHIA 3HUTA 3OC6A 3V1YA 4AJEA 5KX5B 4ENRA 3SS8A 3NHJA 2DCUA 2VTEA 3H99A 3FPGA 1KWGA 3HY3A 2QM0A 1HYEA 2WJYA 2XCTB 2CVHA 1TQ8A 4ZODA 4MICA 1OI2A 2H0QA 3A2NA 5JZ9A 2EXXA 4MV3A 1V4BA 3T0IA 4OBBA 1O3YA 4QO8A 3V48A 3EEYA 3WJ7A 1SQFA 1KC8D 3JU4A 5AUOB 5FOWA 3W9UA 3RJTA 3W9SA 2O2EA 1THGA 4R9RA 2V1XA 1IULA 4G0ZA 5C7OO 3LK6A 1C50A 3UMMA 3BXXA 4XGQA 1IG3A 1EDEA 4L4RA 4ALNA 2CKDA 1JBQA 4ZVMA 5MF6A 3FZYA 5TS2A 3MINB 2O5CA 5JSKA 2LP4Y 1T6ZA 5EEGA 2E6KA 4FDUA 1DZIA 3MUEA 2BRUC 5E9AA 4KPEC 3HL4A 2WTAA 4LMRA 1I2AA 3ZTTA 2RKWA 1FIUA 4LX8A 1N8RD 3GLIB 3T9EA 4K3UA 3KETA 2WG1A 4FGLA 1QX4A 2ZBFA 4OQMA 5SYAA 3SHVA 4HAYA 3HO1A 2A1UA 5HRAA 4XQ0A 1DBVO 2D2IA 2DQYA 4FBGA 3UW3A 4ZV7A 3M1LA 1Z2AA 2C4HA 3MJFA 1XZHA 3ZTYA 3NOVA 1RJFA 3ADBA 5HCNA 2TMGA 2Z04A 3D7SA 5DMHA 1P1IA 2QYSA 1OROA 1CUVA 1ZEJA 5TE9A 3SIPA 4DDVA 1DADA 1WU8A 4Q4AB 2XH8A 3L92A 5EZQA 1KSJA 1ST2A 1TD9A 3RS4A 2JGDA 3HJAA 4R2IA 2J5QA 3VR5D 1IBLB 1R8XA 4J3NA 1NYLA 4GD3Q 3ONUA 2HLNA 4URHA 1B00A 1FTYA 4UAGA 5FWXA 4G8DA 1A50B 3FRJA 5K8CA 1C1HA 3FVQA 4KO8A 4O4JF 4NBLA 1TT5B 3AUJB 4R9NA 4FMBB 1EZZA 5FOXA 3UT5B 4Q1VA 4EL5A 1K28D 1QXSA 1EHYA 3DR5A 3MRVA 1TFRA 1VBKA 5IT0A 3WGIA 1SKMA 3C8UA 3H17A 4BZXA 3TUZC 3AHEA 5IYWA 3GSIA 1P2UA 2FMKA 3RRYA 3U16A 1QVGB 4IYRA 3FVRA 5AJUA 4C14A 2FETA 3NTRA 4LWPA 1KVQA 2M1XA 4O2AB 3R7DA 2OVFA 4BO4A 2IZ6A 2Y0DA 4J0KA 1CS0B 2W6IA 1V48A 3CZ4A 2C8LA 3H6GA 2ZTVA 3PLNA 4LY9A 2FN4A 4RESA 1URPA 4Q3DA 3AL0C 4TKOB 5IT9A 1AIPA 4R51A 4QVAA 3QA9A 1L5HA 3MCUA 4NPCA 1TGVA 3GFBA 4MRMA 4R2KA 3J81A 4TWAA 3FHOA 3P9RA 4OMCA 1II0A 3IV7A 2OBFA 3EWIA 5EZYB 2P5TB 5KNBD 4MGEA 3KZVA 2R4TA 2YZMA 3IXMA 1SC6A 4LVUA 2G83A 5CEFA 1N7JA 4XA8A 3OZFA 4V0SA 2YV3A 4YUVA 5TGDA 4W9MC 2O59A 4LV5B 2PBFA 4A4DA 4RPJA 3PVCA 1JIVA 3RHFA 3JASB 1KQOA 1BO6A 3GLHA 4ZQBA 2CT8A 1N2OA 4YCLA 5JAPA 4IXWA 3CH7A 2ZB2A 3H9EO 1H3EA 2XW6A 3WY9A 2PS0A 2RARA 2VIIA 1RBYA 2W4QA 4FDTA 1X1CA 4MW7A 5H7XA 4JOCA 3S8EA 4GNRA 1TJ5A 2JFXA 3I83A 3QPDA 1YRAA 1CJMA 2GCGA 4PONA 3WOVA 4YHHB 1CJBA 1RZRA 1TQHA 2ESRA 3A1DA 2Y0PA 2C9CA 1JQBA 3JWEA 4J94A 5EUCA 2CV2A 1JFSA 2C7PA 1LLUA 5IAAA 3A8JA 1ZZGA 2PGAA 3LUCA 3SZUA 3DBHA 3D6NB 1FDOA 3A0UA 3UXMA 4CG2A 4FOOA 4WFIA 1VA4A 1IZ7A 3QELA 3DWGA 4BZWA 4PPQA 5C8XA 1U2PA 3SXUB 2OHXA 4RM2A 3OPNA 3TTWA 3VJMA 1IRIA 1N0HA 3FKSD 2EFHB 5B2FA 4BLSA 4F5EA 4N82A 1VI5A 5LA6B 2PKQP 1J25A 1BMDA 1SQ0A 3QU2A 1T13A 3DAGA 1ADJA 1SBZA 2NUTB 5JS7A 4X66B 4OTZA 1PK7A 1T9BA 3NNDA 1LY1A 5A9SA 1N08A 5BN1A 5IBCA 1BS2A 1N6RA 3C3EA 5EMHA 1VYHA 4D9JA 1JSCA 3P2JA 3HK2A 2FW9A 2YQ5A 5L53A 1IUNA 1J9EA 4UW9A 5ALMA 3BY1A 3HBFA 1VJRA 4DNOA 1BG6A 3OMLA 4IWXA 5INTA 1J5XA 2GAFA 2P27A 3D6MA 1VYTA 3IBGA 1LW6E 3PFFA 3USES 2D9RA 5CFZA 2ZM6B 1GL7A 3KYDB 3MS7A 5DLQC 5LOVA 1O57A 2IPMA 1NULA 4WZAE 2IBTA 1G7SA 2QZPA 3EVCA 3TTUA 8MHTA 2PO7A