1SMPI

Crystal structure of a complex between serratia marcescens metallo-protease and an inhibitor from erwinia chrysanthemi
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
100
structure length
100
Chain Sequence
b'SSLRLPSAAELSGQWVLSGAEQHCDIRLNTDVLDGTTWKLAGDTACLQKLLPEAPVGWRPTPDGLTLTQADGSAVAFFSRNRDRYEHKLVDGSVRTLKKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERRATIA METALLO PROTEINASE
publication title Crystal structure of a complex between Serratia marcescens metallo-protease and an inhibitor from Erwinia chrysanthemi.
pubmed doi rcsb
source organism Serratia marcescens
molecule tags Complex (metalloprotease/inhibitor)
total genus 22
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 1995-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF02974 Inh Protease inhibitor Inh
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.10 Mainly Beta Beta Barrel Lipocalin Lipocalin 1smpI00
1SMPI 2X8SA 4KC8A 4KC7A 2X8TA 4KCAA 1JIWI 4COTA 2RN4A 3LV4A 2X8FA
chains in the Genus database with same CATH superfamily
1AELA 1YP7A 5CE4A 1A57A 3UEWA 3FA7A 3FR5A 4OMWA 1E5PA 4YKMA 3NR3A 4AZPA 1SWBA 3P6EA 1MDCA 3NQKA 1ZNGA 4BX7A 2AF5A 2CBRA 4TKHA 5AQ6A 4ZCBA 2X8FA 4Z28A 1N9MA 2XSTA 2X8SA 4I60A 1NQMA 4U3QA 1YUPA 1BSOA 1TVQA 2OFRX 2QO5A 3FEPA 4ORRA 5HCEC 2X45A 1OBPA 4IMOA 1LCWA 4N7CA 1B4MA 3EBKA 2MJIA 4FBOA 1IKJA 2KTSA 2E4JA 1ZNKA 4KCAA 1VWLB 3VG6A 4NV7A 3TF6A 3WVMA 2A2UA 5C0NA 5HZ8A 1SRJA 5CHKA 3FEKA 4IB7A 1EQDA 4CPFA 4EQAC 4Y0QA 1QQSA 4ARHA 1N43A 1X71A 1YWAA 3E3CA 4PJ2A 2AKQA 4MVKA 4PSQA 3C76X 4U46A 2DJGA 4KT5A 4NYRA 1H91A 1SA8A 3SZHA 1FENA 4O49A 4CK4A 3FW5A 5EDCA 3OD9A 1LPJA 1YWBA 3MM0A 3WJDA 1OEKA 1A18A 2ACPX 3FYFA 3P24A 2AH7X 1ACDA 3ZW0B 4TKBA 2BS5A 2IZDB 2WEXA 3P6DA 2OFMX 3PQSA 2R56A 2BSZA 1HMTA 3PDFA 4JNJA 1DV9A 4BX5B 5D48A 3STKA 1RXJA 5L8OA 2RCQA 3QKGA 1PM1X 5JD2A 1JMXA 1NP4A 3HPEA 4ZGUA 4TQ2A 1VWCB 4NLJA 4NNTA 3T6FA 1JQPA 2A0AA 1SWSA 1GX9A 2Q39A 4QZUA 3NQ3A 2M4LA 4IB8A 5CSEA 2OY7A 4WBKA 4M7MA 5LJDA 5HCDC 4ZHGA 4CPEA 3STNA 3P02A 1HXLA 1KZXA 1TW4A 1IW2A 4ES7A 1VWIB 2WWPA 3BS2A 1VWQB 2LBAA 1SLDB 2A13A 3FA9A 1SWLA 4OKAA 4CDEA 1KQWA 5LKEA 1DF3A 1SWQA 3KFHA 4CSBA 1EIIA 2OF9A 2JN3A 3CBCA 2DJFA 4OS8A 2W2AA 4YFPA 2GTLM 1ERBA 4BVMA 3KFGA 3VE2A 1JJJA 4D6AA 1HY2A 2QO6A 3FR4A 4UU2A 2CM4A 1EPAA 4LKTA 5EZ2A 2FS7A 2A5CA 1I4UA 3VG7A 1PMPA 2Q2MA 2MF6A 3ZW2A 4Z27A 1VWOB 1TOUA 4YVBA 5F58A 1FTPA 4U9CA 1ICNA 3AEHA 2KD2A 1HMRA 3O19A 1S7DA 2X34A 1CBQA 2OY8A 1SRHA 1O8VA 4CDCA 1EW3A 1HN2A 5HBSA 1T68X 4AZQA 4O3XB 4DCBA 1GT4A 2PI3O 2RTMA 5HZ9A 2FKJA 1IIUA 5IO6A 5LJBA 4YMYA 1BRQA 3D95A 1VYFA 1YIVA 1LIFA 3RE5A 3HTYA 2IZIA 2WQAE 1QABE 3KFIA 3WYQA 3RDMA 1QFTA 1LIEA 4QRLA 5BYPA 2FTBA 1VYGA 1PTSA 3F8AA 1DF8A 1SY2A 3BDRA 4IRWA 1B56A 1ICMA 1ALBA 3ZW1B 3NADA 2Y32A 4ZHDA 2IZJA 3MBTA 5EDBA 1CBRA 3VG5A 1NBXA 1VWMB 4N7DA 4CDDA 3RDSA 4O4XA 2Q2PA 3FA6A 5FAZA 1RXHA 3WJGA 1A3YA 2PY1A 5KICA 2L68A 3SLJA 4YH0A 5D47A 1GKAB 3P6FA 3JSQA 1EUOA 3HOEA 4IAXA 1NC9A 5FFHA 3HWEA 1SXYA 2G78A 2RTQB 1GT1A 1KL3A 2OL8O 4Y59A 4YGGA 4YBPA 3U0DA 1EIOA 1GX3A 3VE1A 5B10O 2CZTA 1OBUA 2NP1A 2QCBA 1KT4A 3AKNA 4ZFXA 3EW1A 3C77X 4KC7A 2MM3A 4LQZA 1GT5A 1VWFB 1Y9LA 4K19A 1SWFA 1ZNDA 4U8UM 4DQ4A 5HTDA 1AB0A 2IZBA 2X32A 2FWVA 3VGWA 4NW4A 2RTBB 4ORYA 3HWDA 4IB9A 1FDQA 1TOWA 2G79A 2W2BA 1UYNX 1Y52X 1LCVA 3FIDA 3WYPA 4NNSA 2BLGA 4BGFA 4YBUA 1AVGI 2RTGB 4GJVA 5D4AA 1X8QA 2RTNB 5L8NA 5FENA 1X8OA 3CBSA 1SWGA 1VWBB 2HZRA 4GE1A 5EPQA 3SLTA 4O3YA 1STPA 1KT6A 3NX1A 5H8TA 5B29A 3B2IA 5K67A 1VPRA 1JBHA 4CPHA 3FLLA 3SZIA 3LHNA 1STRB 2ASNX 5EEDA 5FQ6E 3BU1A 2IZCB 4C5PA 4QNIA 2CAMA 1VWDB 3FENA 2AL0X 3RZYA 3SZJA 2OYBO 2O62A 4YDBA 2RTFB 1KXOA 2QO4A 2RTJA 5LJGA 3VHMA 5HCCC 3PP6A 1GT3A 2F01A 2FHLA 1G5WA 4IB6A 1LNMA 1SWNA 3UEXA 2L9CA 2VDFA 2EU7X 5B3MO 1EI5A 3LTWA 1U18A 2ALLX 1HBQA 3FA8A 1ERXA 1U17A 1PEEA 4GGZA 3WBGA 3K3LA 4BOEA 4LZUA 2GTLN 3S26A 2FRSA 1MX7A 2IZEB 3WXQA 4BX7B 3PPTA 1JYJA 1MUPA 1SWOA 1VWEB 1SRFA 3U9PC 2Z4IA 4QYPA 4WFUA 4MVIA 5B5GA 4TLJA 4Z2OA 1R0UA 2ZAIA 4GZVA 1JV4A 3FELA 3FR2A 3ELXA 1SWRA 3VG4A 4YGHA 1MEPA 3CKFA 1W6FA 1AVDA 2G8CO 2Q9SA 3PECA 1UYOX 5LJCA 1SWJA 1LIDA 1G7NA 1ML7A 2GC9A 2RTIB 5L8IA 3C78X 2FR3A 5H9LA 1CBIA 1X8PA 1I04A 3KZAA 3RY2A 1I05A 4O3ZA 3OE3A 2QM9A 4ORUA 1LICA 4A60A 4BX6A 1RAVA 2OL6O 3S5VA 2IZLB 4O4UA 4TNNA 4ALOA 2CZUA 1MOYA 1QY1A 2OY1O 3NPOA 1N0SA 2A3FX 3BU9A 1NQNA 3WZNA 4EXZA 3PH6A 5DG4A 2HYSA 1LELA 1EALA 4HPAA 4QGWA 5AJCA 1MM9A 2NNDA 2W2FA 1HMSA 5F1EA 4HPCA 5K06A 4MVLA 4O4OA 4I3CA 5F6ZA 2AVIA 3NX2A 3RE6A 3DTQA 1HXZA 1LUQA 2RTLA 1KT3A 4ORXA 4BJ8A 1KT5A 4CV7A 4MIRA 5H9KA 1OPBA 4GGTA 2RTPB 4IABA 5LJHA 2K62A 4Y5DA 2GH7A 4QYNA 3WZOA 3TZSA 5AJBA 1KQXA 1X8NA 3BRNA 1S44A 4ID2A 1DC9A 3APWA 1K3BA 4I9SA 4YKOA 5IO5A 1GM6A 3RSWA 1N7YA 1BBPA 1QY2A 1SLGB 4QAEA 2LFOA 4JGLA 2I5VO 3RKGA 4AW8A 4WHIA 4LZVA 3KQ0A 3IFBA 5HZ6A 2IFBA 2Y3FA 3UAQA 1JYDA 5JR8A 2OFAA 3HWGA 2RTKA 3CQRA 3PEDA 3WZQA 1N9YA 4GK9A 1AQBA 4CDFA 5HZ5A 4ZGFA 3D97A 4R0BA 1JZUA 4O9SA 3SAOA 5AEOA 2FLJA 3VHHA 4OS3A 5F6BA 4A1HA 4ODDA 1Y0GA 1ZNHA 3BX8A 3MG5A 2BC3A 1DFVA 3O22A 4FGIB 4FQBB 3KFFA 4JO6A 4OELA 1JMZA 1S2PA 2JU7A 3WOVA 4EKVA 4GH7A 1YP6A 4KC8A 2JMBA 4INNA 5IRAA 4WFVA 4XMGA 4XMEA 1I06A 5HTEA 3DSZA 4YCEA 3O2YA 3TGAA 1B8EA 3RWXA 2X4MA 4HWMA 3LV4A 1OEJA 1KGLA 5LJKA 2QOMA 1DZMA 1SXUA 1WBIA 1JIWI 1W4TA 1EXSA 2A5BA 4GD9A 1VWRB 3WZPA 2MHDA 1U0XA 4RUUA 1X8UA 3APUA 5L3YA 1DZJA 4L3RA 2DM5A 3NQ9A 4ZHCA 1UZ2X 1XKIA 3MVFA 4I3BA 3RBYA 2OVAA 2BS6A 2ZAGA 4GETA 1MX8A 4HPDA 1W5RA 4IAWA 4D6BA 1LFOA 2X55A 2Z4HA 4ZR2A 4DNEA 1E06A 1O1UA 2QOSC 4NLIA 1BM5A 1RLBE 4ZH6A 4AZMA 2HLVA 1STSB 2OVEA 4Y0SA 4YDAA 3AKMA 3EMMA 4GDZA 2HKDA 2C1QA 2AT6X 1VWNB 4O4SA 3T6LA 3CR6A 1AVEA 4ZJ0A 1G85A 4BBOA 5CYBA 1IFCA 1SY0A 2FGSA 2BHVA 4CPIA 3B2KA 5F2BA 2WPUA 1UREA 4KH8A 4YGZA 3PH5A 4ZH9A 4QQ1A 1NGLA 4I9RA 5IXGA 3PK2A 3S60A 1OBQA 1ZNEA 3CQNA 1E2TA 1DZKA 1SWEA 1LDQA 1SXWA 3NP1A 3P6CA 1CBSA 3RDOA 3QQ2A 1T8VA 4Z6JA 1SMPI 2VFBA 3N91A 1IFBA 4MVEA 5H9NA 1IJ8A 3WJBA 3NBXX 3SLOA 4A8ZA 1KZWA 1SWAA 4BQUA 5B27A 1VWJB 3ZI8A 2OF8A 4YFRA 3ZW0A 3BY0A 1SWKA 1BRPA 1OEEA 3BSZE 3VG2A 1Y55X 1SXXA 3D96A 2A2GA 1FEMA 1VWGB 1Y9TA 4Y0PA 3ZZVA 2P8GA 3WJCA 4BX5A 2YG2A 2C1SA 4L1NA 5IRWA 2LKKA 3P6GA 1VWKB 3WJFA 1KOIA 3PQUA 3JQOA 4MISA 4ON1A 4CPHB 4GU8A 3F6ZB 3GE2A 1SRIA 4JHQA 2FS6A 3SOTA 4Z2PA 5IO7A 1BEBA 2AT0X 1SY1A 2GTLO 2FHNX 3B2HA 3EYCA 3ZQ3A 2L67A 4AYHA 1QFVA 1LDOA 1EPBA 2HMBA 3X00A 1BSYA 2RTRB 1D2UA 3EBWA 2RTDB 3EM0A 1FJ1E 4AZRA 2IZAA 4QZTA 4GNYA 1QY0A 3FIQA 3D9WA 2RA6A 4ZHHA 5B2AO 1SWUA 1A2DA 2IZKA 2X56A 3T2WA 4BCSA 1ADLA 1SWPA 2HZQA 4GJSA 4NP1A 2L5PA 3F9DA 2WQ9A 3TGBA 3U03A 2GTFX 2NNEA 2Q4NA 2OFBA 2RTOB 3B2JA 1K24A 3CKGA 2MO5A 2FT9A 2G7BA 2NNQA 4ZHFA 2IZFB 2Y3EA 1N4JA 3JS1A 5FQ8E 4XMHA 1SWDA 1WUBA 1Y53X 4AZOA 4FBRA 1XCAA 2MWHA 2R74A 1SREA 4MEEA 2RTAA 2JU8A 2RTEB 4GUZA 4Y0RA 2JU3A 1BSQA 2JGSA 2OL7A 3HWFA 4OMXA 2FR2A 1GXAA 2BT9A 3AUMO 1OSPO 5D8JA 1I9HA 3GAQA 1VWAB 4HFOA 3L4RA 2UZ2A 2ZSCA 4GGRA 4QGVA 3MX7A 1MK5A 4LKPA 5B11O 5KIDA 1TXLA 1NP1A 4EEJA 3VG3A 1QWDA 1VWHB 2AT5X 2CBSA 1RBPA 3BLGA 4ML7B 4XMCA 1P6PA 5FQ7E 1JJXA 1Z24A 3CWKA 1SWTA 2OY5O 1IKEA 1KL5A 2AT8X 5HZQA 1SWHA 2GJ5A 2RTCB 2WEWA 4AZNA 3V8UA 4BX6B 1I78A 4B55A 1T0VA 1D3SA 4U8UN 1YWDA 2XKLA 4I3DA 1KL4A 3ZW1A 4GKCA 4Z2VA 2JOZA 4A1YA 3OBLA 4NYQA 1BJ7A 2G5LA 2OVSA 4I6SA 1KT7A 2QMIA 1B0OA 4ALBA 3T1DA 5HAEA 3UEVA 2RN4A 2LB6A 3I17A 1GKAA 3APXA 1ZRYA 1SWCA 4U8UO 4EDEA 4I95A 5B5FA 2IZHB 2AMMX 5EEEA 3STMX 2OZQA 3CMPA 3VPJE 4COTA 1SLFB 3HK1A 1PBYA 1RSTB 2X46A 1DZPA 2C4IA 1MVGA 3BX7A 3IA8A 4IMNA 5DPQA 4NV8A 3ZUOA 3FW4A 2A8GA 3WJEA 3S5XA 4OS0A 5BVSA 4TKJA 4IBAA 5BVQA 3VU1A 1L6MA 1LF7A 4XMDA 2YMSA 5BVTA 1LKEA 4KIIA 4XMFA 1LCZA 1FELA 3G7XA 3RY1A 3T2XA 3EW2A 1LIBA 5H9AA 3EC5A 3H3IA 2KW1A 5IRUA 3VHIA 4HPBA 1O1VA 4ORSA 5D45A 3HOLA 3ELZA 1E02A 2RD7C 3D4RA 3P6HA 4RUNA 2ACOA 2RTHB 2K23A 1VYOA 3Q34A 4QGXA 1SY3A 1OPAA 3FMZA 1SRGA 2R73A 2UYWA 2ANSA 2WSJA 1X89A 2LBVA 3Q6LA 1CRBA 2LA7A 3FDCA 4ORWA 1HBPA 2X8TA 3KVNA 5F7GA 1G74A 2FKGA 4YFQA 1CJ5A 3ZUIA 1E00A 1RXKA 3APVA 2CM9A 1KFFA 2HNXA 4UU3A 1BWYA 2IZGB 2JW1A 2KTDA 1JJUA 2RCTA 4FBVA 5HA1A 5LKFA 1BLRA 3OJYC 4TJZA 3RDQA 2WUTA 2KT4B 2POAA 2VFCA 2WR6A 3UEUA 4DQ3A 2F73A 3B2LA 1HQQA 4YCHA 4GNWA 5KHPA 5LJEA 1QG5A 4OEMA 3RDUA 3I0AA 1HQPA 1ZNLA 5HA0A 4O3WA 3RDXA 1SLEB 3TGCA 4GDAA 3ZWEA 2F09A 2AT3X 5HWZA 1FE3A 5K68A 1PBOA 1GX8A 2N93A 1YWCA 4GRJA 2RQ0A 2OVDA 4M6SA 1GGLA 4EFGA 1RSUB 2I5ZO 1VWPB 1NDJA
chains in the Genus database with same CATH topology
1AELA 1YP7A 5CE4A 1A57A 3UEWA 3FA7A 3FR5A 4OMWA 1E5PA 4YKMA 3NR3A 4AZPA 3P6EA 1MDCA 3NQKA 1ZNGA 2CBRA 4TKHA 5AQ6A 4ZCBA 2X8FA 2XSTA 2X8SA 4U3QA 1YUPA 1BSOA 1TVQA 2OFRX 2QO5A 3FEPA 4ORRA 5HCEC 2X45A 1OBPA 4IMOA 4N7CA 1B4MA 3EBKA 2MJIA 4FBOA 1IKJA 2KTSA 2E4JA 1ZNKA 4KCAA 3VG6A 3TF6A 3WVMA 5C0NA 2A2UA 5HZ8A 3FEKA 4IB7A 1EQDA 4EQAC 4Y0QA 1QQSA 4ARHA 1X71A 1YWAA 3E3CA 4PJ2A 2AKQA 4MVKA 4PSQA 3C76X 4KT5A 4NYRA 1H91A 1SA8A 1FENA 4O49A 4CK4A 3FW5A 5EDCA 3OD9A 1LPJA 1YWBA 3WJDA 1OEKA 1A18A 2ACPX 3FYFA 3P24A 2AH7X 1ACDA 3ZW0B 4TKBA 2BS5A 2WEXA 3P6DA 2OFMX 3PQSA 2R56A 1HMTA 1DV9A 5D48A 3STKA 5L8OA 2RCQA 3QKGA 1PM1X 1NP4A 4ZGUA 4TQ2A 4NLJA 4NNTA 2A0AA 1GX9A 2Q39A 4QZUA 3NQ3A 2M4LA 4IB8A 4WBKA 4M7MA 5LJDA 5HCDC 4ZHGA 3STNA 3P02A 1KZXA 1TW4A 1IW2A 4ES7A 2WWPA 3BS2A 2LBAA 3FA9A 2A13A 1KQWA 5LKEA 1DF3A 3KFHA 4CSBA 1EIIA 3CBCA 2JN3A 4OS8A 4YFPA 4BVMA 2W2AA 2GTLM 1ERBA 3KFGA 3VE2A 1JJJA 4D6AA 2QO6A 3FR4A 4UU2A 2CM4A 1EPAA 4LKTA 5EZ2A 2FS7A 1I4UA 3VG7A 1PMPA 2Q2MA 3ZW2A 1TOUA 5F58A 1FTPA 4U9CA 1ICNA 2KD2A 1HMRA 3O19A 1S7DA 1CBQA 1O8VA 1EW3A 1HN2A 5HBSA 1T68X 4AZQA 4O3XB 1GT4A 5HZ9A 1IIUA 5IO6A 5LJBA 4YMYA 1BRQA 3D95A 1VYFA 1YIVA 1LIFA 3HTYA 2WQAE 1QABE 3KFIA 1QFTA 1LIEA 4QRLA 5BYPA 2FTBA 1VYGA 3F8AA 1SY2A 3BDRA 1B56A 1ICMA 1ALBA 3ZW1B 3NADA 4ZHDA 3MBTA 5EDBA 1CBRA 3VG5A 4N7DA 4O4XA 2Q2PA 3FA6A 5FAZA 3WJGA 1A3YA 2PY1A 5KICA 2L68A 4YH0A 5D47A 1GKAB 3P6FA 3JSQA 1EUOA 3HOEA 4IAXA 5FFHA 3HWEA 1SXYA 2G78A 4YGGA 1GT1A 4YBPA 1EIOA 3U0DA 3VE1A 2CZTA 1OBUA 2NP1A 1KT4A 3AKNA 4ZFXA 3C77X 4KC7A 2MM3A 4LQZA 1GT5A 1Y9LA 4K19A 1ZNDA 4U8UM 4DQ4A 5HTDA 1AB0A 2FWVA 4NW4A 4ORYA 3HWDA 4IB9A 1FDQA 1TOWA 2G79A 2W2BA 4NNSA 2BLGA 5L8NA 4YBUA 1AVGI 5D4AA 1X8QA 5FENA 1X8OA 3CBSA 2HZRA 4GE1A 5EPQA 4O3YA 1KT6A 3NX1A 5H8TA 5B29A 3B2IA 1VPRA 1JBHA 3FLLA 3LHNA 2ASNX 5EEDA 5FQ6E 3BU1A 4QNIA 3FENA 2AL0X 3RZYA 2O62A 4YDBA 5LJGA 1KXOA 2QO4A 5HCCC 3PP6A 1GT3A 1G5WA 4IB6A 1LNMA 3UEXA 2L9CA 2EU7X 1EI5A 1U18A 2ALLX 1HBQA 3FA8A 1ERXA 1U17A 1PEEA 3WBGA 3K3LA 4BOEA 4LZUA 2GTLN 3S26A 2FRSA 1MX7A 3WXQA 3PPTA 1JYJA 1MUPA 5BVTA 3U9PC 2Z4IA 4QYPA 4WFUA 4MVIA 4TLJA 1R0UA 2ZAIA 4GZVA 1JV4A 3FELA 3FR2A 3ELXA 3VG4A 4YGHA 2Q9SA 3PECA 5LJCA 1LIDA 1ML7A 1G7NA 5L8IA 2GC9A 3C78X 2FR3A 5H9LA 1CBIA 1X8PA 1I04A 3KZAA 1I05A 4O3ZA 3OE3A 2QM9A 4ORUA 1LICA 4A60A 3S5VA 4ALOA 4O4UA 4TNNA 2CZUA 1QY1A 3NPOA 1N0SA 2A3FX 3BU9A 4EXZA 3PH6A 5DG4A 2HYSA 1EALA 4HPAA 4QGWA 5AJCA 2NNDA 2W2FA 1HMSA 5F1EA 4HPCA 5K06A 4MVLA 4O4OA 4I3CA 5F6ZA 3NX2A 3DTQA 1KT3A 4ORXA 1KT5A 4CV7A 4MIRA 5H9KA 1OPBA 4IABA 5LJHA 2K62A 4QYNA 3TZSA 5AJBA 1KQXA 1X8NA 3BRNA 1S44A 4ID2A 1DC9A 3APWA 4I9SA 5IO5A 4YKOA 1GM6A 3RSWA 1BBPA 1QY2A 4QAEA 2LFOA 4JGLA 3RKGA 4AW8A 4WHIA 4LZVA 3KQ0A 3IFBA 5HZ6A 2IFBA 3UAQA 1JYDA 5JR8A 3HWGA 3CQRA 3PEDA 4GK9A 1AQBA 4ZGFA 3D97A 4R0BA 1JZUA 4O9SA 3SAOA 5AEOA 2FLJA 4OS3A 5F6BA 4A1HA 4ODDA 1ZNHA 3BX8A 3O22A 4FGIB 1DFVA 4FQBB 5F7GA 5HZ5A 3KFFA 1S2PA 2JU7A 3WOVA 4GH7A 1YP6A 4KC8A 2JMBA 4INNA 4WFVA 4XMGA 4XMEA 1I06A 5HTEA 3DSZA 4YCEA 3O2YA 3TGAA 1B8EA 3RWXA 4HWMA 1KGLA 3LV4A 1OEJA 5LJKA 1DZMA 1SXUA 1JIWI 1EXSA 2MHDA 1U0XA 4RUUA 1X8UA 3APUA 1DZJA 4L3RA 2DM5A 3NQ9A 4ZHCA 1UZ2X 1XKIA 3MVFA 4I3BA 3RBYA 2OVAA 2BS6A 2ZAGA 4GETA 1MX8A 4IAWA 4D6BA 1LFOA 4ZR2A 2Z4HA 1E06A 1O1UA 2QOSC 4NLIA 1BM5A 1RLBE 4ZH6A 4AZMA 2HLVA 2OVEA 4Y0SA 4YDAA 3AKMA 3EMMA 4GDZA 2AT6X 4O4SA 3CR6A 4ZJ0A 1G85A 5CYBA 1IFCA 1SY0A 2BHVA 3B2KA 1UREA 4KH8A 4YGZA 3PH5A 4ZH9A 4QQ1A 1NGLA 4I9RA 3S60A 1OBQA 1ZNEA 3CQNA 1DZKA 1SXWA 3NP1A 3P6CA 1CBSA 1T8VA 1SMPI 3N91A 1IFBA 4MVEA 5H9NA 1KZWA 3WJBA 3NBXX 4A8ZA 4BQUA 5B27A 3ZI8A 4YFRA 3ZW0A 3BY0A 3VG2A 1BRPA 1OEEA 3BSZE 3ZZVA 1SXXA 3D96A 2A2GA 1FEMA 4Y0PA 1Y9TA 2P8GA 3WJCA 2YG2A 4L1NA 2LKKA 3P6GA 3WJFA 1KOIA 3PQUA 3JQOA 4MISA 4ON1A 4GU8A 3F6ZB 3GE2A 3SOTA 5IO7A 2FS6A 1BEBA 2AT0X 1SY1A 2GTLO 3B2HA 3EYCA 3ZQ3A 4AYHA 2L67A 1QFVA 2HMBA 1EPBA 1BSYA 1D2UA 3EBWA 3EM0A 4AZRA 4QZTA 4GNYA 1QY0A 3FIQA 2RA6A 4ZHHA 1A2DA 1ADLA 2HZQA 4NP1A 2L5PA 3F9DA 2WQ9A 3TGBA 3U03A 2GTFX 2NNEA 2Q4NA 3B2JA 4ZHFA 2MO5A 2FT9A 2G7BA 2NNQA 3JS1A 5FQ8E 4XMHA 4AZOA 4FBRA 1XCAA 2MWHA 2R74A 2JU8A 4Y0RA 2JU3A 1BSQA 3HWFA 4OMXA 2FR2A 1GXAA 2BT9A 5D8JA 3GAQA 4HFOA 3L4RA 4QGVA 5KIDA 3MX7A 4LKPA 1TXLA 1NP1A 4EEJA 3VG3A 1QWDA 2AT5X 2CBSA 1RBPA 3BLGA 4ML7B 4XMCA 1P6PA 5FQ7E 1JJXA 1Z24A 3CWKA 1IKEA 2AT8X 5HZQA 2GJ5A 4AZNA 2WEWA 3V8UA 1T0VA 1D3SA 4U8UN 1YWDA 2XKLA 4I3DA 3ZW1A 4GKCA 2JOZA 4A1YA 3OBLA 4NYQA 1BJ7A 2OVSA 4I6SA 1KT7A 2QMIA 1B0OA 4ALBA 3T1DA 5HAEA 3UEVA 2RN4A 2LB6A 3I17A 1GKAA 3APXA 1ZRYA 4U8UO 4EDEA 4I95A 2AMMX 5EEEA 3STMX 2OZQA 3CMPA 3VPJE 4COTA 3HK1A 2X46A 1DZPA 1MVGA 3BX7A 3IA8A 4IMNA 5DPQA 3ZUOA 3FW4A 3WJEA 3S5XA 4OS0A 5BVSA 4TKJA 4IBAA 5BVQA 3VU1A 1L6MA 1LF7A 4XMDA 2YMSA 1LKEA 4KIIA 4XMFA 1FELA 3G7XA 1LIBA 5H9AA 3H3IA 2KW1A 4HPBA 1O1VA 4ORSA 5D45A 3HOLA 3ELZA 1E02A 2RD7C 3D4RA 3P6HA 4RUNA 2ACOA 2K23A 4QGXA 1SY3A 1OPAA 3FMZA 2R73A 2ANSA 2WSJA 1X89A 2LBVA 3Q6LA 1CRBA 2LA7A 4ORWA 1HBPA 2X8TA 1G74A 4YFQA 1CJ5A 3ZUIA 1E00A 3APVA 2CM9A 2HNXA 4UU3A 1BWYA 2KTDA 2JW1A 5HA1A 2RCTA 4FBVA 5LKFA 1BLRA 3OJYC 4TJZA 2WUTA 2KT4B 2POAA 2WR6A 3UEUA 4DQ3A 2F73A 3B2LA 4YCHA 4GNWA 5KHPA 5LJEA 1QG5A 3I0AA 1HQPA 1ZNLA 5HA0A 4O3WA 3TGCA 3ZWEA 2F09A 2AT3X 5HWZA 1FE3A 1PBOA 1GX8A 2N93A 1YWCA 4GRJA 2RQ0A 2OVDA 4M6SA 1GGLA 4EFGA 4HPDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SMP I;  2X8S A;  4KC8 A;  4KC7 A;  2X8T A;  4KCA A;  1JIW I;  4COT A;  2RN4 A;  3LV4 A;  2X8F A; 
#chains in the Genus database with same CATH topology
 1AEL A;  1YP7 A;  5CE4 A;  1A57 A;  3UEW A;  3FA7 A;  3FR5 A;  4OMW A;  1E5P A;  4YKM A;  3NR3 A;  4AZP A;  1SWB A;  3P6E A;  1MDC A;  3NQK A;  1ZNG A;  4BX7 A;  2AF5 A;  2CBR A;  4TKH A;  5AQ6 A;  4ZCB A;  2X8F A;  4Z28 A;  1N9M A;  2XST A;  2X8S A;  4I60 A;  1NQM A;  4U3Q A;  1YUP A;  1BSO A;  1TVQ A;  2OFR X;  2QO5 A;  3FEP A;  4ORR A;  5HCE C;  2X45 A;  1OBP A;  4IMO A;  1LCW A;  4N7C A;  1B4M A;  3EBK A;  2MJI A;  4FBO A;  1IKJ A;  2KTS A;  2E4J A;  1ZNK A;  4KCA A;  1VWL B;  3VG6 A;  4NV7 A;  3TF6 A;  3WVM A;  2A2U A;  5C0N A;  5HZ8 A;  1SRJ A;  5CHK A;  3FEK A;  4IB7 A;  1EQD A;  4CPF A;  4EQA C;  4Y0Q A;  1QQS A;  4ARH A;  1N43 A;  1X71 A;  1YWA A;  3E3C A;  4PJ2 A;  2AKQ A;  4MVK A;  4PSQ A;  3C76 X;  4U46 A;  2DJG A;  4KT5 A;  4NYR A;  1H91 A;  1SA8 A;  3SZH A;  1FEN A;  4O49 A;  4CK4 A;  3FW5 A;  5EDC A;  3OD9 A;  1LPJ A;  1YWB A;  3MM0 A;  3WJD A;  1OEK A;  1A18 A;  2ACP X;  3FYF A;  3P24 A;  2AH7 X;  1ACD A;  3ZW0 B;  4TKB A;  2BS5 A;  2IZD B;  2WEX A;  3P6D A;  2OFM X;  3PQS A;  2R56 A;  2BSZ A;  1HMT A;  3PDF A;  4JNJ A;  1DV9 A;  4BX5 B;  5D48 A;  3STK A;  1RXJ A;  5L8O A;  2RCQ A;  3QKG A;  1PM1 X;  5JD2 A;  1JMX A;  1NP4 A;  3HPE A;  4ZGU A;  4TQ2 A;  1VWC B;  4NLJ A;  4NNT A;  3T6F A;  1JQP A;  2A0A A;  1SWS A;  1GX9 A;  2Q39 A;  4QZU A;  3NQ3 A;  2M4L A;  4IB8 A;  5CSE A;  2OY7 A;  4WBK A;  4M7M A;  5LJD A;  5HCD C;  4ZHG A;  4CPE A;  3STN A;  3P02 A;  1HXL A;  1KZX A;  1TW4 A;  1IW2 A;  4ES7 A;  1VWI B;  2WWP A;  3BS2 A;  1VWQ B;  2LBA A;  1SLD B;  2A13 A;  3FA9 A;  1SWL A;  4OKA A;  4CDE A;  1KQW A;  5LKE A;  1DF3 A;  1SWQ A;  3KFH A;  4CSB A;  1EII A;  2OF9 A;  2JN3 A;  3CBC A;  2DJF A;  4OS8 A;  2W2A A;  4YFP A;  2GTL M;  1ERB A;  4BVM A;  3KFG A;  3VE2 A;  1JJJ A;  4D6A A;  1HY2 A;  2QO6 A;  3FR4 A;  4UU2 A;  2CM4 A;  1EPA A;  4LKT A;  5EZ2 A;  2FS7 A;  2A5C A;  1I4U A;  3VG7 A;  1PMP A;  2Q2M A;  2MF6 A;  3ZW2 A;  4Z27 A;  1VWO B;  1TOU A;  4YVB A;  5F58 A;  1FTP A;  4U9C A;  1ICN A;  3AEH A;  2KD2 A;  1HMR A;  3O19 A;  1S7D A;  2X34 A;  1CBQ A;  2OY8 A;  1SRH A;  1O8V A;  4CDC A;  1EW3 A;  1HN2 A;  5HBS A;  1T68 X;  4AZQ A;  4O3X B;  4DCB A;  1GT4 A;  2PI3 O;  2RTM A;  5HZ9 A;  2FKJ A;  1IIU A;  5IO6 A;  5LJB A;  4YMY A;  1BRQ A;  3D95 A;  1VYF A;  1YIV A;  1LIF A;  3RE5 A;  3HTY A;  2IZI A;  2WQA E;  1QAB E;  3KFI A;  3WYQ A;  3RDM A;  1QFT A;  1LIE A;  4QRL A;  5BYP A;  2FTB A;  1VYG A;  1PTS A;  3F8A A;  1DF8 A;  1SY2 A;  3BDR A;  4IRW A;  1B56 A;  1ICM A;  1ALB A;  3ZW1 B;  3NAD A;  2Y32 A;  4ZHD A;  2IZJ A;  3MBT A;  5EDB A;  1CBR A;  3VG5 A;  1NBX A;  1VWM B;  4N7D A;  4CDD A;  3RDS A;  4O4X A;  2Q2P A;  3FA6 A;  5FAZ A;  1RXH A;  3WJG A;  1A3Y A;  2PY1 A;  5KIC A;  2L68 A;  3SLJ A;  4YH0 A;  5D47 A;  1GKA B;  3P6F A;  3JSQ A;  1EUO A;  3HOE A;  4IAX A;  1NC9 A;  5FFH A;  3HWE A;  1SXY A;  2G78 A;  2RTQ B;  1GT1 A;  1KL3 A;  2OL8 O;  4Y59 A;  4YGG A;  4YBP A;  3U0D A;  1EIO A;  1GX3 A;  3VE1 A;  5B10 O;  2CZT A;  1OBU A;  2NP1 A;  2QCB A;  1KT4 A;  3AKN A;  4ZFX A;  3EW1 A;  3C77 X;  4KC7 A;  2MM3 A;  4LQZ A;  1GT5 A;  1VWF B;  1Y9L A;  4K19 A;  1SWF A;  1ZND A;  4U8U M;  4DQ4 A;  5HTD A;  1AB0 A;  2IZB A;  2X32 A;  2FWV A;  3VGW A;  4NW4 A;  2RTB B;  4ORY A;  3HWD A;  4IB9 A;  1FDQ A;  1TOW A;  2G79 A;  2W2B A;  1UYN X;  1Y52 X;  1LCV A;  3FID A;  3WYP A;  4NNS A;  2BLG A;  4BGF A;  4YBU A;  1AVG I;  2RTG B;  4GJV A;  5D4A A;  1X8Q A;  2RTN B;  5L8N A;  5FEN A;  1X8O A;  3CBS A;  1SWG A;  1VWB B;  2HZR A;  4GE1 A;  5EPQ A;  3SLT A;  4O3Y A;  1STP A;  1KT6 A;  3NX1 A;  5H8T A;  5B29 A;  3B2I A;  5K67 A;  1VPR A;  1JBH A;  4CPH A;  3FLL A;  3SZI A;  3LHN A;  1STR B;  2ASN X;  5EED A;  5FQ6 E;  3BU1 A;  2IZC B;  4C5P A;  4QNI A;  2CAM A;  1VWD B;  3FEN A;  2AL0 X;  3RZY A;  3SZJ A;  2OYB O;  2O62 A;  4YDB A;  2RTF B;  1KXO A;  2QO4 A;  2RTJ A;  5LJG A;  3VHM A;  5HCC C;  3PP6 A;  1GT3 A;  2F01 A;  2FHL A;  1G5W A;  4IB6 A;  1LNM A;  1SWN A;  3UEX A;  2L9C A;  2VDF A;  2EU7 X;  5B3M O;  1EI5 A;  3LTW A;  1U18 A;  2ALL X;  1HBQ A;  3FA8 A;  1ERX A;  1U17 A;  1PEE A;  4GGZ A;  3WBG A;  3K3L A;  4BOE A;  4LZU A;  2GTL N;  3S26 A;  2FRS A;  1MX7 A;  2IZE B;  3WXQ A;  4BX7 B;  3PPT A;  1JYJ A;  1MUP A;  1SWO A;  1VWE B;  1SRF A;  3U9P C;  2Z4I A;  4QYP A;  4WFU A;  4MVI A;  5B5G A;  4TLJ A;  4Z2O A;  1R0U A;  2ZAI A;  4GZV A;  1JV4 A;  3FEL A;  3FR2 A;  3ELX A;  1SWR A;  3VG4 A;  4YGH A;  1MEP A;  3CKF A;  1W6F A;  1AVD A;  2G8C O;  2Q9S A;  3PEC A;  1UYO X;  5LJC A;  1SWJ A;  1LID A;  1G7N A;  1ML7 A;  2GC9 A;  2RTI B;  5L8I A;  3C78 X;  2FR3 A;  5H9L A;  1CBI A;  1X8P A;  1I04 A;  3KZA A;  3RY2 A;  1I05 A;  4O3Z A;  3OE3 A;  2QM9 A;  4ORU A;  1LIC A;  4A60 A;  4BX6 A;  1RAV A;  2OL6 O;  3S5V A;  2IZL B;  4O4U A;  4TNN A;  4ALO A;  2CZU A;  1MOY A;  1QY1 A;  2OY1 O;  3NPO A;  1N0S A;  2A3F X;  3BU9 A;  1NQN A;  3WZN A;  4EXZ A;  3PH6 A;  5DG4 A;  2HYS A;  1LEL A;  1EAL A;  4HPA A;  4QGW A;  5AJC A;  1MM9 A;  2NND A;  2W2F A;  1HMS A;  5F1E A;  4HPC A;  5K06 A;  4MVL A;  4O4O A;  4I3C A;  5F6Z A;  2AVI A;  3NX2 A;  3RE6 A;  3DTQ A;  1HXZ A;  1LUQ A;  2RTL A;  1KT3 A;  4ORX A;  4BJ8 A;  1KT5 A;  4CV7 A;  4MIR A;  5H9K A;  1OPB A;  4GGT A;  2RTP B;  4IAB A;  5LJH A;  2K62 A;  4Y5D A;  2GH7 A;  4QYN A;  3WZO A;  3TZS A;  5AJB A;  1KQX A;  1X8N A;  3BRN A;  1S44 A;  4ID2 A;  1DC9 A;  3APW A;  1K3B A;  4I9S A;  4YKO A;  5IO5 A;  1GM6 A;  3RSW A;  1N7Y A;  1BBP A;  1QY2 A;  1SLG B;  4QAE A;  2LFO A;  4JGL A;  2I5V O;  3RKG A;  4AW8 A;  4WHI A;  4LZV A;  3KQ0 A;  3IFB A;  5HZ6 A;  2IFB A;  2Y3F A;  3UAQ A;  1JYD A;  5JR8 A;  2OFA A;  3HWG A;  2RTK A;  3CQR A;  3PED A;  3WZQ A;  1N9Y A;  4GK9 A;  1AQB A;  4CDF A;  5HZ5 A;  4ZGF A;  3D97 A;  4R0B A;  1JZU A;  4O9S A;  3SAO A;  5AEO A;  2FLJ A;  3VHH A;  4OS3 A;  5F6B A;  4A1H A;  4ODD A;  1Y0G A;  1ZNH A;  3BX8 A;  3MG5 A;  2BC3 A;  1DFV A;  3O22 A;  4FGI B;  4FQB B;  3KFF A;  4JO6 A;  4OEL A;  1JMZ A;  1S2P A;  2JU7 A;  3WOV A;  4EKV A;  4GH7 A;  1YP6 A;  4KC8 A;  2JMB A;  4INN A;  5IRA A;  4WFV A;  4XMG A;  4XME A;  1I06 A;  5HTE A;  3DSZ A;  4YCE A;  3O2Y A;  3TGA A;  1B8E A;  3RWX A;  2X4M A;  4HWM A;  3LV4 A;  1OEJ A;  1KGL A;  5LJK A;  2QOM A;  1DZM A;  1SXU A;  1WBI A;  1JIW I;  1W4T A;  1EXS A;  2A5B A;  4GD9 A;  1VWR B;  3WZP A;  2MHD A;  1U0X A;  4RUU A;  1X8U A;  3APU A;  5L3Y A;  1DZJ A;  4L3R A;  2DM5 A;  3NQ9 A;  4ZHC A;  1UZ2 X;  1XKI A;  3MVF A;  4I3B A;  3RBY A;  2OVA A;  2BS6 A;  2ZAG A;  4GET A;  1MX8 A;  4HPD A;  1W5R A;  4IAW A;  4D6B A;  1LFO A;  2X55 A;  2Z4H A;  4ZR2 A;  4DNE A;  1E06 A;  1O1U A;  2QOS C;  4NLI A;  1BM5 A;  1RLB E;  4ZH6 A;  4AZM A;  2HLV A;  1STS B;  2OVE A;  4Y0S A;  4YDA A;  3AKM A;  3EMM A;  4GDZ A;  2HKD A;  2C1Q A;  2AT6 X;  1VWN B;  4O4S A;  3T6L A;  3CR6 A;  1AVE A;  4ZJ0 A;  1G85 A;  4BBO A;  5CYB A;  1IFC A;  1SY0 A;  2FGS A;  2BHV A;  4CPI A;  3B2K A;  5F2B A;  2WPU A;  1URE A;  4KH8 A;  4YGZ A;  3PH5 A;  4ZH9 A;  4QQ1 A;  1NGL A;  4I9R A;  5IXG A;  3PK2 A;  3S60 A;  1OBQ A;  1ZNE A;  3CQN A;  1E2T A;  1DZK A;  1SWE A;  1LDQ A;  1SXW A;  3NP1 A;  3P6C A;  1CBS A;  3RDO A;  3QQ2 A;  1T8V A;  4Z6J A;  1SMP I;  2VFB A;  3N91 A;  1IFB A;  4MVE A;  5H9N A;  1IJ8 A;  3WJB A;  3NBX X;  3SLO A;  4A8Z A;  1KZW A;  1SWA A;  4BQU A;  5B27 A;  1VWJ B;  3ZI8 A;  2OF8 A;  4YFR A;  3ZW0 A;  3BY0 A;  1SWK A;  1BRP A;  1OEE A;  3BSZ E;  3VG2 A;  1Y55 X;  1SXX A;  3D96 A;  2A2G A;  1FEM A;  1VWG B;  1Y9T A;  4Y0P A;  3ZZV A;  2P8G A;  3WJC A;  4BX5 A;  2YG2 A;  2C1S A;  4L1N A;  5IRW A;  2LKK A;  3P6G A;  1VWK B;  3WJF A;  1KOI A;  3PQU A;  3JQO A;  4MIS A;  4ON1 A;  4CPH B;  4GU8 A;  3F6Z B;  3GE2 A;  1SRI A;  4JHQ A;  2FS6 A;  3SOT A;  4Z2P A;  5IO7 A;  1BEB A;  2AT0 X;  1SY1 A;  2GTL O;  2FHN X;  3B2H A;  3EYC A;  3ZQ3 A;  2L67 A;  4AYH A;  1QFV A;  1LDO A;  1EPB A;  2HMB A;  3X00 A;  1BSY A;  2RTR B;  1D2U A;  3EBW A;  2RTD B;  3EM0 A;  1FJ1 E;  4AZR A;  2IZA A;  4QZT A;  4GNY A;  1QY0 A;  3FIQ A;  3D9W A;  2RA6 A;  4ZHH A;  5B2A O;  1SWU A;  1A2D A;  2IZK A;  2X56 A;  3T2W A;  4BCS A;  1ADL A;  1SWP A;  2HZQ A;  4GJS A;  4NP1 A;  2L5P A;  3F9D A;  2WQ9 A;  3TGB A;  3U03 A;  2GTF X;  2NNE A;  2Q4N A;  2OFB A;  2RTO B;  3B2J A;  1K24 A;  3CKG A;  2MO5 A;  2FT9 A;  2G7B A;  2NNQ A;  4ZHF A;  2IZF B;  2Y3E A;  1N4J A;  3JS1 A;  5FQ8 E;  4XMH A;  1SWD A;  1WUB A;  1Y53 X;  4AZO A;  4FBR A;  1XCA A;  2MWH A;  2R74 A;  1SRE A;  4MEE A;  2RTA A;  2JU8 A;  2RTE B;  4GUZ A;  4Y0R A;  2JU3 A;  1BSQ A;  2JGS A;  2OL7 A;  3HWF A;  4OMX A;  2FR2 A;  1GXA A;  2BT9 A;  3AUM O;  1OSP O;  5D8J A;  1I9H A;  3GAQ A;  1VWA B;  4HFO A;  3L4R A;  2UZ2 A;  2ZSC A;  4GGR A;  4QGV A;  3MX7 A;  1MK5 A;  4LKP A;  5B11 O;  5KID A;  1TXL A;  1NP1 A;  4EEJ A;  3VG3 A;  1QWD A;  1VWH B;  2AT5 X;  2CBS A;  1RBP A;  3BLG A;  4ML7 B;  4XMC A;  1P6P A;  5FQ7 E;  1JJX A;  1Z24 A;  3CWK A;  1SWT A;  2OY5 O;  1IKE A;  1KL5 A;  2AT8 X;  5HZQ A;  1SWH A;  2GJ5 A;  2RTC B;  2WEW A;  4AZN A;  3V8U A;  4BX6 B;  1I78 A;  4B55 A;  1T0V A;  1D3S A;  4U8U N;  1YWD A;  2XKL A;  4I3D A;  1KL4 A;  3ZW1 A;  4GKC A;  4Z2V A;  2JOZ A;  4A1Y A;  3OBL A;  4NYQ A;  1BJ7 A;  2G5L A;  2OVS A;  4I6S A;  1KT7 A;  2QMI A;  1B0O A;  4ALB A;  3T1D A;  5HAE A;  3UEV A;  2RN4 A;  2LB6 A;  3I17 A;  1GKA A;  3APX A;  1ZRY A;  1SWC A;  4U8U O;  4EDE A;  4I95 A;  5B5F A;  2IZH B;  2AMM X;  5EEE A;  3STM X;  2OZQ A;  3CMP A;  3VPJ E;  4COT A;  1SLF B;  3HK1 A;  1PBY A;  1RST B;  2X46 A;  1DZP A;  2C4I A;  1MVG A;  3BX7 A;  3IA8 A;  4IMN A;  5DPQ A;  4NV8 A;  3ZUO A;  3FW4 A;  2A8G A;  3WJE A;  3S5X A;  4OS0 A;  5BVS A;  4TKJ A;  4IBA A;  5BVQ A;  3VU1 A;  1L6M A;  1LF7 A;  4XMD A;  2YMS A;  5BVT A;  1LKE A;  4KII A;  4XMF A;  1LCZ A;  1FEL A;  3G7X A;  3RY1 A;  3T2X A;  3EW2 A;  1LIB A;  5H9A A;  3EC5 A;  3H3I A;  2KW1 A;  5IRU A;  3VHI A;  4HPB A;  1O1V A;  4ORS A;  5D45 A;  3HOL A;  3ELZ A;  1E02 A;  2RD7 C;  3D4R A;  3P6H A;  4RUN A;  2ACO A;  2RTH B;  2K23 A;  1VYO A;  3Q34 A;  4QGX A;  1SY3 A;  1OPA A;  3FMZ A;  1SRG A;  2R73 A;  2UYW A;  2ANS A;  2WSJ A;  1X89 A;  2LBV A;  3Q6L A;  1CRB A;  2LA7 A;  3FDC A;  4ORW A;  1HBP A;  2X8T A;  3KVN A;  5F7G A;  1G74 A;  2FKG A;  4YFQ A;  1CJ5 A;  3ZUI A;  1E00 A;  1RXK A;  3APV A;  2CM9 A;  1KFF A;  2HNX A;  4UU3 A;  1BWY A;  2IZG B;  2JW1 A;  2KTD A;  1JJU A;  2RCT A;  4FBV A;  5HA1 A;  5LKF A;  1BLR A;  3OJY C;  4TJZ A;  3RDQ A;  2WUT A;  2KT4 B;  2POA A;  2VFC A;  2WR6 A;  3UEU A;  4DQ3 A;  2F73 A;  3B2L A;  1HQQ A;  4YCH A;  4GNW A;  5KHP A;  5LJE A;  1QG5 A;  4OEM A;  3RDU A;  3I0A A;  1HQP A;  1ZNL A;  5HA0 A;  4O3W A;  3RDX A;  1SLE B;  3TGC A;  4GDA A;  3ZWE A;  2F09 A;  2AT3 X;  5HWZ A;  1FE3 A;  5K68 A;  1PBO A;  1GX8 A;  2N93 A;  1YWC A;  4GRJ A;  2RQ0 A;  2OVD A;  4M6S A;  1GGL A;  4EFG A;  1RSU B;  2I5Z O;  1VWP B;  1NDJ A; 
#chains in the Genus database with same CATH homology
 1AEL A;  1YP7 A;  5CE4 A;  1A57 A;  3UEW A;  3FA7 A;  3FR5 A;  4OMW A;  1E5P A;  4YKM A;  3NR3 A;  4AZP A;  3P6E A;  1MDC A;  3NQK A;  1ZNG A;  2CBR A;  4TKH A;  5AQ6 A;  4ZCB A;  2X8F A;  2XST A;  2X8S A;  4U3Q A;  1YUP A;  1BSO A;  1TVQ A;  2OFR X;  2QO5 A;  3FEP A;  4ORR A;  5HCE C;  2X45 A;  1OBP A;  4IMO A;  4N7C A;  1B4M A;  3EBK A;  2MJI A;  4FBO A;  1IKJ A;  2KTS A;  2E4J A;  1ZNK A;  4KCA A;  3VG6 A;  3TF6 A;  3WVM A;  5C0N A;  2A2U A;  5HZ8 A;  3FEK A;  4IB7 A;  1EQD A;  4EQA C;  4Y0Q A;  1QQS A;  4ARH A;  1X71 A;  1YWA A;  3E3C A;  4PJ2 A;  2AKQ A;  4MVK A;  4PSQ A;  3C76 X;  4KT5 A;  4NYR A;  1H91 A;  1SA8 A;  1FEN A;  4O49 A;  4CK4 A;  3FW5 A;  5EDC A;  3OD9 A;  1LPJ A;  1YWB A;  3WJD A;  1OEK A;  1A18 A;  2ACP X;  3FYF A;  3P24 A;  2AH7 X;  1ACD A;  3ZW0 B;  4TKB A;  2BS5 A;  2WEX A;  3P6D A;  2OFM X;  3PQS A;  2R56 A;  1HMT A;  1DV9 A;  5D48 A;  3STK A;  5L8O A;  2RCQ A;  3QKG A;  1PM1 X;  1NP4 A;  4ZGU A;  4TQ2 A;  4NLJ A;  4NNT A;  2A0A A;  1GX9 A;  2Q39 A;  4QZU A;  3NQ3 A;  2M4L A;  4IB8 A;  4WBK A;  4M7M A;  5LJD A;  5HCD C;  4ZHG A;  3STN A;  3P02 A;  1KZX A;  1TW4 A;  1IW2 A;  4ES7 A;  2WWP A;  3BS2 A;  2LBA A;  3FA9 A;  2A13 A;  1KQW A;  5LKE A;  1DF3 A;  3KFH A;  4CSB A;  1EII A;  3CBC A;  2JN3 A;  4OS8 A;  4YFP A;  4BVM A;  2W2A A;  2GTL M;  1ERB A;  3KFG A;  3VE2 A;  1JJJ A;  4D6A A;  2QO6 A;  3FR4 A;  4UU2 A;  2CM4 A;  1EPA A;  4LKT A;  5EZ2 A;  2FS7 A;  1I4U A;  3VG7 A;  1PMP A;  2Q2M A;  3ZW2 A;  1TOU A;  5F58 A;  1FTP A;  4U9C A;  1ICN A;  2KD2 A;  1HMR A;  3O19 A;  1S7D A;  1CBQ A;  1O8V A;  1EW3 A;  1HN2 A;  5HBS A;  1T68 X;  4AZQ A;  4O3X B;  1GT4 A;  5HZ9 A;  1IIU A;  5IO6 A;  5LJB A;  4YMY A;  1BRQ A;  3D95 A;  1VYF A;  1YIV A;  1LIF A;  3HTY A;  2WQA E;  1QAB E;  3KFI A;  1QFT A;  1LIE A;  4QRL A;  5BYP A;  2FTB A;  1VYG A;  3F8A A;  1SY2 A;  3BDR A;  1B56 A;  1ICM A;  1ALB A;  3ZW1 B;  3NAD A;  4ZHD A;  3MBT A;  5EDB A;  1CBR A;  3VG5 A;  4N7D A;  4O4X A;  2Q2P A;  3FA6 A;  5FAZ A;  3WJG A;  1A3Y A;  2PY1 A;  5KIC A;  2L68 A;  4YH0 A;  5D47 A;  1GKA B;  3P6F A;  3JSQ A;  1EUO A;  3HOE A;  4IAX A;  5FFH A;  3HWE A;  1SXY A;  2G78 A;  4YGG A;  1GT1 A;  4YBP A;  1EIO A;  3U0D A;  3VE1 A;  2CZT A;  1OBU A;  2NP1 A;  1KT4 A;  3AKN A;  4ZFX A;  3C77 X;  4KC7 A;  2MM3 A;  4LQZ A;  1GT5 A;  1Y9L A;  4K19 A;  1ZND A;  4U8U M;  4DQ4 A;  5HTD A;  1AB0 A;  2FWV A;  4NW4 A;  4ORY A;  3HWD A;  4IB9 A;  1FDQ A;  1TOW A;  2G79 A;  2W2B A;  4NNS A;  2BLG A;  5L8N A;  4YBU A;  1AVG I;  5D4A A;  1X8Q A;  5FEN A;  1X8O A;  3CBS A;  2HZR A;  4GE1 A;  5EPQ A;  4O3Y A;  1KT6 A;  3NX1 A;  5H8T A;  5B29 A;  3B2I A;  1VPR A;  1JBH A;  3FLL A;  3LHN A;  2ASN X;  5EED A;  5FQ6 E;  3BU1 A;  4QNI A;  3FEN A;  2AL0 X;  3RZY A;  2O62 A;  4YDB A;  5LJG A;  1KXO A;  2QO4 A;  5HCC C;  3PP6 A;  1GT3 A;  1G5W A;  4IB6 A;  1LNM A;  3UEX A;  2L9C A;  2EU7 X;  1EI5 A;  1U18 A;  2ALL X;  1HBQ A;  3FA8 A;  1ERX A;  1U17 A;  1PEE A;  3WBG A;  3K3L A;  4BOE A;  4LZU A;  2GTL N;  3S26 A;  2FRS A;  1MX7 A;  3WXQ A;  3PPT A;  1JYJ A;  1MUP A;  5BVT A;  3U9P C;  2Z4I A;  4QYP A;  4WFU A;  4MVI A;  4TLJ A;  1R0U A;  2ZAI A;  4GZV A;  1JV4 A;  3FEL A;  3FR2 A;  3ELX A;  3VG4 A;  4YGH A;  2Q9S A;  3PEC A;  5LJC A;  1LID A;  1ML7 A;  1G7N A;  5L8I A;  2GC9 A;  3C78 X;  2FR3 A;  5H9L A;  1CBI A;  1X8P A;  1I04 A;  3KZA A;  1I05 A;  4O3Z A;  3OE3 A;  2QM9 A;  4ORU A;  1LIC A;  4A60 A;  3S5V A;  4ALO A;  4O4U A;  4TNN A;  2CZU A;  1QY1 A;  3NPO A;  1N0S A;  2A3F X;  3BU9 A;  4EXZ A;  3PH6 A;  5DG4 A;  2HYS A;  1EAL A;  4HPA A;  4QGW A;  5AJC A;  2NND A;  2W2F A;  1HMS A;  5F1E A;  4HPC A;  5K06 A;  4MVL A;  4O4O A;  4I3C A;  5F6Z A;  3NX2 A;  3DTQ A;  1KT3 A;  4ORX A;  1KT5 A;  4CV7 A;  4MIR A;  5H9K A;  1OPB A;  4IAB A;  5LJH A;  2K62 A;  4QYN A;  3TZS A;  5AJB A;  1KQX A;  1X8N A;  3BRN A;  1S44 A;  4ID2 A;  1DC9 A;  3APW A;  4I9S A;  5IO5 A;  4YKO A;  1GM6 A;  3RSW A;  1BBP A;  1QY2 A;  4QAE A;  2LFO A;  4JGL A;  3RKG A;  4AW8 A;  4WHI A;  4LZV A;  3KQ0 A;  3IFB A;  5HZ6 A;  2IFB A;  3UAQ A;  1JYD A;  5JR8 A;  3HWG A;  3CQR A;  3PED A;  4GK9 A;  1AQB A;  4ZGF A;  3D97 A;  4R0B A;  1JZU A;  4O9S A;  3SAO A;  5AEO A;  2FLJ A;  4OS3 A;  5F6B A;  4A1H A;  4ODD A;  1ZNH A;  3BX8 A;  3O22 A;  4FGI B;  1DFV A;  4FQB B;  5F7G A;  5HZ5 A;  3KFF A;  1S2P A;  2JU7 A;  3WOV A;  4GH7 A;  1YP6 A;  4KC8 A;  2JMB A;  4INN A;  4WFV A;  4XMG A;  4XME A;  1I06 A;  5HTE A;  3DSZ A;  4YCE A;  3O2Y A;  3TGA A;  1B8E A;  3RWX A;  4HWM A;  1KGL A;  3LV4 A;  1OEJ A;  5LJK A;  1DZM A;  1SXU A;  1JIW I;  1EXS A;  2MHD A;  1U0X A;  4RUU A;  1X8U A;  3APU A;  1DZJ A;  4L3R A;  2DM5 A;  3NQ9 A;  4ZHC A;  1UZ2 X;  1XKI A;  3MVF A;  4I3B A;  3RBY A;  2OVA A;  2BS6 A;  2ZAG A;  4GET A;  1MX8 A;  4IAW A;  4D6B A;  1LFO A;  4ZR2 A;  2Z4H A;  1E06 A;  1O1U A;  2QOS C;  4NLI A;  1BM5 A;  1RLB E;  4ZH6 A;  4AZM A;  2HLV A;  2OVE A;  4Y0S A;  4YDA A;  3AKM A;  3EMM A;  4GDZ A;  2AT6 X;  4O4S A;  3CR6 A;  4ZJ0 A;  1G85 A;  5CYB A;  1IFC A;  1SY0 A;  2BHV A;  3B2K A;  1URE A;  4KH8 A;  4YGZ A;  3PH5 A;  4ZH9 A;  4QQ1 A;  1NGL A;  4I9R A;  3S60 A;  1OBQ A;  1ZNE A;  3CQN A;  1DZK A;  1SXW A;  3NP1 A;  3P6C A;  1CBS A;  1T8V A;  1SMP I;  3N91 A;  1IFB A;  4MVE A;  5H9N A;  1KZW A;  3WJB A;  3NBX X;  4A8Z A;  4BQU A;  5B27 A;  3ZI8 A;  4YFR A;  3ZW0 A;  3BY0 A;  3VG2 A;  1BRP A;  1OEE A;  3BSZ E;  3ZZV A;  1SXX A;  3D96 A;  2A2G A;  1FEM A;  4Y0P A;  1Y9T A;  2P8G A;  3WJC A;  2YG2 A;  4L1N A;  2LKK A;  3P6G A;  3WJF A;  1KOI A;  3PQU A;  3JQO A;  4MIS A;  4ON1 A;  4GU8 A;  3F6Z B;  3GE2 A;  3SOT A;  5IO7 A;  2FS6 A;  1BEB A;  2AT0 X;  1SY1 A;  2GTL O;  3B2H A;  3EYC A;  3ZQ3 A;  4AYH A;  2L67 A;  1QFV A;  2HMB A;  1EPB A;  1BSY A;  1D2U A;  3EBW A;  3EM0 A;  4AZR A;  4QZT A;  4GNY A;  1QY0 A;  3FIQ A;  2RA6 A;  4ZHH A;  1A2D A;  1ADL A;  2HZQ A;  4NP1 A;  2L5P A;  3F9D A;  2WQ9 A;  3TGB A;  3U03 A;  2GTF X;  2NNE A;  2Q4N A;  3B2J A;  4ZHF A;  2MO5 A;  2FT9 A;  2G7B A;  2NNQ A;  3JS1 A;  5FQ8 E;  4XMH A;  4AZO A;  4FBR A;  1XCA A;  2MWH A;  2R74 A;  2JU8 A;  4Y0R A;  2JU3 A;  1BSQ A;  3HWF A;  4OMX A;  2FR2 A;  1GXA A;  2BT9 A;  5D8J A;  3GAQ A;  4HFO A;  3L4R A;  4QGV A;  5KID A;  3MX7 A;  4LKP A;  1TXL A;  1NP1 A;  4EEJ A;  3VG3 A;  1QWD A;  2AT5 X;  2CBS A;  1RBP A;  3BLG A;  4ML7 B;  4XMC A;  1P6P A;  5FQ7 E;  1JJX A;  1Z24 A;  3CWK A;  1IKE A;  2AT8 X;  5HZQ A;  2GJ5 A;  4AZN A;  2WEW A;  3V8U A;  1T0V A;  1D3S A;  4U8U N;  1YWD A;  2XKL A;  4I3D A;  3ZW1 A;  4GKC A;  2JOZ A;  4A1Y A;  3OBL A;  4NYQ A;  1BJ7 A;  2OVS A;  4I6S A;  1KT7 A;  2QMI A;  1B0O A;  4ALB A;  3T1D A;  5HAE A;  3UEV A;  2RN4 A;  2LB6 A;  3I17 A;  1GKA A;  3APX A;  1ZRY A;  4U8U O;  4EDE A;  4I95 A;  2AMM X;  5EEE A;  3STM X;  2OZQ A;  3CMP A;  3VPJ E;  4COT A;  3HK1 A;  2X46 A;  1DZP A;  1MVG A;  3BX7 A;  3IA8 A;  4IMN A;  5DPQ A;  3ZUO A;  3FW4 A;  3WJE A;  3S5X A;  4OS0 A;  5BVS A;  4TKJ A;  4IBA A;  5BVQ A;  3VU1 A;  1L6M A;  1LF7 A;  4XMD A;  2YMS A;  1LKE A;  4KII A;  4XMF A;  1FEL A;  3G7X A;  1LIB A;  5H9A A;  3H3I A;  2KW1 A;  4HPB A;  1O1V A;  4ORS A;  5D45 A;  3HOL A;  3ELZ A;  1E02 A;  2RD7 C;  3D4R A;  3P6H A;  4RUN A;  2ACO A;  2K23 A;  4QGX A;  1SY3 A;  1OPA A;  3FMZ A;  2R73 A;  2ANS A;  2WSJ A;  1X89 A;  2LBV A;  3Q6L A;  1CRB A;  2LA7 A;  4ORW A;  1HBP A;  2X8T A;  1G74 A;  4YFQ A;  1CJ5 A;  3ZUI A;  1E00 A;  3APV A;  2CM9 A;  2HNX A;  4UU3 A;  1BWY A;  2KTD A;  2JW1 A;  5HA1 A;  2RCT A;  4FBV A;  5LKF A;  1BLR A;  3OJY C;  4TJZ A;  2WUT A;  2KT4 B;  2POA A;  2WR6 A;  3UEU A;  4DQ3 A;  2F73 A;  3B2L A;  4YCH A;  4GNW A;  5KHP A;  5LJE A;  1QG5 A;  3I0A A;  1HQP A;  1ZNL A;  5HA0 A;  4O3W A;  3TGC A;  3ZWE A;  2F09 A;  2AT3 X;  5HWZ A;  1FE3 A;  1PBO A;  1GX8 A;  2N93 A;  1YWC A;  4GRJ A;  2RQ0 A;  2OVD A;  4M6S A;  1GGL A;  4EFG A;  4HPD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...