1SMFE

Studies on an artificial trypsin inhibitor peptide derived from the mung bean inhibitor
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Studies on an artificial trypsin inhibitor peptide derived from the mung bean trypsin inhibitor: chemical synthesis, refolding, and crystallographic analysis of its complex with trypsin.
pubmed rcsb
molecule keywords TRYPSIN
molecule tags Hydrolase/hydrolase inhibitor
source organism Bos taurus
total genus 46
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1992-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1smfE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1smfE02
1LVYA 1O2ZA 3TVJB 3SQHE 4DGJA 4X6PA 1P11E 1SPJA 1ZTLA 1MTUA 1BMNH 1UVTH 1YGCH 3LONA 3DA9B 3PYHA 4IC6A 1QR3E 1O5GH 5ETXA 4XDEA 2KAIA 1O2JA 2FEQH 1MU8B 4X0WU 1KYNA 1G37A 4ZHMU 3KN2A 1P0SH 1WBGB 2FOHA 3AASA 3K9XB 1IQNA 1NFYA 2A5KA 2F3CE 4Y8ZA 1HIAB 1XUJA 1QB1A 5LH8A 3AW1A 3KEEA 3SJKA 5BRRE 1A0JA 1YPKH 2VH0A 3MI4A 5C1UA 3GYLB 5DPAA 3D23A 2QY0B 2AS9A 3LJOA 1EZUC 1ZPCA 3PB1E 3SORA 1GL0E 1MBMA 4H6TA 1WAYB 4ABHA 2OUAA 1S6HA 2B0FA 2BD8A 1N6YA 1Y3WA 3A7XA 1IHSH 1O2OA 1Y5BT 4U01A 1SQOA 1IAUA 3BV9B 1BMAA 1ZOMA 2ZCHP 2WPMS 1QTFA 1ZTKA 2AYWA 5PTPA 3SHAH 3G01A 2GZ8A 2BD4A 2XC4A 1LQDB 1QBNA 1BT7A 1S82A 4ZHLU 5DP9A 1C4Y2 1Q2WA 1JXPA 3UWJH 2BD3A 3PMBB 1J9CH 1SLXB 1KSNA 1GI1A 1SFIA 2BLWA 3ZYEA 5EXNA 3UQOA 3SO3A 3RLYH 4O03A 4UFFH 1MKXK 1KDQA 1C5MD 3FP6E 1BTXA 4ABBA 5E0GA 1VCQA 1ZMNA 1E35B 7GCHG 2ZQ2A 1XUHA 1O34A 5GCHG 2XBVA 1GI0A 1O5EH 3S7HB 1AB9B 5E8EH 5TCAA 1HAYB 4F49A 1O2SA 3UIRA 2UWLA 4BAOB 3HKJB 1TRNA 2ZPQA 1EAXA 1C2DA 1O2YA 3E91A 1E34B 3GDSA 1TGNA 4CHAB 1AE5A 2IJOB 1TNIA 4A1VA 4YTAA 4ABGA 3ATLA 5SGAE 5AHGH 2QXGA 1YPEH 3QGNB 3GOVB 1IHTH 2C8YB 2JETC 5C20A 2SGEE 1GL1A 1VCWA 1ZTJA 1O3GA 3GY6A 2ZPSA 4NWKA 1EAUA 3EGKH 3MH4A 3A85A 2HPPH 3Q77A 3LGIA 2BX4A 4ZKOU 1W7GH 3RXLA 1CT4E 1LHFH 1V6DA 1UCYH 4DOQA 1WQVH 1FY3A 1H9IE 2OTVA 1W7XH 3P92A 3LH1A 3M37A 1O5CB 1P06A 4WF8A 1GJ9B 2ZDMA 4Y8XA 2BDGA 1FZZA 2TGTA 2C8ZB 1YPGH 2OQ5A 1QJ6B 2CF8H 1NROH 5T6FA 1Y8TA 5FBEA 1DLKB 1PQ7A 1BITA 1ZRBA 1GJ6A 1MD8A 3SJIA 3RXVA 3EAJA 4XSKU 1UMAH 5GJ4B 3RMLH 2FTMA 1DOJA 1ZYOA 4YLUA 1MKWH 2VIOA 3Q00A 1XKAC 2PHBA 1JIRA 2C3SA 1Y3YA 4OS5A 1F5KU 1NFUA 2ODPA 2HGTH 4KELA 4Q7XA 1H9HE 2ZFTA 5A09A 1GCDA 1V2NT 5L6NH 1NM6A 3VGCB 1W2KH 1INCA 4UFGH 1DICA 1ARCA 2ALPA 4IMQA 4VGCC 3UR6A 1DX5M 4DCDA 2UUJB 4Q7YA 2LNCA 1GI6A 3MO6A 1L1NA 1GPZA 3FP8E 1TPAE 4MLFB 2QIQA 2WPKS 3ZVBA 1NRNH 4AB9A 4DIHH 1AFEH 2YNAA 4I32A 1Z1JA 2AMQA 2ZDLA 1UJ1A 1P05A 8ESTE 4LXBH 3ZZ6A 3AVZA 1V2VT 3P8FA 1NC6A 4YO9A 5TCCA 1GI3A 1WUNH 1S85A 2VVVA 1P12E 2IPHA 2ZA5A 1XUFA 1TGBA 3KIDU 1SGTA 2CJIA 1EB2A 3QZRA 5F8TA 1MBQA 1O36A 3MO9A 1ANBA 2H1UA 1GVZA 3GY4A 4NSYA 1RTFB 3KGPA 1TB6H 2BY7X 4WMDA 2Y5HA 1BCUH 1GBDA 3LGWA 1UHBB 2OXSA 1F7ZA 2TGPZ 3BEFB 5T3HA 1YLCA 4UONA 5TJXA 1V2OT 7GCHF 1GMDG 1O37A 3PO1C 1C5TA 5I46H 3RDZA 2FOEA 5GCHF 4XBDA 3U98H 2V0BA 2FP7B 4H4FA 4B75A 2G55A 5DP5A 1OP8A 4FUJA 3ZVGA 3EYDA 1TLDA 4WH6A 2ZFFH 2ZFPH 1ZJKA 2FI4E 2ANMH 2BOHB 2GDDA 2GD4B 1S5SA 2FOGA 3W95A 4GCHF 2J95A 1T4VH 1BRBE 2ZDNA 3VB7A 5GWZA 2FIRH 4GHQA 4MNYA 4I8GA 2A0QB 2P16A 1EOLA 4MPVA 1O2HA 1TPSA 4Y79A 1PPCE 5IYTA 3PM3A 3FAOA 1TGCA 2VJ1A 1CU1A 5EXLA 2O8TA 1GJBB 1KXEA 4IGDA 2G8TA 1ELBA 3HPTB 3L3TA 1A2CH 1D3TB 1V2UT 1BJVA 4B2CA 4KGAA 1DFPA 5FX5A 4TWYA 4B2BA 1QNJA 1A5IA 3SI4H 5C1XA 1E36B 3DFJA 2GMTB 2JKHA 2GCTC 3O8CA 1YC0A 2ZU3A 3MU5A 3S7KB 8LPRA 3RXDA 5JB9S 4UEHH 1PQ5A 2BDHA 1C2KA 1GG6B 1CQQA 1O3IA 1AVWA 3ZZ4A 2CF9H 2AIPA 4X8UH 2XC0A 2F9NA 3M5LA 4O97A 2VIQA 1O5BB 4JK6A 1G30B 1SGRE 3STJA 2Z6BD 1A61H 2Y80A 4FXGH 1HAPH 2CHAB 2BQWB 4X1NU 4CRFA 1QL7A 1ZGIA 1J14A 2AIQA 4ZKRU 3SV6A 3KHVA 1NTPA 3A8DA 4OS6A 1WSSH 2UUYA 1OWEA 1FPHH 3QX5H 2VWOA 4U2WA 2DE9A 3S9CA 2GKVE 1V2JT 3VB4A 3HGPA 1UVPA 2P3UB 2OC1A 3R3GB 1LKBA 3BEUA 3TGJE 1L4DA 2PTNA 1EPTA 1ESBA 2A31A 2ZNKH 2ZU4A 4HTCH 5DG6A 2VU8E 4A92A 1SGIB 8KME2 2G5NA 5C2ZA 2ZI2H 3BG4B 1V3XA 4AFUA 1O2UA 1GHYH 2C8XB 2WYJA 2QCYA 2Z9IA 1CGJE 3MU1A 2A5IA 4WVPE 4IBLH 1TOMH 1TPOA 1FNIA 1G2MA 2V35A 2QN5T 1P02A 1S6FA 1MU6B 3PROA 1C1MA 3LGVA 1SQAA 4OGYA 4LZ1H 1CT2E 2KAIB 1HJAC 2ZEBA 3A7YA 2ZFQH 1IQHA 4TWWA 3TJUA 2PUQH 1GMDF 4YT6H 3M5MA 3F9EA 2XWBI 4Y8YA 3GCTG 3Q3YA 1FMGA 3N7OA 2FTLE 2P3FH 1SLVB 3RXHA 1ESTA 1V2LT 2ALVA 1XKBC 4RSPA 2Z9KA 1B7XB 1BRAA 5DGJA 2ZCKP 3GYMA 1Z71A 1RRKA 3W94A 1FAXA 4ZKSU 1TMTH 4BAQB 4WWYA 4WMEA 3SQEE 2DUCA 1IQMA 1O38A 5JBAS 2QXIA 4WXIA 1MZAA 4TY7A 1L1GA 3LT3A 4MPXA 3VB5A 1DY9A 1QQ4A 1QIXB 3RXUA 1DS2E 1LPGB 2C4FH 4UDWH 4DJZB 3MH5A 1CGHA 1C1PA 2JH0D 2BMGB 5FX6A 1LMWB 2VNTA 1FY1A 3V13A 6CHAC 1G9IE 3RXFA 1O3LA 3ITIA 4RKOB 4BXWA 1K1JA 1O3KA 1LHEH 1A5HA 1KDQB 2D8WA 2HRVA 5C5NA 2M5TA 4NIWA 1SGDE 1E0FD 1Z8JB 3A7WA 5L30H 1S81A 2W7SA 2HVXA 1IQLA 4K60A 2R3UA 1JRTA 3UQVA 1OX1A 3JZ2B 1Z8RA 3LU9B 5AFZH 4FUIA 2P95A 1C5ZB 2ZGXH 1JRSA 4OS2A 5B6OA 4X2YA 4BTTB 1MTVA 2BHGA 1DWCH 1S0QA 2UUFB 3UTUH 2PGBB 1GHBF 1O2KA 1TYNA 3BTME 3QN7A 2GTBA 3A7TA 4D76A 4MDSA 2W5EA 4X6OA 3A7ZA 1JMOH 1GBFA 3B23B 1DT2A 1NRSH 1TNLA 1DWBH 1SHYA 1EJMA 5LPRA 2QXHA 5JPMH 3SNCA 1GJCB 2AGGX 4DG4A 4ZHAA 1B5GH 4GAWA 1F5LA 1HNEE 4FUGA 1RJXB 2A2XH 3M61U 2G4UA 1CBWC 2BB4A 1NN6A 5FBIA 3RXIA 1PPZA 4K69A 3UWIA 1CHGA 3FZZA 1C5QA 4KP0A 1YPLH 5L2YH 1THSH 2QYIA 3RXQA 4CBNA 5A8ZA 4JZ1A 1UK4A 2TIOA 3ZVAA 4I8LA 3EA8A 1AD8H 1P2MA 3E16B 3RXJA 1AFQB 1W0YH 4WJG2 1RXPA 1EJAA 2QGRA 3OSYA 3ATIA 3SU5A 1S83A 4E06H 1TWXB 2FOAA 3SU6A 1MKXH 1AVGH 2YNBA 5G4BA 5JBCS 1UTNA 1Z6EA 1V2RT 2F83A 1GHWH 1MTNB 2ZIQH 4J1YA 1Z8IB 4X6NA 2G4TA 2RG3A 4AFSA 3E0NB 1O5AB 1OYQA 1E37B 1P03A 2A45B 3FFGA 4BNRA 3MMGA 2WUCA 3P8GA 2VGCB 5EW1H 3KCGH 1O3NA 1CT0E 4ISIH 4JZEH 1A1RA 4NWLA 5GIBA 1AVXA 3OY6U 3LDXH 2SGAA 1G2LA 2TPIZ 1O2MA 1P3EA 1QQUA 1QURH 1T31A 1YCPK 5A8YA 3RU4E 1GHAG 4CH2B 2ESTE 1BQYA 1ACBE 1PQAA 2HLCA 4X1QU 4BTIB 1FQ3A 3E6PH 3IITA 2ULLA 1PYTD 4DURA 1P2JA 1DUAA 3GY8A 3VEQB 1C2EA 3VXEH 1YKTA 1ZZZA 3C1KA 1KLTA 3S9AA 2GZ7A 1BHXF 2FLBH 3SN8A 2FLRH 1B0FA 2PW8H 3FZDA 1U6QA 1YYY1 3E8LA 1MQ5A 1ELAA 2ZTYA 1SLUB 3K2UA 1EP5A 1EXFA 2BYAX 2A4OA 2YOLA 3T28A 1WYKA 3HK6B 1XMNB 4DT7B 2Y7ZA 3RMOH 3RXTA 1P2QA 4CRAA 2Y5FA 1N8OB 1O2VA 2GT8A 3LJJA 3ZZ7A 2Q6GA 4JZIA 2GGVB 7KMEH 1K1NA 1BHXB 4MPWA 1GCTB 1WQSA 1QA7A 2R3YA 4GUXA 3AW0A 2Z9LA 5LGOA 2FXRA 4XOJA 1K1OA 3BTHE 2BD2A 2BXUH 2NU2E 2EI8A 3S0NA 4UFEH 4YT7H 3QWCH 2BDIA 2G51A 1GBAA 2A4QA 1C4U2 4HGCA 2AERH 3NXPA 2OCVB 3ATKA 4K1EA 1Y5UT 1O3AA 5A8XA 5EGMA 4ABJA 1YPMH 4RKJB 1SGQE 2WUBA 3NK8A 1MTSA 3AAUA 1MUEB 1ETRH 2ZHQH 3PMHB 2WINI 5DP6A 1FN8A 1GGDC 2OQUA 1NESE 1DY8A 3I78A 1C9TA 1UK2A 2AH4X 1GBEA 3E1XB 5EQSA 1O39A 2C90B 1XVMA 1DITH 3BEIB 1QCPA 4HZHA 1KXDA 5EPYA 2FX6A 3D65E 3T29A 2OD3B 2C8WB 1HCGA 1VJAU 2XBXA 1BOQA 1O0DH 1TIOA 1OWJA 1BB0B 2ZHWH 1TX8A 3H5CB 1CA0C 4GCHG 1GJDB 1C2LA 3GCHB 4ESTE 3QUMP 5EPNA 3M35A 1PFXC 2VWMA 2J34A 1K21H 1GBBA 5E2OA 2GVFA 2ZGBH 4XBCA 1EATA 2ZTZA 1BA8B 3SV9A 1TNGA 1O3FA 4NA8A 1C1NA 1T8OA 3HKIB 1XXFA 1GVLA 4ASHA 5ABWA 1ZSKA 1MCTA 2VIVA 1HPGA 3TIUA 3ZZCA 3U8TH 1Y3UA 1SI5H 1TMUH 4AGJA 3MH6A 4K8YA 1GHAF 1O5DH 1EPTB 1ABJH 3OYPA 2BD7A 3A8BA 2F9OA 1V2QT 3BTKE 2SNVA 3M3TA 2TGAA 3D49H 2P8OC 3F9FA 2A1DB 2Y81A 3KNXA 1P01A 1O2RA 1K1MA 1C1UH 3ZZBA 3M36A 4GVUA 1ZPZA 1P09A 3O8BA 4NZQA 1UTLM 1UVOA 1GG6C 1J8AA 1C5OH 1LKAA 1AY6H 5HMAA 3UNRA 2G5VA 4UD9H 1QJ1B 4NGAH 4K2YA 5LPFA 1ZSJA 1O5FH 1V2MT 3ZVEA 1SR5C 3HGNA 4AFZA 5AF9H 1TNKA 1ZJDA 4OS7A 5F8XA 3ZVCA 1WOFA 1YPHC 1D6RA 4ABFA 3SNEA 1TBQH 1TPPA 2ZO3H 5ESBA 7ESTE 2ZU2A 1AN1E 1GJ7B 1DVAH 4TY6A 4WXVA 4WY3A 1NO9H 4INLA 3NPSA 1O32A 4Y7BA 1C5YB 3F9GA 1GJ5H 1NT1A 1TOCB 2GCHF 2XCFA 1OP2A 2FOBA 5EODA 1C2IA 1GI5A 1O30A 1C1OA 3MH7A 1HJ8A 3RXMA 3MNXA 3UOUA 1O2GH 3A82A 5HM9A 3UR9A 1O35A 1EUFA 2UUKB 2AGIX 1ANDA 3I77A 4I33A 3UNSA 2BQ7B 4K1TA 4YOIA 1DWDH 3KF2A 2Z3DA 1NRPH 2RCEA 2SFAA 2ZGJA 1BTYA 1SC8U 3RXRA 1X7AC 2XRCA 2W26A 1TONA 1S84A 2VH6A 3VPKA 3ZZ8A 4CR5A 4A6LA 1FV9A 3RXAA 1RS0A 2BVSH 2B8OH 1EAWA 2HNTF 1W14U 2R0KA 2A4GA 1TBRH 1ELEE 3SV8A 4LZ4B 1IQFA 2HPQH 2PSXA 2J92A 2J9NA 1IQEA 2FOMB 2PUXB 3ZV8A 1TA6A 3P8OA 1SG8B 1GMHF 1ORFA 2BLVA 5C1YA 1CVWH 3BTDE 2F9VA 4I8HA 1G3EA 1O2TA 1ABIH 1WCZA 1EQ9A 3S9BA 1GBMA 1LQEA 4YOGA 2NWNA 4JMYA 1H8IH 3RXEA 2CXVA 1CA8B 4Y6DA 3GY5A 1XUIA 5JYIA 2GT7A 2THFB 2JETB 1TBZH 5FCRA 1BUIA 4JYTA 1HV7A 3SNBA 5HXFA 2XYAA 1YLDA 1SBWA 2GP9B 1SGNE 4LOYH 2R2WU 4AYYB 3TK6A 2FMJA 1SB1H 4AB8A 3BTWE 1JBUH 4D7GA 1C5LH 1FY8E 2GV7A 1FY5A 2BX3A 3TITA 1XXDA 2NU1E 2F9UA 1DE7H 2ZHEH 3KQCA 2P94A 3T2NA 2ZDKA 4KKDA 4Z6AH 1V2KT 1J17T 3RC6A 1KXCA 4B71A 3PLKA 1KXBA 2PKSC 2FO9A 4HFPB 1C9PA 2VIPA 2O8WA 1GHBG 1C2GA 1NPMA 3ZZAA 2O8LA 1K22H 4X2VA 3TJOA 5E2PA 3U1IB 1Q31A 1T32A 4R8TB 3ZV9A 2VINA 3SNDA 3C27B 4NIXA 5A0AE 3K6ZA 4X1PU 2Z3CA 1RIWC 3U69H 3KQBA 2RA3A 1VGCC 2HOBA 1EZXC 1N1LA 1HAVB 1JOUB 4F4OC 5IDKA 4KTCA 2DE8A 3ENSB 3LGUA 1AE8H 1VJ9U 4VGCB 3PV4A 4B1TA 8GCHF 2ZPRA 1H9LB 3BG8A 4GLYA 3SGAE 3V0XA 2FPZA 2ZGCA 1N6XA 1P8VC 1JIMA 9ESTA 1EJNA 3BTGE 1ARBA 1BBRH 3RMMH 1J15A 1K1IA 3LC3A 1P3CA 4CRGA 1LPKB 1MAYA 1SOZA 2FYRA 1PPHE 5CE1A 2AGEX 2BDCA 1AFQC 3DFLA 1FAKH 2SGFE 2BY5X 3OX7U 2BZ6H 1BDAA 1MAXA 5ESTE 3UY9A 2NU3E 1C1TA 3H7TA 2BXTH 1GHVH 3M5NA 1T8MA 1F0UA 1MTNC 3M7QA 1DSUA 1Z1IA 2LPRA 3PO1B 1KLIH 4K5ZA 3LGYA 3SOSA 1FI8A 2F91A 4WMFA 1EAIA 2D1JA 2FZZA 1OOKB 1LHCH 2XC5A 2Y6TA 1ELDE 1V2TT 3SUGA 2WPJS 4X1SU 1V2ST 3GDUA 1T8NA 3NWUA 4AORA 5EQRA 4X8SH 3KQEA 5K0HA 3PMAB 1BTUA 1SHHB 2XW9A 3GISB 1CSOE 4JK5A 4RN6A 1K9OE 4ISHH 1Y3VA 1HXEH 3EE0B 2ZDVH 2H2ZA 1C5NH 3F6UH 1SVPA 1OWKA 1L4ZA 5GDSH 1AWHB 3UFAA 1ANCA 2W3IA 3ZVDA 5LPEA 1UTJA 2PV9B 3K6YA 3UREA 1IOEA 1OWIA 4OGXA 1GHZA 1O31A 3UPEA 4FVDA 1J16A 1NFWA 5DP8A 1D3QB 3IG6B 1GI4A 2STBE 6GCHF 2XTTB 1HBTH 2A4RA 1PPEE 1P04A 1H8DH 1A0HB 1SGFG 4M7GA 4ABAA 1DM4B 1UHBA 2RA0A 2H5DA 2AEIH 1ZMLA 2ZF0H 2BQ6B 1EZSC 1FXYA 1NU7B 1HDTH 1UCYE 4JZDH 2Y7XA 3SJOA 1W0ZU 6LPRA 4FU7A 1GCTC 4CREA 1KTTB 3RUOA 1OP0A 3V7TA 4A1XA 1GDUA 1QB6A 1DXWA 1HAXB 4ISNA 1W11U 1BTHH 1FIZA 1Y5AT 3MU8A 3RXBA 1YPHE 4MNWA 1GJ4H 4K8BA 4NA7A 3VB3A 4B73A 3A83A 4CR9A 2Z7FE 5CHAB 1L2EA 3BIUH 1OSSA 3U8OH 3UOPA 1UTOA 2WV5A 5AVDA 3T27A 2ANYA 3AAVA 1PPBH 1A4WH 1W8BH 2FDAA 2ASUB 2Z9JA 1F2SE 1GVKB 1QB9A 5EXMA 5EQQA 1HAIH 3M5OA 5DJ7A 1Y3XA 2BY6X 1XUGA 4A5TS 3SNAA 1F0RA 3QTVH 1UTPA 1D3DB 3DUXH 1YM0A 3FVFB 4AGKA 2ZZUH 4H42U 1FN6A 2I6QA 3TNTA 4CBOA 1D3PB 5FPYA 1EOJA 1TGTA 2O8UA 4JYUH 3BTEE 1AB9C 2R9PA 3SBKA 4FUEA 2F9BH 3RC5A 1P2KA 4CH8B 1TX6A 2ANWA 2CV3A 1C5VA 1P9SA 3DT0H 2BDAA 4CHAC 2BZAA 1HJAB 1TAWA 1LCYA 1P2IA 1VITH 2Q1JA 1GBIA 2OC0A 2B7DH 3NUMA 4JYVH 3D62A 1ETSH 4FUDA 5J4SA 3WY8A 3GY3A 3Q3KA 1MTWA 3KQDA 1EKBB 4K3JA 2FS9A 2Z94A 3A81A 3E0PB 4Y71A 3VXFH 2RDLA 3OTJE 5CMXH 2OBOA 1FUJA 2H9HA 1S0RA 1Z8GA 1HXFH 2IOTA 1QA0A 2AMDA 3FANA 2H9EH 1OWHA 1QGFA 1AKSA 3A89A 1QBOA 2CGAA 4BANB 2V6NA 4NG9H 1AMHA 1C5PA 1GJ8B 4E05H 1TGSZ 3CS0A 3O8DA 1K1PA 1SFQB 2ZECA 4ISLA 3A80A 4ZXYH 4NFFA 2WPHS 4OS4A 5GPIB 2ZTXA 1D4PB 1O2QA 3GCNA 3MTYA 1O33A 1GBHA 2WPIS 4Q80A 3Q76A 1QBVH 1K28D 4E7NA 3EA9A 5EU8A 2D2DA 2XWAA 4GPGA 6CHAB 4INKA 1BMMH 4JCNA 1LHDH 3P8NA 1G32B 1TNHA 1OPHB 1MCVA 3BSQA 2J4IA 1DWEH 5BPEA 3T62A 1HAGE 1QFKH 1TFXA 1Z7KA 1XX9A 4ABEA 3SU4A 3TU7H 3VGCC 4O9VA 4Y11E 3SUFA 3MNBA 1XUKA 1GJAB 1HFDA 2BDBA 1ETTH 1LHGH 1RD3B 4DW2U 1O3JA 1W12U 3B8JA 2BY8X 2PFEA 2GCHG 1MQ6A 2A32A 3RC4A 4SGAE 1C4V2 5EG4A 5JBBS 1O3EA 1RTKA 1EB1H 1SGCA 2FOFA 1HRTH 1FJSA 1DPOA 2B5TB 1C1SA 3M7TA 1BTWA 3MNCA 1W10U 3RXKA 1C1QA 3PMJA 3SJ8A 1ZRKA 1UTQA 1SMFE 1UTKA 2P93A 2SNWA 1P9UA 2FWWA 1PYTC 5I25A 4TPIZ 1GBCA 1K2I1 1P57B 3MOCA 2PGQB 2CMYA 1GMCG 1AIXH 4Y7AA 3QLPH 1CBWB 3MO3A 1ZLRA 2STAE 4Y0ZE 1IQGA 1O3PB 1NRQH 4O3TA 3GDVA 1D9IA 1O3DA 3ZZ5A 4Y0YE 5HGGA 3K65B 5A0BA 4ABIA 2G52A 1A0LA 1SGEE 3E3TA 4TYDA 3GY7A 3T26A 4X8TH 4DVAU 1VITF 1GMHG 4LK4A 1F0TA 1ESAA 3SU0A 3TH4H 2OP9A 4BXSA 1NZQH 2Y5GA 4GHTA 3ODDA 4TPYA 1QL9A 1O2IA 1CHOF 1AWFH 2TGDA 4IMZA 4D7FA 4KTSA 1Q3XA 3M3SA 3SV2H 3SU2A 1F5RA 2F9PA 2HNTC 1QRXA 4Y10E 3BTQE 3TH3H 1TALA 3TGIE 2NU4E 2AFQB 4X6MA 2XBYA 3OU0A 3ZYDA 4ZMAH 4AYVB 1THRH 1T8LA 5K7RA 2QXJA 1BBRE 2GDEH 2BOKA 2VVCA 1F0SA 2ZHFH 3A88A 1TX7A 1C5XB 1A3BH 3ZZ9A 1ELFA 2ZU1A 1GDQA 2PLXA 5JDUB 4YZUA 4QT8C 2GMTC 3GICB 1KIGH 1GI8B 4AFQA 3BTTE 2PKAA 3SUDA 2OC8A 4B76A 2ILNA 3RXGA 1AU8A 1XVOA 3SUEA 2BVRH 2ZC9H 2ODQA 1KXFA 1BJUA 2FI5E 1KLJH 1WV7H 2EI7A 1ANEA 1PQ8A 4XE4A 1VR1H 4JZFH 2VIDA 2FM2A 1CE5A 2BDYA 2G81E 4FUHA 3HK3B 4IS5A 3S69A 2CHAC 1LO6A 3QGJA 3SW2B 1EX3A 1O3MA 4CRDA 4CRBA 1MMJN 2OBQA 1OS8A 4AG1A 5E0JA 2H6MA 3VB6A 2A7JA 2PSYA 1KTSB 3BN9A 2O9QA 2ZU5A 8GCHG 4IN2A 4D9QA 5F6MA 2ZQ1A 3DHKH 3RU4D 1SQTA 2B9LA 2ANKH 3P95A 3QZQA 3TLOA 2K1QA 3R0FA 4AN7A 1P10A 3DD2H 2QV1A 5A2MH 3A87A 3BG4C 3RLWH 5DK1A 3PLPA 2OLGA 1A5GH 1YPJH 2XXLA 1AUTC 1GMCF 1O2WA 2XCNA 5F03A 1GBJA 4K1SA 4MNXA 3TJNA 4D9RA 4E7RG 3A84A 1DXPA 1SL3A 1FIWA 1P2NA 3EQ0H 1QL8A 4MPUA 3QO6A 2BTCE 3UUZA 1C5UA 1GI9B 4BTUB 1H1BA 5T6GA 1IQJA 4H6SB 4NA9H 3SGQE 2AMPA 3URDA 1FY4A 3MU0A 1G3CA 1GGDB 1VZQH 1DDJA 2G00A 3EDXB 1HIAA 2O8MA 4IC5A 1C1WH 1BZXE 1AGJA 1O2LA 1A7SA 2ZWLH 1WTGH 2IN2A 3B9FH 2HWLB 1W3CA 1ZHPA 2BY9X 4ZROA 3L6PA 3CENA 2PR3A 3JZ1B 2V3OH 1D6WA 1BMLA 3FP7E 1NY22 2GV6A 3CS7A 2H9TH 1CA0B 1ELGA 1P2OA 1QRZA 1HLTH 1EP6A 1LVOA 1ZR0A 1WU1A 1UCYK 2Q6DA 1OWDA 2A7CA 4FU8A 4BAKB 3ELAH 3SJ9A 1KXAA 2XNIA 2Z3EA 4WH8A 1FDPA 2ODYB 1O2XA 3VFEA 4CRCA 2C93B 1UK3A 3F68H 3BIVH 1SGFA 2R0LA 3PLBA 6GCHG 1TABE 1DANH 3P17H 1O2PA 4I7YH 4PROA 2V3HH 2ZGHA 2GZ9A 1AZZA 2TBSA 2UWPA 3QTOH 2VWLA 4X2XA 1EZQA 5E0HA 1GI2A 1MKWK 5FXLA 4ZKNU 3TH2H 1G3DA 2JH5D 2W7UA 3SZNA 1PPFE 2P8OB 1IQIA 1SLWB 1BRCE 1TMBH 5DP4A 4DIIH 2TRMA 1V2PT 3SU3A 1THPB 1LVBA 4AOQA 1C1VH 3ZVFA 3CP7A 1Z6JH 1GBTA 2ZG0H 1SGPE 1NU9A 2WYGA 2A7HA 3LGTA 2QF3A 5FCKA 5C5OA 4MNVA 3TK9A 6ESTA 2FESH 4ABDA 4ZXXH 1CGIE 1RGQA 2QF0A 1OYTH 4AZ2B 1DLEA 4YESB 3RP2A 1PPGE 1QHRB 4YM9A 1RTLA 1FONA 2A2QH 5CHAC 3LPRA 1AKSB 3T25A 2SGDE 1ZPBA 1GHXH 3TPIZ 3M3VA 1C1RA 5T6DA 2HALA 3QDZB 4NCYA 2SGQE 2CN0H 4FVBA 2BD5A 1UTMA 2Y82A 1GI7B 3ATWA 3NZIA 5C67A 4X8VH 2J94A 2ZDAH 3MFJA 2ZP0H 4BAHB 2P59A 5A0CA 4YLQH 4AG2A 1AHTH 2FX4A 1PJPA 2ZCLP 2BLOA 1C2FA 1T4UH 3SV7A 3V12A 1HUTH 2FS8A 4GSOA 3QK1A 1MZDA 1DSTA 1B0EA 2D26C 2VIWA 5DP3A 1C2MA 1FPCH 1LVMA 2UWOA 1EASA 3L33A 5JB8S 3H7OA 3PWCA 2GX4A 4A1TA 1OKXA 2OINA 2WV4A 3I29A 3P6ZB 2VGCC 5FPTA 2R2MB 1SOTA 1UVUH 4OS1A 5DO4H 2ZFRH 5EOKA 4D8NA 1C5SA 4BAMB 1ELTA 1F92A 3RXSA 3F1SB 1AZ8A 1GWAA 2VWNA 2WPLS 3A8AA 4I8JA 5FAHA 5J4QA 3LH3A 4NFEA 9LPRA 1BTZA 2FI3E 4B74A 4X1RU 3URCA 1QJ7B 4A7IB 1ID5H 4MTBA 5EW2H 1HAHH 1HGTH 1CO7E 1O3CA 4IW4E 5GXPA 3RU4T 5C3NA 4MVNA 1TA2A 1GDNA 1W13U 2EI6A 2A5AA 3GY2A 4UFDH 3U9AH 2HNTE 1GBLA 2ZFSA 3P70B 1TRYA 3RXPA 3M7UA 3ODFA 1XM1A 1AI8H 1YCPH 2BLQA 3TNSA 4Q2KA 3T5FH 1JWTA 1YP9A 1Y59T 1TRMA 3BTFE 4IN1A 2W3KA 1C2JA 3MWIU 1K1LA 2OC7A 4NIYA 1C5RA 1TE0A 3PWBA 2GCTB 1UVSH 1M9UA 4B2AA 3LC5A 4INHA 1HAZB 4NIVA 1N8OC 2BM2A 1OXGA 3STIA 2QC2A 3MU4A 3MNSA 1O2NA 3EA7A 5H4IB 1FLEE 3TGKE 3IWMA 4NSVA 1YF4A 1TQ0B 1SSXA 1BTPA 3ZZDA 1A46H 2ZKSA 4KTUA 2BD9A 3O8RA 1HAOH 3TJVA 3LOXA 3SGBE 7LPRA 1DUEA 2PKSB 4FUCA 1QY6A 5HM2A 3ESTA 4SGBE 1E38B 4Y76A 3TK5A 5FHTA 3RXCA 3NKKA 1A3EH 3RXOA 3A8CA 1NFXA 2ZHDA 3E90B 4HI3A 1UO6A 4AX9H 3U8RH 1SGYE 1ELVA 4XFQA 1WTHD 3PTNA 5AFYH 2Q6FA 1ZHMA 1T7CA 3RM0H 1RIWB 4J2YB 1G3BA 2QAAA 1MH0A 1AO5A 2Z9GA 5L2ZH 1BRUP 1O3HA 4Z0KA 1VGCB 1LPZB 1ZMJA 4U30A 1HYLA 1L1JA 4ZH8A 2FOCA 2P3TB 1O3BA 4R0IA 2FYQA 4U32A 5DP7A 2J2UA 1G36A 5DKMA 1BBRK 3GCOA 1HJ9A 3OY5U 4FUFA 1IQKA 3SU1A 1VCPA 3V3MA 1ZSLA 2EEKA 4I31A 3RM2H 3U1JB 2PKAB 3Q3XA 3MHWU 5HYOA 2VVUA 3LIWA 2QA9E 4MQAA 4I8KA 4X2WA 1ZGVA 2H5CA 1VITG 3BF6H 1LDTT 4FU9A 2FODA 1RFNA 4BOHA 1QRWA 3SHCH 3KL6A 4ISOA 4UE7H 4NZLA 2EC9H 1TQ7B 4DY7B 3PTBA 1CHOG 2I6SA 2J38A 1HB0B 4Q7ZA 3GCHC 4YOJA 1YBWA 1C2HA 2XBWA 3UNQA 2PWXA 3A86A 1GBKA 1L0ZA 1LTOA 5JBTA 2BVXH 1C5WB 2NU0E 2PTCE 4MG3A 4FUBA 3GCTF 2EA3A 3F9HA 4XBBA 5F8ZA 3MYWA 3ATMA 1NRRH 2VB0A 3SI3H 3LKWA 1O3OA 1TNJA 1YCPM 1MD7A 1NS3A 3A7VA 3ZZ3A 1AUJA 1V2WT 2SGPE 3NCLA 1HAVA 4THNH 4ZAEA 2JH6D 1EPTC 3HATH 1AQ7A 1ELCA 1ZHRA 4O3UA 1BIOA 1H4WA 4ZUHA 3RMNH 1KY9A 5FPSA
chains in the Genus database with same CATH superfamily
1LVYA 1O2ZA 5C94A 3TVJB 3SQHE 4DGJA 3OFND 4X6PA 1P11E 1SPJA 1ZTLA 1MTUA 1BMNH 1UVTH 1YGCH 2JJ1D 3LONA 3DA9B 3PYHA 4IC6A 1QR3E 1O5GH 5ETXA 2J98B 3UB0A 4XDEA 2KAIA 5CDFE 1O2JA 2FEQH 1MU8B 4X0WU 1KYNA 1G37A 4ZHMU 3KN2A 1P0SH 1WBGB 1W0KD 2FOHA 3AASA 3K9XB 1IQNA 1NFYA 2A5KA 2F3CE 4Y8ZA 1HIAB 1XUJA 1QB1A 5LH8A 3AW1A 3KEEA 3SJKA 2QF5A 5BRRE 1A0JA 1YPKH 2VH0A 3MI4A 5C1UA 3GYLB 5DPAA 3D23A 2QY0B 2AS9A 3LJOA 1EZUC 1ZPCA 3PB1E 3SORA 5B6LA 1GL0E 5HKKD 1MBMA 4H6TA 1WAYB 4ABHA 2OUAA 1S6HA 2B0FA 2BD8A 1N6YA 1Y3WA 3A7XA 1IHSH 1O2OA 1Y5BT 4U01A 1SQOA 1IAUA 3BV9B 1BMAA 1ZOMA 2ZCHP 2WPMS 1QTFA 1ZTKA 2AYWA 5PTPA 3SHAH 3G01A 4Z1MD 2GZ8A 2BD4A 2XC4A 1LQDB 1QBNA 1BT7A 1S82A 4ZHLU 5DP9A 1C4Y2 1Q2WA 1JXPA 3UWJH 2BD3A 3PMBB 1J9CH 1SLXB 1KSNA 1GI1A 1SFIA 2BLWA 3ZYEA 1SQRA 5EXNA 3UQOA 3SO3A 5CHBA 3RLYH 2GJGA 4O03A 4UFFH 1MKXK 1KDQA 4HG6A 1C5MD 3FP6E 1BTXA 4ABBA 5E0GA 1VCQA 1ZMNA 1E35B 7GCHG 2ZQ2A 1XUHA 1O34A 5GCHG 2XBVA 1GI0A 1O5EH 3S7HB 1AB9B 5E8EH 5TCAA 1HAYB 4F49A 1O2SA 3UIRA 2KFWA 2UWLA 4BAOB 3HKJB 1TRNA 2ZPQA 1EAXA 3NRLA 1C2DA 1O2YA 3E91A 1E34B 3GDSA 1TGNA 4CHAB 1AE5A 2IJOB 1TNIA 4A1VA 4YTAA 4ABGA 3ATLA 1COWD 5SGAE 4M9FA 5AHGH 2QXGA 1YPEH 3QGNB 3GOVB 3KYGA 1IHTH 2C8YB 2JETC 5C20A 2SGEE 1GL1A 1VCWA 1ZTJA 1O3GA 3GY6A 2ZPSA 4NWKA 1EAUA 3EGKH 3MH4A 3A85A 2HPPH 3Q77A 3LGIA 2BX4A 4ZKOU 1W7GH 3RXLA 1CT4E 1LHFH 1V6DA 1UCYH 4DOQA 1WQVH 1FY3A 1H9IE 2OTVA 2LELA 1W7XH 3P92A 3LH1A 3M37A 1O5CB 1P06A 3N99A 1GJ9B 2ZDMA 4WF8A 2BDGA 1FZZA 4Y8XA 2TGTA 2C8ZB 1YPGH 5GNDA 2OQ5A 1QJ6B 2CF8H 1E1QD 1NROH 5T6FA 1Y8TA 2HLDD 3N7DA 5FBEA 1DLKB 1PQ7A 1BITA 1ZRBA 1GJ6A 1MD8A 3SJIA 3RXVA 3EAJA 4XSKU 3WWFA 1UMAH 5GJ4B 3RMLH 2FTMA 3F0PA 1DOJA 1ZYOA 4YLUA 1MKWH 2VIOA 4TT3D 3Q00A 1XKAC 2PHBA 1JIRA 3ZIAD 2C3SA 1Y3YA 4OS5A 1F5KU 2AHME 1NFUA 2ODPA 2HGTH 4KELA 4Q7XA 1H9HE 2ZFTA 5A09A 1GCDA 1V2NT 5L6NH 1NM6A 3VGCB 1W2KH 1INCA 4Q4LA 4UFGH 1DICA 1ARCA 2ALPA 4IMQA 4VGCC 3UR6A 1DX5M 4DCDA 2UUJB 4Q7YA 2LNCA 1GI6A 3MO6A 1L1NA 1GPZA 3FP8E 1TPAE 4MLFB 2QIQA 2WPKS 3ZVBA 1NRNH 4AB9A 4DIHH 1AFEH 2YNAA 4I32A 1Z1JA 2AMQA 2ZDLA 1UJ1A 1P05A 8ESTE 3OE7D 4LXBH 3ZZ6A 3AVZA 1V2VT 3P8FA 1NC6A 4YO9A 5TCCA 1GI3A 1WUNH 1K0HA 1S85A 2VVVA 1P12E 2IPHA 2ZA5A 1XUFA 1TGBA 3KIDU 1SGTA 2CJIA 1EB2A 3QZRA 5F8TA 1MBQA 1O36A 3MO9A 4ASUD 1ANBA 2H1UA 1GVZA 3GY4A 4NSYA 1RTFB 3KGPA 1TB6H 2BY7X 4WMDA 2Y5HA 1E1RD 1BCUH 1GBDA 3LGWA 1UHBB 2OXSA 1F7ZA 2TGPZ 3BEFB 5T3HA 2L74A 1YLCA 4UONA 5TJXA 1V2OT 7GCHF 1GMDG 1O37A 3PO1C 1C5TA 5I46H 3RDZA 2FOEA 5GCHF 4XBDA 3U98H 2V0BA 2FP7B 4H4FA 4B75A 2G55A 5DP5A 4OM9A 1OP8A 4FUJA 5F53A 3ZVGA 3EYDA 1TLDA 4WH6A 3PRBA 3F0OA 2ZFFH 3F3BA 2ZFPH 1ZJKA 2OK5A 2FI4E 2ANMH 2BOHB 2GDDA 2GD4B 5KECA 1S5SA 2FOGA 3W95A 4GCHF 2J95A 1T4VH 1BRBE 2ZDNA 3VB7A 5GWZA 2FIRH 4GHQA 4MNYA 4I8GA 2A0QB 2P16A 1EOLA 4MPVA 1O2HA 1TPSA 4Y79A 1PPCE 5IYTA 3PM3A 3FAOA 1NBME 1TGCA 2VJ1A 1CU1A 5EXLA 2O8TA 1GJBB 1KXEA 4IGDA 2G8TA 1ELBA 3HPTB 3L3TA 4F48B 1A2CH 1D3TB 1V2UT 1BJVA 4B2CA 4KGAA 1DFPA 5FX5A 4TWYA 4B2BA 1QNJA 3PRDA 1A5IA 3SI4H 5C1XA 1E36B 2KX4A 3DFJA 2JKHA 2GMTB 2GCTC 3O8CA 1YC0A 1E79D 2ZU3A 3MU5A 3S7KB 8LPRA 3RXDA 5JB9S 4UEHH 1PQ5A 2BDHA 1C2KA 1GG6B 1CQQA 1O3IA 1AVWA 3ZZ4A 3U28C 2CF9H 2AIPA 4X8UH 2XC0A 2F9NA 3M5LA 4O97A 2VIQA 2V3MA 1O5BB 2KCYA 4JK6A 1G30B 5HIYA 1SGRE 3STJA 2Z6BD 1A61H 2Y80A 4FXGH 1HAPH 2CHAB 2BQWB 4X1NU 4CRFA 1QL7A 1ZGIA 1J14A 2AIQA 4ZKRU 3SV6A 3KHVA 1NTPA 3A8DA 4OS6A 1WSSH 2UUYA 1OWEA 1FPHH 3QX5H 2VWOA 4U2WA 2DE9A 3S9CA 2GKVE 1V2JT 3VB4A 3HGPA 1UVPA 2P3UB 2OC1A 3R3GB 1LKBA 3BEUA 3TGJE 1L4DA 2PTNA 1EPTA 1ESBA 2A31A 2ZNKH 4RT1A 5DSFA 2ZU4A 4HTCH 5DG6A 2VU8E 4A92A 1SGIB 8KME2 2G5NA 5C2ZA 2ZI2H 3BG4B 5DN6D 1V3XA 4AFUA 1O2UA 1GHYH 2C8XB 2WYJA 2QCYA 2Z9IA 1CGJE 3MU1A 2A5IA 4WVPE 4IBLH 1TOMH 1TPOA 1FNIA 1G2MA 2V35A 2QN5T 1P02A 3DSPA 1S6FA 1MU6B 3PROA 1C1MA 3LGVA 1SQAA 4OGYA 4LZ1H 1CT2E 2KAIB 1HJAC 2ZEBA 3A7YA 2ZFQH 1IQHA 4TWWA 3TJUA 2PUQH 1GMDF 4YT6H 3M5MA 3F9EA 2XWBI 4Y8YA 3GCTG 3Q3YA 1FMGA 3N7OA 2FTLE 2P3FH 1SLVB 3RXHA 1ESTA 1V2LT 2ALVA 1XKBC 4RSPA 2Z9KA 1B7XB 1BRAA 5DGJA 2ZCKP 3GYMA 1Z71A 1RRKA 3W94A 1FAXA 4ZKSU 1TMTH 4BAQB 4WWYA 4WMEA 3SQEE 2DUCA 1IQMA 1O38A 5JBAS 2QXIA 4WXIA 1MZAA 4TY7A 1L1GA 3LT3A 4MPXA 3VB5A 1DY9A 1QQ4A 1QIXB 3RXUA 1DS2E 1LPGB 2C4FH 4UDWH 4DJZB 3MH5A 1CGHA 4F55A 1C1PA 2JH0D 2BMGB 5FX6A 1LMWB 2VNTA 1FY1A 3V13A 6CHAC 1G9IE 3RXFA 1O3LA 3ITIA 4RKOB 4BXWA 1K1JA 1O3KA 1LHEH 1A5HA 1KDQB 2D8WA 2HRVA 5C5NA 2M5TA 4NIWA 1SGDE 2KZ4A 1E0FD 1Z8JB 3A7WA 5L30H 4ACAA 1S81A 2W7SA 2HVXA 1IQLA 4K60A 2R3UA 1JRTA 2WV9A 3UQVA 1OX1A 3JZ2B 1Z8RA 3LU9B 5AFZH 4FUIA 2P95A 1C5ZB 2ZGXH 1JRSA 4OS2A 5B6OA 4X2YA 4BTTB 1MTVA 2BHGA 1DWCH 1S0QA 2UUFB 3UTUH 2PGBB 1GHBF 1O2KA 1TYNA 3BTME 3QN7A 2GTBA 3A7TA 4D76A 4MDSA 2W5EA 4X6OA 3A7ZA 1JMOH 1GBFA 2RFKC 3B23B 1DT2A 1NRSH 1TNLA 1DWBH 1SHYA 1EJMA 5LPRA 2QXHA 5JPMH 3SNCA 1GJCB 2AGGX 4DG4A 4ZHAA 1B5GH 4GAWA 1F5LA 1HNEE 4FUGA 1RJXB 4Q63A 2A2XH 3M61U 2G4UA 1CBWC 2BB4A 1NN6A 5FBIA 3RXIA 1PPZA 4K69A 3UWIA 1CHGA 3FZZA 1C5QA 4KP0A 1YPLH 5L2YH 1THSH 2QYIA 2WZQA 3RXQA 4CBNA 5A8ZA 1YWUA 2VBCA 4JZ1A 4ZCNA 1UK4A 2TIOA 4XRNA 3ZVAA 4I8LA 2JDID 3EA8A 1AD8H 1P2MA 3E16B 3RXJA 1AFQB 1W0YH 4WJG2 1RXPA 1EJAA 2QGRA 3OSYA 3ATIA 3SU5A 1S83A 4E06H 1TWXB 2FOAA 3SU6A 1MKXH 1AVGH 2YNBA 5G4BA 5JBCS 1UTNA 1Z6EA 1V2RT 2F83A 1GHWH 1MTNB 2ZIQH 4J1YA 1Z8IB 4X6NA 2G4TA 2RG3A 4AFSA 3E0NB 1O5AB 1OYQA 1E37B 1P03A 2A45B 3FFGA 4BNRA 3MMGA 2WUCA 3P8GA 2VGCB 5EW1H 3KCGH 1O3NA 1CT0E 4ISIH 4JZEH 1A1RA 4NWLA 5GIBA 1AVXA 3OY6U 3LDXH 2SGAA 1G2LA 2TPIZ 1O2MA 1P3EA 1QQUA 1QURH 1T31A 1YCPK 5A8YA 3RU4E 2KCAA 1GHAG 4CH2B 2ESTE 1BQYA 1ACBE 1PQAA 2HLCA 4X1QU 4BTIB 1FQ3A 3E6PH 4RT0A 3IITA 2ULLA 1PYTD 4DURA 1P2JA 1DUAA 3GY8A 3VEQB 1C2EA 3VXEH 1YKTA 1ZZZA 3C1KA 1KLTA 3S9AA 2GZ7A 1BHXF 2FLBH 3SN8A 2FLRH 1B0FA 2PW8H 3FZDA 3H09A 1U6QA 1YYY1 3E8LA 1MQ5A 1ELAA 2ZTYA 1SLUB 3K2UA 1EP5A 1EXFA 2BYAX 2A4OA 2YOLA 3T28A 1WYKA 3HK6B 1XMNB 2RDEA 2Y7ZA 4DT7B 3RMOH 3RXTA 1P2QA 4CRAA 2Y5FA 1N8OB 1O2VA 4I86A 2GT8A 3LJJA 3ZZ7A 2Q6GA 4JZIA 2YMSB 2GGVB 1WDIA 7KMEH 3FN8A 1K1NA 1BHXB 4MPWA 1GCTB 1WQSA 1QA7A 2R3YA 3PV2A 4GUXA 3AW0A 2Z9LA 5LGOA 2FXRA 4XOJA 1K1OA 3BTHE 2BD2A 2BXUH 2NU2E 2EI8A 3S0NA 4UFEH 4YT7H 3QWCH 2BDIA 2G51A 1GBAA 2A4QA 1C4U2 4HGCA 2AERH 3NXPA 2OCVB 3ATKA 4K1EA 1Y5UT 1O3AA 5A8XA 5EGMA 4ABJA 1YPMH 4RKJB 1SGQE 2WUBA 2WSSD 3NK8A 1MTSA 5T1VA 3AAUA 1MUEB 1ETRH 2ZHQH 3PMHB 2WINI 5DP6A 1FN8A 1GGDC 2OQUA 1NESE 1DY8A 3I78A 1C9TA 1UK2A 2AH4X 1GBEA 3E1XB 5EQSA 1O39A 2C90B 1XVMA 1DITH 3BEIB 1QCPA 4HZHA 1KXDA 5EPYA 2FX6A 3D65E 3T29A 2OD3B 2C8WB 1HCGA 2KCOA 1VJAU 2XBXA 1BOQA 1O0DH 1TIOA 1OWJA 1BB0B 2ZHWH 1TX8A 3H5CB 1CA0C 4GCHG 1GJDB 1C2LA 3GCHB 4ESTE 3QUMP 5EPNA 3M35A 1PFXC 2VWMA 2J34A 1K21H 1GBBA 5E2OA 3PV5A 2GVFA 2ZGBH 4XBCA 1EATA 2ZTZA 1BA8B 3SV9A 1TNGA 1O3FA 4NA8A 1C1NA 1T8OA 3HKIB 1XXFA 1GVLA 4ASHA 5ABWA 1ZSKA 1MCTA 2VIVA 1HPGA 3TIUA 3ZZCA 3U8TH 1Y3UA 1SI5H 1TMUH 4AGJA 3MH6A 4K8YA 1GHAF 1O5DH 1EPTB 1ABJH 3OYPA 2BD7A 3A8BA 2F9OA 1V2QT 3BTKE 2SNVA 3M3TA 2TGAA 3D49H 2P8OC 3F9FA 2LP6A 2A1DB 2Y81A 3KNXA 1P01A 1O2RA 2KCPA 1K1MA 1C1UH 3ZZBA 3M36A 4GVUA 1ZPZA 1P09A 3O8BA 4NZQA 1UTLM 1UVOA 1GG6C 1J8AA 1C5OH 1LKAA 5EJLA 1AY6H 5HMAA 3UNRA 2G5VA 4UD9H 1QJ1B 4NGAH 5HIZA 4K2YA 5LPFA 1ZSJA 3OEED 1O5FH 1V2MT 3ZVEA 1SR5C 3HGNA 4AFZA 5AF9H 1TNKA 1ZJDA 4OS7A 5F8XA 3ZVCA 1WOFA 1YPHC 1D6RA 4ABFA 3SNEA 1TBQH 1TPPA 2ZO3H 5ESBA 7ESTE 2ZU2A 1AN1E 1GJ7B 1DVAH 4TY6A 4WXVA 4WY3A 1NO9H 4INLA 3NPSA 1O32A 4Y7BA 1C5YB 3F9GA 1GJ5H 1NT1A 5C0TA 1TOCB 2GCHF 2XCFA 1OP2A 2FOBA 5EODA 1C2IA 1GI5A 1O30A 1C1OA 3MH7A 1HJ8A 3RXMA 3MNXA 3UOUA 1O2GH 3A82A 5HM9A 3UR9A 1O35A 1EUFA 2UUKB 2AGIX 1ANDA 3I77A 4I33A 3UNSA 2BQ7B 4K1TA 4YOIA 1DWDH 2F43B 2W6JD 3KF2A 2Z3DA 1NRPH 4RI0A 2RCEA 2SFAA 2ZGJA 1BTYA 1SC8U 3RXRA 1X7AC 2XRCA 2W26A 1TONA 1S84A 2VH6A 3VPKA 3ZZ8A 4CR5A 4A6LA 1FV9A 3RXAA 1UW7A 1RS0A 2BVSH 2B8OH 2J98A 1EAWA 2HNTF 1W14U 2R0KA 2L6OA 4P02A 3MQKC 2A4GA 1TBRH 1ELEE 3SV8A 4LZ4B 1IQFA 2HPQH 2PSXA 2J92A 2J9NA 1IQEA 2FOMB 2PUXB 3ZV8A 1TA6A 3P8OA 1SG8B 3UAIC 1GMHF 1ORFA 2BLVA 5C1YA 1CVWH 3BTDE 2F9VA 4I8HA 1G3EA 1O2TA 1ABIH 1WCZA 1EQ9A 5FL7D 3VG8A 3S9BA 1GBMA 1LQEA 4YOGA 2NWNA 1FX0B 4JMYA 1H8IH 3RXEA 2CXVA 1CA8B 4Y6DA 3GY5A 1XUIA 5JYIA 2GT7A 2THFB 2JETB 1TBZH 2EQNA 5FCRA 1BUIA 4JYTA 1HV7A 3SNBA 5HXFA 2XYAA 1YLDA 1SBWA 5C0UA 2GP9B 1SGNE 4LOYH 2R2WU 4AYYB 3TK6A 2FMJA 4DT4A 1SB1H 4AB8A 3BTWE 1JBUH 4D7GA 1C5LH 1FY8E 2GV7A 1FY5A 2BX3A 3TITA 1XXDA 2NU1E 2F9UA 1DE7H 2ZHEH 5KEDA 3KQCA 2P94A 3T2NA 2ZDKA 4KKDA 4Z6AH 1V2KT 1J17T 3RC6A 1KXCA 4B71A 3PLKA 1KXBA 2PKSC 2FO9A 4HFPB 2HVYB 1C9PA 2VIPA 2O8WA 1GHBG 1C2GA 1NPMA 3ZZAA 2O8LA 1K22H 4X2VA 3TJOA 5E2PA 3U1IB 1Q31A 1T32A 1H8HD 4R8TB 3ZV9A 2VINA 3SNDA 3C27B 4NIXA 5A0AE 3K6ZA 4X1PU 2Z3CA 1RIWC 3U69H 3KQBA 2RA3A 1VGCC 2HOBA 1EZXC 1N1LA 1HAVB 5EJZA 1JOUB 4F4OC 5IDKA 4KTCA 2DE8A 3ENSB 3LGUA 1AE8H 1VJ9U 4VGCB 3PV4A 4B1TA 8GCHF 2ZPRA 1H9LB 3BG8A 4GLYA 3SGAE 3V0XA 2FPZA 2ZGCA 1N6XA 1P8VC 1JIMA 9ESTA 1EJNA 3BTGE 1ARBA 1BBRH 3RMMH 1J15A 1K1IA 3LC3A 1P3CA 4CRGA 1LPKB 1MAYA 1SOZA 2FYRA 1PPHE 5CE1A 2AGEX 2BDCA 1AFQC 3DFLA 1FAKH 2SGFE 2BY5X 3OX7U 2BZ6H 1BDAA 1MAXA 5ESTE 3UY9A 2NU3E 1C1TA 3H7TA 2K0QA 2BXTH 3GS9A 1GHVH 3M5NA 1T8MA 1F0UA 1MTNC 3M7QA 2YMSD 1DSUA 1Z1IA 2LPRA 3PO1B 1KLIH 4K5ZA 3LGYA 3SOSA 1FI8A 2F91A 1EFRD 4WMFA 1EAIA 2D1JA 2FZZA 1OOKB 1LHCH 2XC5A 2Y6TA 1ELDE 1V2TT 3SUGA 2WPJS 4X1SU 1V2ST 3GDUA 1T8NA 3NWUA 4AORA 5EQRA 4X8SH 3KQEA 5K0HA 3PMAB 1BTUA 3DSOA 1SHHB 2XW9A 3GISB 1CSOE 4JK5A 4RN6A 1K9OE 4ISHH 1Y3VA 1HXEH 3EE0B 2ZDVH 2H2ZA 1C5NH 3F6UH 1SVPA 2K8IA 1OWKA 1L4ZA 5GDSH 1AWHB 3UFAA 1ANCA 2W3IA 3ZVDA 5LPEA 1UTJA 2PV9B 3K6YA 3UREA 1IOEA 1OWIA 4OGXA 1GHZA 1O31A 3UPEA 4FVDA 1J16A 1NFWA 5DP8A 1BMFD 1D3QB 3IG6B 1GI4A 2STBE 6GCHF 2XTTB 3OEHD 4B6FA 2KR7A 1HBTH 2A4RA 1PPEE 1P04A 1H8DH 1A0HB 1SGFG 4M7GA 4ABAA 1DM4B 1UHBA 2RA0A 2H5DA 2AEIH 1ZMLA 2ZF0H 2BQ6B 1EZSC 1FXYA 1NU7B 1HDTH 1UCYE 4JZDH 2Y7XA 3SJOA 1W0ZU 6LPRA 2IPQX 1GCTC 4FU7A 4CREA 1KTTB 3RUOA 1OP0A 3V7TA 4A1XA 1GDUA 1YY3A 1QB6A 3SZEA 1DXWA 1HAXB 1NBMD 4ISNA 1W11U 1BTHH 1FIZA 1Y5AT 3MU8A 3RXBA 1YPHE 4MNWA 1GJ4H 4K8BA 2EY4C 4NA7A 3VB3A 4B73A 3A83A 4CR9A 2Z7FE 5CHAB 1L2EA 5C17A 3BIUH 1OSSA 3U8OH 3UOPA 1UTOA 2WV5A 5AVDA 3T27A 2ANYA 3AAVA 1PPBH 1A4WH 1W8BH 2FDAA 2ASUB 2Z9JA 1F2SE 1GVKB 1QB9A 5EXMA 5EQQA 1HAIH 3M5OA 5DJ7A 1Y3XA 2BY6X 1XUGA 4A5TS 3SNAA 1F0RA 3QTVH 1UTPA 1D3DB 3DUXH 1YM0A 3FVFB 4AGKA 2ZZUH 4H42U 1FN6A 2I6QA 3TNTA 4CBOA 1D3PB 5FPYA 1EOJA 1TGTA 2O8UA 4JYUH 3BTEE 1AB9C 2R9PA 3SBKA 4FUEA 2F9BH 3RC5A 1P2KA 4CH8B 1TX6A 2ANWA 2CV3A 1C5VA 4XD7D 3AK5A 2WPDD 1P9SA 3DT0H 2BDAA 4CHAC 2BZAA 1HJAB 1TAWA 1LCYA 1P2IA 1VITH 2Q1JA 1GBIA 2OC0A 2B7DH 3NUMA 4JYVH 3D62A 1ETSH 4FUDA 5J4SA 3WY8A 3GY3A 3Q3KA 2V7QD 1MTWA 3KQDA 1EKBB 4K3JA 2FS9A 2Z94A 3A81A 3E0PB 4Y71A 3VXFH 2RDLA 3OTJE 5CMXH 1FUJA 2H9HA 2OBOA 1S0RA 1Z8GA 1HXFH 2IOTA 1QA0A 2AMDA 3DCLA 3FANA 2H9EH 1OWHA 5EJ1A 1QGFA 1AKSA 4FETA 3A89A 1QBOA 2CGAA 4BANB 2V6NA 4NG9H 1AMHA 1C5PA 1GJ8B 4E05H 1TGSZ 3CS0A 3O8DA 1K1PA 1SFQB 2ZECA 4ISLA 3A80A 4ZXYH 4NFFA 2WPHS 4OS4A 5GPIB 2ZTXA 1D4PB 1O2QA 3GCNA 3MTYA 1O33A 1GBHA 2WPIS 4Q80A 3Q76A 1QBVH 1K28D 4E7NA 3EA9A 5EU8A 2D2DA 2XWAA 4GPGA 6CHAB 4INKA 1BMMH 4JCNA 1LHDH 3P8NA 1G32B 1TNHA 1OPHB 1MCVA 3BSQA 2J4IA 1DWEH 5BPEA 3T62A 1HAGE 1QFKH 1TFXA 1Z7KA 1XX9A 4ABEA 3N7EA 3F2HA 3SU4A 3TU7H 3VGCC 4O9VA 3OTPA 4Y11E 3MNBA 3SUFA 1XUKA 1GJAB 1HFDA 2BDBA 1ETTH 1LHGH 1RD3B 4DW2U 1O3JA 1W12U 3B8JA 3CNRA 4AC9A 2BY8X 2F4LA 2PFEA 2GCHG 1MQ6A 2A32A 3RC4A 4SGAE 3WW7A 1C4V2 5EG4A 5JBBS 1O3EA 1RTKA 1EB1H 1SGCA 2FOFA 1HRTH 1FJSA 1DPOA 2B5TB 1C1SA 3M7TA 1BTWA 3MNCA 1W10U 3RXKA 1MABB 1C1QA 3PMJA 5EIYA 3SJ8A 1ZRKA 1UTQA 3FOAA 1SMFE 1UTKA 2P93A 2SNWA 1P9UA 2FWWA 2W6ID 1PYTC 5I25A 4TPIZ 1GBCA 1K2I1 1P57B 3MOCA 2PGQB 2CMYA 1GMCG 3OAAD 1AIXH 4Y7AA 3QLPH 1CBWB 3MO3A 1ZLRA 2STAE 4Y0ZE 1IQGA 1O3PB 1NRQH 4O3TA 3GDVA 1D9IA 1O3DA 3ZZ5A 4Y0YE 5HGGA 3SYJA 3K65B 5A0BA 4ABIA 2G52A 1A0LA 1SGEE 3E3TA 4TYDA 3GY7A 3T26A 4X8TH 4DVAU 1VITF 1GMHG 4LK4A 1F0TA 1ESAA 3SU0A 3TH4H 2OP9A 4BXSA 1NZQH 2Y5GA 4GHTA 3ODDA 4TPYA 1QL9A 1O2IA 1CHOF 1AWFH 2TGDA 4IMZA 4D7FA 4KTSA 1Q3XA 3M3SA 3SV2H 3SU2A 3WWBA 1F5RA 2F9PA 2HNTC 1QRXA 4Y10E 3BTQE 3TH3H 1TALA 2PP6A 2NU4E 2AFQB 3TGIE 4X6MA 2XBYA 3OU0A 3ZYDA 3W1EA 4ZMAH 4AYVB 1THRH 1T8LA 5K7RA 2QXJA 1BBRE 2GDEH 2BOKA 2VVCA 1F0SA 2ZHFH 3A88A 1TX7A 1C5XB 1A3BH 3ZZ9A 3F2FA 1ELFA 2ZU1A 2CK3D 1GDQA 2PLXA 5JDUB 4YZUA 4QT8C 2GMTC 3GICB 1KIGH 1GI8B 4AFQA 3BTTE 2PKAA 3SUDA 2OC8A 4B76A 2ILNA 2JJ2D 3RXGA 1AU8A 1XVOA 3SUEA 2BVRH 2ZC9H 4YXWD 2ODQA 1KXFA 1BJUA 2FI5E 1KLJH 1WV7H 2EI7A 1ANEA 1PQ8A 4XE4A 1VR1H 4JZFH 2VIDA 2FM2A 1CE5A 2BDYA 2G81E 4FUHA 3HK3B 1SKYE 4IS5A 3S69A 2CHAC 1LO6A 3QGJA 3SW2B 1EX3A 2IJD1 1O3MA 4CRDA 4CRBA 1MMJN 2OBQA 1OS8A 4AG1A 5E0JA 2H6MA 3VB6A 2A7JA 2PSYA 1KTSB 3BN9A 2O9QA 2ZU5A 8GCHG 4IN2A 4D9QA 5F6MA 1QZ8A 1VKYA 2ZQ1A 3DHKH 3RU4D 1SQTA 2B9LA 2ANKH 3P95A 3QZQA 3TLOA 2K1QA 3R0FA 4AN7A 1P10A 3DD2H 2QV1A 5A2MH 3A87A 3BG4C 3RLWH 5IK2D 5DK1A 3PLPA 2OLGA 1A5GH 1YPJH 2XXLA 3KYFA 1AUTC 1GMCF 1O2WA 2XCNA 5F03A 1GBJA 3EE7A 4K1SA 4MNXA 3TJNA 4D9RA 4E7RG 2JIZD 3A84A 1DXPA 1SL3A 1FIWA 1P2NA 3EQ0H 1QL8A 4MPUA 3QO6A 2BTCE 3UUZA 1C5UA 1WXRA 1GI9B 4BTUB 1H1BA 5T6GA 1IQJA 4H6SB 4NA9H 3SGQE 2AMPA 3URDA 1FY4A 3MU0A 1G3CA 1GGDB 1VZQH 1DDJA 2G00A 3EDXB 1HIAA 2O8MA 4IC5A 1C1WH 1BZXE 1AGJA 1O2LA 1A7SA 2ZWLH 1WTGH 2IN2A 3B9FH 2HWLB 1W3CA 1ZHPA 2BY9X 4ZROA 3L6PA 3CENA 2J5UA 2PR3A 2V3OH 3JZ1B 3KQ5A 1D6WA 1BMLA 3FP7E 1NY22 2GV6A 3CS7A 2H9TH 1CA0B 1ELGA 1P2OA 1QRZA 1HLTH 1EP6A 1LVOA 1ZR0A 1WU1A 1UCYK 2J97A 2Q6DA 1OWDA 2A7CA 4FU8A 4BAKB 3ELAH 3SJ9A 1KXAA 3F2GA 2XNIA 2Z3EA 4WH8A 1FDPA 2ODYB 1O2XA 3VFEA 4CRCA 1H8ED 2C93B 1UK3A 3F68H 3BIVH 1SGFA 2R0LA 3PLBA 6GCHG 1TABE 1DANH 3P17H 1O2PA 4I7YH 4PROA 2V3HH 2ZGHA 2GZ9A 1AZZA 2TBSA 2UWPA 3QTOH 2VWLA 4X2XA 1EZQA 5E0HA 1GI2A 1MKWK 5FXLA 4ZKNU 3TH2H 1G3DA 2JH5D 2W7UA 3SZNA 1PPFE 2P8OB 1IQIA 1SLWB 1BRCE 1TMBH 5DP4A 4DIIH 2TRMA 1V2PT 3SU3A 1THPB 1LVBA 4AOQA 1C1VH 3ZVFA 3CP7A 1Z6JH 1GBTA 2ZG0H 1SGPE 1NU9A 2WYGA 2A7HA 3LGTA 2QF3A 5FCKA 5C5OA 4MNVA 3TK9A 6ESTA 2FESH 4ABDA 4ZXXH 4B6EA 1CGIE 1RGQA 2QF0A 1OYTH 4AZ2B 1DLEA 4YESB 3RP2A 1PPGE 1QHRB 4YM9A 1RTLA 1W0JD 1FONA 2A2QH 5CHAC 3LPRA 1OHHD 1AKSB 2M2AA 3T25A 2SGDE 1ZPBA 1GHXH 3TPIZ 3M3VA 1C1RA 5T6DA 2HALA 3QDZB 4NCYA 2SGQE 2CN0H 4FVBA 2BD5A 1UTMA 2Y82A 1GI7B 3ATWA 3NZIA 5C67A 4X8VH 2J94A 2ZDAH 3MFJA 2ZP0H 4BAHB 2P59A 5A0CA 4YLQH 4AG2A 1AHTH 2FX4A 1PJPA 2ZCLP 2BLOA 1C2FA 1T4UH 3SV7A 3V12A 1HUTH 2FS8A 4GSOA 3QK1A 1MZDA 1DSTA 1B0EA 2D26C 2VIWA 5DP3A 1C2MA 1FPCH 1LVMA 1YLNA 1KMHB 2UWOA 1EASA 3L33A 5JB8S 3H7OA 3PWCA 2GX4A 4A1TA 1OKXA 2OINA 2WV4A 3I29A 3P6ZB 2VGCC 5FPTA 2R2MB 1SOTA 1UVUH 4OS1A 5DO4H 4FOUC 2QE7D 2ZFRH 5EOKA 4D8NA 2QF4A 1C5SA 4BAMB 1ELTA 1F92A 3RXSA 3F1SB 1AZ8A 1GWAA 2VWNA 2WPLS 3A8AA 4ACBA 4I8JA 5FAHA 5J4QA 3LH3A 4NFEA 9LPRA 1BTZA 2FI3E 4B74A 4X1RU 3URCA 1QJ7B 4A7IB 1ID5H 4MTBA 5EW2H 1HAHH 1HGTH 1CO7E 1O3CA 4IW4E 5GXPA 3RU4T 5C3NA 4MVNA 1TA2A 1GDNA 1W13U 2EI6A 2A5AA 3GY2A 4UFDH 3U9AH 2HNTE 1GBLA 2ZFSA 3P70B 1TRYA 3RXPA 3M7UA 3ODFA 1XM1A 1AI8H 1YCPH 2BLQA 3TNSA 4Q2KA 3T5FH 3FKSD 1JWTA 1YP9A 1Y59T 1TRMA 3BTFE 4IN1A 4TSFD 1S6LA 2W3KA 1C2JA 3MWIU 1K1LA 2OC7A 4NIYA 1C5RA 1TE0A 3PWBA 2GCTB 1UVSH 1M9UA 4B2AA 3LC5A 4INHA 1HAZB 4NIVA 1N8OC 2BM2A 1OXGA 3STIA 2QC2A 3MU4A 3MNSA 1O2NA 3EA7A 5H4IB 1FLEE 3TGKE 3IWMA 4NSVA 1YF4A 1TQ0B 2YMSC 1SSXA 1BTPA 3ZZDA 1A46H 2ZKSA 4KTUA 2BD9A 3O8RA 1HAOH 3TJVA 3LOXA 3SGBE 7LPRA 1DUEA 2PKSB 4FUCA 1QY6A 5HM2A 3ESTA 4SGBE 1E38B 4Y76A 3TK5A 5FHTA 3RXCA 2WHXA 3NKKA 1A3EH 3RXOA 3A8CA 1NFXA 2ZHDA 3E90B 4HI3A 1UO6A 4AX9H 3U8RH 1SGYE 1ELVA 4XFQA 1WTHD 3PTNA 5AFYH 2Q6FA 1ZHMA 1T7CA 3RM0H 1RIWB 2KM0A 4J2YB 1G3BA 2QAAA 1MH0A 1AO5A 2Z9GA 5L2ZH 1BRUP 1O3HA 4Z0KA 1VGCB 1LPZB 1ZMJA 4U30A 1HYLA 1L1JA 4ZH8A 2FOCA 2P3TB 1O3BA 4R0IA 2FYQA 4U32A 5DP7A 2J2UA 1G36A 5DKMA 1BBRK 3GCOA 1HJ9A 3OY5U 4FUFA 1IQKA 3SU1A 1VCPA 3V3MA 1ZSLA 2EEKA 4I31A 3RM2H 2XOKD 3U1JB 2PKAB 3Q3XA 3MHWU 5HYOA 2VVUA 3LIWA 2QA9E 4MQAA 4I8KA 4X2WA 1ZGVA 2H5CA 1VITG 3BF6H 1LDTT 4FU9A 2FODA 1RFNA 4BOHA 1QRWA 3SHCH 3KL6A 4ISOA 4UE7H 4NZLA 2EC9H 1TQ7B 4DY7B 5KGOA 3FO8D 3PTBA 1CHOG 2I6SA 2J38A 1HB0B 4Q7ZA 3GCHC 4YOJA 1YBWA 1C2HA 2XBWA 3UNQA 2PWXA 3A86A 1GBKA 1L0ZA 1LTOA 5JBTA 2BVXH 1C5WB 2NU0E 2PTCE 4MG3A 3DSGA 4FUBA 3GCTF 2EA3A 3F9HA 4XBBA 5F8ZA 3MYWA 3ATMA 1NRRH 2VB0A 3SI3H 2XNDD 3LKWA 1O3OA 1TNJA 1YCPM 1MD7A 1NS3A 3A7VA 3ZZ3A 1AUJA 1V2WT 2SGPE 3NCLA 1HAVA 4THNH 4ZAEA 2JH6D 1EPTC 3HATH 1AQ7A 1ELCA 1ZHRA 4O3UA 4P00A 1BIOA 1H4WA 4ZUHA 3RMNH 1KY9A 5FPSA
chains in the Genus database with same CATH topology
1LVYA 1O2ZA 3TVJB 3SQHE 4DGJA 4X6PA 1P11E 1SPJA 1ZTLA 1MTUA 1BMNH 1UVTH 1YGCH 3LONA 3DA9B 3PYHA 4IC6A 1QR3E 1O5GH 5ETXA 4XDEA 2KAIA 1O2JA 2FEQH 1MU8B 4X0WU 1KYNA 1G37A 4ZHMU 3KN2A 1P0SH 1WBGB 2FOHA 3AASA 3K9XB 1IQNA 1NFYA 2A5KA 2F3CE 4Y8ZA 1HIAB 1XUJA 1QB1A 5LH8A 3AW1A 3KEEA 3SJKA 5BRRE 1A0JA 1YPKH 2VH0A 3MI4A 5C1UA 3GYLB 5DPAA 3D23A 2QY0B 2AS9A 3LJOA 1EZUC 1ZPCA 3PB1E 3SORA 1GL0E 1MBMA 4H6TA 1WAYB 4ABHA 2OUAA 1S6HA 2B0FA 2BD8A 1N6YA 1Y3WA 3A7XA 1IHSH 1O2OA 1Y5BT 4U01A 1SQOA 1IAUA 3BV9B 1BMAA 1ZOMA 2ZCHP 2WPMS 1QTFA 1ZTKA 2AYWA 5PTPA 3SHAH 3G01A 2GZ8A 2BD4A 2XC4A 1LQDB 1QBNA 1BT7A 1S82A 4ZHLU 5DP9A 1C4Y2 1Q2WA 1JXPA 3UWJH 2BD3A 3PMBB 1J9CH 1SLXB 1KSNA 1GI1A 1SFIA 2BLWA 3ZYEA 5EXNA 3UQOA 3SO3A 3RLYH 4O03A 4UFFH 1MKXK 1KDQA 1C5MD 3FP6E 1BTXA 4ABBA 5E0GA 1VCQA 1ZMNA 1E35B 7GCHG 2ZQ2A 1XUHA 1O34A 5GCHG 2XBVA 1GI0A 1O5EH 3S7HB 1AB9B 5E8EH 5TCAA 1HAYB 4F49A 1O2SA 3UIRA 2UWLA 4BAOB 3HKJB 1TRNA 2ZPQA 1EAXA 1C2DA 1O2YA 3E91A 1E34B 3GDSA 1TGNA 4CHAB 1AE5A 2IJOB 1TNIA 4A1VA 4YTAA 4ABGA 3ATLA 5SGAE 5AHGH 2QXGA 1YPEH 3QGNB 3GOVB 1IHTH 2C8YB 2JETC 5C20A 2SGEE 1GL1A 1VCWA 1ZTJA 1O3GA 3GY6A 2ZPSA 4NWKA 1EAUA 3EGKH 3MH4A 3A85A 2HPPH 3Q77A 3LGIA 2BX4A 4ZKOU 1W7GH 3RXLA 1CT4E 1LHFH 1V6DA 1UCYH 4DOQA 1WQVH 1FY3A 1H9IE 2OTVA 1W7XH 3P92A 3LH1A 3M37A 1O5CB 1P06A 4WF8A 1GJ9B 2ZDMA 4Y8XA 2BDGA 1FZZA 2TGTA 2C8ZB 1YPGH 2OQ5A 1QJ6B 2CF8H 1NROH 5T6FA 1Y8TA 5FBEA 1DLKB 1PQ7A 1BITA 1ZRBA 1GJ6A 1MD8A 3SJIA 3RXVA 3EAJA 4XSKU 1UMAH 5GJ4B 3RMLH 2FTMA 1DOJA 1ZYOA 4YLUA 1MKWH 2VIOA 3Q00A 1XKAC 2PHBA 1JIRA 2C3SA 1Y3YA 4OS5A 1F5KU 1NFUA 2ODPA 2HGTH 4KELA 4Q7XA 1H9HE 2ZFTA 5A09A 1GCDA 1V2NT 5L6NH 1NM6A 3VGCB 1W2KH 1INCA 4UFGH 1DICA 1ARCA 2ALPA 4IMQA 4VGCC 3UR6A 1DX5M 4DCDA 2UUJB 4Q7YA 2LNCA 1GI6A 3MO6A 1L1NA 1GPZA 3FP8E 1TPAE 4MLFB 2QIQA 2WPKS 3ZVBA 1NRNH 4AB9A 4DIHH 1AFEH 2YNAA 4I32A 1Z1JA 2AMQA 2ZDLA 1UJ1A 1P05A 8ESTE 4LXBH 3ZZ6A 3AVZA 1V2VT 3P8FA 1NC6A 4YO9A 5TCCA 1GI3A 1WUNH 1S85A 2VVVA 1P12E 2IPHA 2ZA5A 1XUFA 1TGBA 3KIDU 1SGTA 2CJIA 1EB2A 3QZRA 5F8TA 1MBQA 1O36A 3MO9A 1ANBA 2H1UA 1GVZA 3GY4A 4NSYA 1RTFB 3KGPA 1TB6H 2BY7X 4WMDA 2Y5HA 1BCUH 1GBDA 3LGWA 1UHBB 2OXSA 1F7ZA 2TGPZ 3BEFB 5T3HA 1YLCA 4UONA 5TJXA 1V2OT 7GCHF 1GMDG 1O37A 3PO1C 1C5TA 5I46H 3RDZA 2FOEA 5GCHF 4XBDA 3U98H 2V0BA 2FP7B 4H4FA 4B75A 2G55A 5DP5A 1OP8A 4FUJA 3ZVGA 3EYDA 1TLDA 4WH6A 2ZFFH 2ZFPH 1ZJKA 2FI4E 2ANMH 2BOHB 2GDDA 2GD4B 1S5SA 2FOGA 3W95A 4GCHF 2J95A 1T4VH 1BRBE 2ZDNA 3VB7A 5GWZA 2FIRH 4GHQA 4MNYA 4I8GA 2A0QB 2P16A 1EOLA 4MPVA 1O2HA 1TPSA 4Y79A 1PPCE 5IYTA 3PM3A 3FAOA 1TGCA 2VJ1A 1CU1A 5EXLA 2O8TA 1GJBB 1KXEA 4IGDA 2G8TA 1ELBA 3HPTB 3L3TA 1A2CH 1D3TB 1V2UT 1BJVA 4B2CA 4KGAA 1DFPA 5FX5A 4TWYA 4B2BA 1QNJA 1A5IA 3SI4H 5C1XA 1E36B 3DFJA 2GMTB 2JKHA 2GCTC 3O8CA 1YC0A 2ZU3A 3MU5A 3S7KB 8LPRA 3RXDA 5JB9S 4UEHH 1PQ5A 2BDHA 1C2KA 1GG6B 1CQQA 1O3IA 1AVWA 3ZZ4A 2CF9H 2AIPA 4X8UH 2XC0A 2F9NA 3M5LA 4O97A 2VIQA 1O5BB 4JK6A 1G30B 1SGRE 3STJA 2Z6BD 1A61H 2Y80A 4FXGH 1HAPH 2CHAB 2BQWB 4X1NU 4CRFA 1QL7A 1ZGIA 1J14A 2AIQA 4ZKRU 3SV6A 3KHVA 1NTPA 3A8DA 4OS6A 1WSSH 2UUYA 1OWEA 1FPHH 3QX5H 2VWOA 4U2WA 2DE9A 3S9CA 2GKVE 1V2JT 3VB4A 3HGPA 1UVPA 2P3UB 2OC1A 3R3GB 1LKBA 3BEUA 3TGJE 1L4DA 2PTNA 1EPTA 1ESBA 2A31A 2ZNKH 2ZU4A 4HTCH 5DG6A 2VU8E 4A92A 1SGIB 8KME2 2G5NA 5C2ZA 2ZI2H 3BG4B 1V3XA 4AFUA 1O2UA 1GHYH 2C8XB 2WYJA 2QCYA 2Z9IA 1CGJE 3MU1A 2A5IA 4WVPE 4IBLH 1TOMH 1TPOA 1FNIA 1G2MA 2V35A 2QN5T 1P02A 1S6FA 1MU6B 3PROA 1C1MA 3LGVA 1SQAA 4OGYA 4LZ1H 1CT2E 2KAIB 1HJAC 2ZEBA 3A7YA 2ZFQH 1IQHA 4TWWA 3TJUA 2PUQH 1GMDF 4YT6H 3M5MA 3F9EA 2XWBI 4Y8YA 3GCTG 3Q3YA 1FMGA 3N7OA 2FTLE 2P3FH 1SLVB 3RXHA 1ESTA 1V2LT 2ALVA 1XKBC 4RSPA 2Z9KA 1B7XB 1BRAA 5DGJA 2ZCKP 3GYMA 1Z71A 1RRKA 3W94A 1FAXA 4ZKSU 1TMTH 4BAQB 4WWYA 4WMEA 3SQEE 2DUCA 1IQMA 1O38A 5JBAS 2QXIA 4WXIA 1MZAA 4TY7A 1L1GA 3LT3A 4MPXA 3VB5A 1DY9A 1QQ4A 1QIXB 3RXUA 1DS2E 1LPGB 2C4FH 4UDWH 4DJZB 3MH5A 1CGHA 1C1PA 2JH0D 2BMGB 5FX6A 1LMWB 2VNTA 1FY1A 3V13A 6CHAC 1G9IE 3RXFA 1O3LA 3ITIA 4RKOB 4BXWA 1K1JA 1O3KA 1LHEH 1A5HA 1KDQB 2D8WA 2HRVA 5C5NA 2M5TA 4NIWA 1SGDE 1E0FD 1Z8JB 3A7WA 5L30H 1S81A 2W7SA 2HVXA 1IQLA 4K60A 2R3UA 1JRTA 3UQVA 1OX1A 3JZ2B 1Z8RA 3LU9B 5AFZH 4FUIA 2P95A 1C5ZB 2ZGXH 1JRSA 4OS2A 5B6OA 4X2YA 4BTTB 1MTVA 2BHGA 1DWCH 1S0QA 2UUFB 3UTUH 2PGBB 1GHBF 1O2KA 1TYNA 3BTME 3QN7A 2GTBA 3A7TA 4D76A 4MDSA 2W5EA 4X6OA 3A7ZA 1JMOH 1GBFA 3B23B 1DT2A 1NRSH 1TNLA 1DWBH 1SHYA 1EJMA 5LPRA 2QXHA 5JPMH 3SNCA 1GJCB 2AGGX 4DG4A 4ZHAA 1B5GH 4GAWA 1F5LA 1HNEE 4FUGA 1RJXB 2A2XH 3M61U 2G4UA 1CBWC 2BB4A 1NN6A 5FBIA 3RXIA 1PPZA 4K69A 3UWIA 1CHGA 3FZZA 1C5QA 4KP0A 1YPLH 5L2YH 1THSH 2QYIA 3RXQA 4CBNA 5A8ZA 4JZ1A 1UK4A 2TIOA 3ZVAA 4I8LA 3EA8A 1AD8H 1P2MA 3E16B 3RXJA 1AFQB 1W0YH 4WJG2 1RXPA 1EJAA 2QGRA 3OSYA 3ATIA 3SU5A 1S83A 4E06H 1TWXB 2FOAA 3SU6A 1MKXH 1AVGH 2YNBA 5G4BA 5JBCS 1UTNA 1Z6EA 1V2RT 2F83A 1GHWH 1MTNB 2ZIQH 4J1YA 1Z8IB 4X6NA 2G4TA 2RG3A 4AFSA 3E0NB 1O5AB 1OYQA 1E37B 1P03A 2A45B 3FFGA 4BNRA 3MMGA 2WUCA 3P8GA 2VGCB 5EW1H 3KCGH 1O3NA 1CT0E 4ISIH 4JZEH 1A1RA 4NWLA 5GIBA 1AVXA 3OY6U 3LDXH 2SGAA 1G2LA 2TPIZ 1O2MA 1P3EA 1QQUA 1QURH 1T31A 1YCPK 5A8YA 3RU4E 1GHAG 4CH2B 2ESTE 1BQYA 1ACBE 1PQAA 2HLCA 4X1QU 4BTIB 1FQ3A 3E6PH 3IITA 2ULLA 1PYTD 4DURA 1P2JA 1DUAA 3GY8A 3VEQB 1C2EA 3VXEH 1YKTA 1ZZZA 3C1KA 1KLTA 3S9AA 2GZ7A 1BHXF 2FLBH 3SN8A 2FLRH 1B0FA 2PW8H 3FZDA 1U6QA 1YYY1 3E8LA 1MQ5A 1ELAA 2ZTYA 1SLUB 3K2UA 1EP5A 1EXFA 2BYAX 2A4OA 2YOLA 3T28A 1WYKA 3HK6B 1XMNB 4DT7B 2Y7ZA 3RMOH 3RXTA 1P2QA 4CRAA 2Y5FA 1N8OB 1O2VA 2GT8A 3LJJA 3ZZ7A 2Q6GA 4JZIA 2GGVB 7KMEH 1K1NA 1BHXB 4MPWA 1GCTB 1WQSA 1QA7A 2R3YA 4GUXA 3AW0A 2Z9LA 5LGOA 2FXRA 4XOJA 1K1OA 3BTHE 2BD2A 2BXUH 2NU2E 2EI8A 3S0NA 4UFEH 4YT7H 3QWCH 2BDIA 2G51A 1GBAA 2A4QA 1C4U2 4HGCA 2AERH 3NXPA 2OCVB 3ATKA 4K1EA 1Y5UT 1O3AA 5A8XA 5EGMA 4ABJA 1YPMH 4RKJB 1SGQE 2WUBA 3NK8A 1MTSA 3AAUA 1MUEB 1ETRH 2ZHQH 3PMHB 2WINI 5DP6A 1FN8A 1GGDC 2OQUA 1NESE 1DY8A 3I78A 1C9TA 1UK2A 2AH4X 1GBEA 3E1XB 5EQSA 1O39A 2C90B 1XVMA 1DITH 3BEIB 1QCPA 4HZHA 1KXDA 5EPYA 2FX6A 3D65E 3T29A 2OD3B 2C8WB 1HCGA 1VJAU 2XBXA 1BOQA 1O0DH 1TIOA 1OWJA 1BB0B 2ZHWH 1TX8A 3H5CB 1CA0C 4GCHG 1GJDB 1C2LA 3GCHB 4ESTE 3QUMP 5EPNA 3M35A 1PFXC 2VWMA 2J34A 1K21H 1GBBA 5E2OA 2GVFA 2ZGBH 4XBCA 1EATA 2ZTZA 1BA8B 3SV9A 1TNGA 1O3FA 4NA8A 1C1NA 1T8OA 3HKIB 1XXFA 1GVLA 4ASHA 5ABWA 1ZSKA 1MCTA 2VIVA 1HPGA 3TIUA 3ZZCA 3U8TH 1Y3UA 1SI5H 1TMUH 4AGJA 3MH6A 4K8YA 1GHAF 1O5DH 1EPTB 1ABJH 3OYPA 2BD7A 3A8BA 2F9OA 1V2QT 3BTKE 2SNVA 3M3TA 2TGAA 3D49H 2P8OC 3F9FA 2A1DB 2Y81A 3KNXA 1P01A 1O2RA 1K1MA 1C1UH 3ZZBA 3M36A 4GVUA 1ZPZA 1P09A 3O8BA 4NZQA 1UTLM 1UVOA 1GG6C 1J8AA 1C5OH 1LKAA 1AY6H 5HMAA 3UNRA 2G5VA 4UD9H 1QJ1B 4NGAH 4K2YA 5LPFA 1ZSJA 1O5FH 1V2MT 3ZVEA 1SR5C 3HGNA 4AFZA 5AF9H 1TNKA 1ZJDA 4OS7A 5F8XA 3ZVCA 1WOFA 1YPHC 1D6RA 4ABFA 3SNEA 1TBQH 1TPPA 2ZO3H 5ESBA 7ESTE 2ZU2A 1AN1E 1GJ7B 1DVAH 4TY6A 4WXVA 4WY3A 1NO9H 4INLA 3NPSA 1O32A 4Y7BA 1C5YB 3F9GA 1GJ5H 1NT1A 1TOCB 2GCHF 2XCFA 1OP2A 2FOBA 5EODA 1C2IA 1GI5A 1O30A 1C1OA 3MH7A 1HJ8A 3RXMA 3MNXA 3UOUA 1O2GH 3A82A 5HM9A 3UR9A 1O35A 1EUFA 2UUKB 2AGIX 1ANDA 3I77A 4I33A 3UNSA 2BQ7B 4K1TA 4YOIA 1DWDH 3KF2A 2Z3DA 1NRPH 2RCEA 2SFAA 2ZGJA 1BTYA 1SC8U 3RXRA 1X7AC 2XRCA 2W26A 1TONA 1S84A 2VH6A 3VPKA 3ZZ8A 4CR5A 4A6LA 1FV9A 3RXAA 1RS0A 2BVSH 2B8OH 1EAWA 2HNTF 1W14U 2R0KA 2A4GA 1TBRH 1ELEE 3SV8A 4LZ4B 1IQFA 2HPQH 2PSXA 2J92A 2J9NA 1IQEA 2FOMB 2PUXB 3ZV8A 1TA6A 3P8OA 1SG8B 1GMHF 1ORFA 2BLVA 5C1YA 1CVWH 3BTDE 2F9VA 4I8HA 1G3EA 1O2TA 1ABIH 1WCZA 1EQ9A 3S9BA 1GBMA 1LQEA 4YOGA 2NWNA 4JMYA 1H8IH 3RXEA 2CXVA 1CA8B 4Y6DA 3GY5A 1XUIA 5JYIA 2GT7A 2THFB 2JETB 1TBZH 5FCRA 1BUIA 4JYTA 1HV7A 3SNBA 5HXFA 2XYAA 1YLDA 1SBWA 2GP9B 1SGNE 4LOYH 2R2WU 4AYYB 3TK6A 2FMJA 1SB1H 4AB8A 3BTWE 1JBUH 4D7GA 1C5LH 1FY8E 2GV7A 1FY5A 2BX3A 3TITA 1XXDA 2NU1E 2F9UA 1DE7H 2ZHEH 3KQCA 2P94A 3T2NA 2ZDKA 4KKDA 4Z6AH 1V2KT 1J17T 3RC6A 1KXCA 4B71A