1SMWA

Crystal structure of cp rd l41a mutant in reduced state 2 (soaked)
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
54
structure length
54
Chain Sequence
b'MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPACGVGKDQFEEVEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rubredoxin
publication title The unique hydrogen bonded water in the reduced form of Clostridium pasteurianum rubredoxin and its possible role in electron transfer
pubmed doi rcsb
source organism Clostridium pasteurianum
molecule tags Electron transport
total genus 8
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2004-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00301 Rubredoxin Rubredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 1smwA00
1LKMA 1BRFA 4ME3A 1BE7A 5AI3A 2HR5A 2M4YA 2RDVA 3KYVA 4YWLA 4POGA 1CAAA 1C09A 1FHMA 1SMWA 1YK4A 4POFA 1RB9A 2MS3A 1IROA 1IRNA 1B13A 1NNQA 1IU5A 1FHHA 1YK5A 1R0GA 5IY0A 4YWMA 5RXNA 2KKDA 3A44A 1YUXA 1E8JA 1QYBA 1R0JA 1B2OA 3KYXA 1T9PA 1T9OA 2PVXA 3KYYA 1R0FA 3SS2A 1LTLA 3QVDA 1BFYA 1SMMA 1LKOA 2KN9A 1DVBA 7RXNA 1B2JA 3PZAA 1RYTA 4AR3A 4AR4A 4RXNA 5AI2A 4K9FA 2PYAA 1S2ZA 1S30A 1LKPA 1YUZA 4TPUA 1VCXA 3KYWA 1SMUA 1S24A 1BQ8A 4AR6A 2QL0A 1YV1A 2GMGA 1R0IA 1JYBA 1DX8A 2K2DA 1CADA 1BQ9A 3RZTA 1RDGA 3KYUA 1B71A 3PWFA 1R0HA 1RDVA 4AR5A 3RZ6A 3RYGA 2DSXA 1ZRPA 6RXNA 8RXNA 1H7VA 2LCQA 2PVEA 1QCVA 1IU6A 2VL6A 1RWDA 1T9QA 2V3BB 3MPSA
chains in the Genus database with same CATH superfamily
1LKMA 5MFZA 2XJRA 2JI1A 4U671 2C6AA 1FHMA 5C3EL 4A3IL 1RYQA 4XGHA 1RB9A 2AUSB 4TVMA 4JAGA 1OWCA 3PKIA 3GTLL 1YK5A 2PSMC 5RXNA 1QYBA 1R0JA 1T9PA 2PPTA 1T9OA 4C2M1 3KYYA 3S17L 4BBSL 1PFUA 4AHYA 3M4OL 5IYBL 1Z92B 1DVBA 7RXNA 3S1ML 1TWGL 2XJUA 1Y1WL 3IU3I 4K9FA 2JA8L 4A3JL 5JVH1 2JA6L 3LNLA 3FDJA 4TPUA 1R9TL 3GTKL 1SMUA 2WB1P 1BQ8A 2YU9L 1R0IA 1JYBA 1K83L 2K2DA 5DM71 1VZIA 2A69D 2Y0SP 3KYUA 4A3EL 1R0HA 2A6ED 3H97A 4AR5A 2L0ZA 3LWQB 8RXNA 1H7VA 2PVEA 1IU6A 2VL6A 3HOWL 5C4JL 1RWDA 3HKZP 2V3BB 5IP9L 4C3HL 3MPSA 3RZDL 3RZOL 2JA5L 3I4ML 3HOYL 1BRFA 4ME3A 5GADc 2RDVA 4POGA 1CAAA 4AI3A 4QIWP 1QQTA 4POFA 3S2DL 2C6BA 3PKJA 2Z3RB 1IROA 1B13A 1IU5A 4BXXL 1PFWA 3PO3L 2KKDA 3HOZL 2NVTL 1Y1VL 5MLC3 4BY7L 4E6YA 3HAXC 4WFN1 2M6OA 4A3ML 1TWAL 1R0FA 3WWLA 3QVDA 3LWPB 3MQKB 1SMMA 5M3FL 3LWRB 1VZHA 3PZAA 2E2IL 1I3QL 2XJTA 3HJYB 2APOB 3PIO1 4UY81 2PYAA 1IW7D 1S2ZA 3MSUA 2ZIXA 3GTJL 2J9UB 3GTQL 3K35A 5GAGc 5IYCL 4AYBP 3S1QL 3P8BA 5FJ8L 1I50L 3CQZL 2A68D 5M5YL 2XJVA 4AI0A 6RXNA 4BY1L 3B08B 1QCVA 3S14L 4JAEA 3J7Y1 2CKAA 3GTPL 3PIP1 3PO2L 4GS7D 1BE7A 4AHWA 3NFPI 4JAFA 2HR5A 5C44L 2HVYC 4LHLA 4A3LL 2Z3QB 5MF6A 1IRNA 2B63L 3VPBE 5FLML 3WWNB 2E2JL 2O5JD 2V0FA 3H9CA 3J7Z1 5GAHc 1SFOL 2JA7L 3LPEB 5IY0A 4C3JL 3S16L 4YWMA 4A3DL 2M6PA 1YUXA 3LWVB 5MGNA 4AHXA 3I4NL 3H9BA 1LTLA 1BFYA 3GTGL 2KN9A 4BBRL 4A3CL 5M5WL 2WAQP 2NVQL 4A3BL 1TWHL 1B2JA 3HOUL 3M3YL 4B8CD 4AR3A 4A3FL 3S2HL 4AI2A 1ODHA 4RXNA 1NXGA 5AI2A 5H1Sc 2XJSA 2RFKB 5GAEc 1S30A 2ERJA 1VCXA 3KYWA 3H99A 4AHZA 1TWFL 2QL0A 1YV1A 2GMGA 4G6BA 2JI2A 5AN9H 1DX8A 1PZXA 3GTOL 1CADA 1F4LA 3H0GL 1P7PA 1BQ9A 3RZTA 1RDGA 2E2HL 1B71A 3PWFA 2NVYL 2VUML 2V0EA 1ZRPA 3JR7A 4JADA 2PMZP 3S15L 3PL5A 2R7ZL 5AI3A 2M4YA 3KYVA 4YWLA 2JI3A 2R92L 2R93L 2AYJA 2CR8A 2A6HD 1C09A 1SMWA 1YK4A 4A3KL 4LHNA 2MS3A 4X6AL 3GTML 1NNQA 1WJVA 1PFYA 1FHHA 3FKIL 1R0GA 3H3VM 1I6HL 2XJPA 4C3IL 3A44A 2XJQA 1E8JA 1B2OA 3KYXA 5C4XL 2CKCA 2PVXA 3S1RL 3SS2A 2NVXL 1LKOA 2ERSA 1PFVA 3LWOB 1VZGA 1RYTA 5MFPA 3HJWB 2AQCA 4AR4A 3QQCE 5EIOC 4Y52L 3S1NL 3K7AL 1LKPA 1TWCL 1YUZA 2EY4E 2H12A 1S24A 4AR6A 2BE5D 1OWBA 5EINC 4A3GL 5JVG1 5IYDL 5IP7L 5M3ML 4ZN3B 1WCML 1RDVA 2M4VA 4V196 3ZG6A 3RZ6A 2B5ID 3RYGA 2DSXA 5M5XL 4A93L 4AI1A 3P2AA 3B0AB 2LCQA 4Y7NL 5K2ME 2NYDA 4XXBB 1T9QA 3HOXL 4ZN1B 5DM61 3HOVL 1NXEA
chains in the Genus database with same CATH topology
1LKMA 1BRFA 4U671 4ME3A 1BE7A 4AHWA 5MFZA 3NFPI 4JAFA 5AI3A 2HR5A 2M4YA 2RDVA 2JI3A 2XJRA 2JI1A 3KYVA 2AYJA 2C6AA 1CAAA 2CR8A 4LHLA 4YWLA 2A6HD 4AI3A 1C09A 1FHMA 1SMWA 1YK4A 4POFA 2Z3QB 2C6BA 1RYQA 3PKJA 4XGHA 4LHNA 1RB9A 2MS3A 4TVMA 5MF6A 2Z3RB 1IROA 1IRNA 1B13A 4JAGA 3VPBE 1NNQA 1OWCA 3PKIA 1WJVA 3WWNB 2O5JD 1IU5A 2V0FA 1FHHA 3J7Z1 5GAHc 1YK5A 2PSMC 1R0GA 3LPEB 5IY0A 2XJPA 4YWMA 5RXNA 2KKDA 2M6PA 3A44A 1YUXA 2XJQA 5MLC3 1E8JA 1QYBA 4E6YA 1R0JA 1B2OA 5MGNA 4POGA 3KYXA 1T9PA 2PPTA 4WFN1 4AHXA 2M6OA 1T9OA 2CKCA 2PVXA 3KYYA 1R0FA 3SS2A 3WWLA 1LTLA 3QVDA 1BFYA 4AHYA 1SMMA 1LKOA 2KN9A 2ERSA 1Z92B 1DVBA 7RXNA 1B2JA 1VZGA 1VZHA 3PZAA 1RYTA 2XJUA 5MFPA 4B8CD 4AR3A 2XJTA 3IU3I 4AI2A 4AR4A 1ODHA 4RXNA 1NXGA 3QQCE 5AI2A 5EIOC 3PIO1 4K9FA 5H1Sc 2XJSA 4UY81 2PYAA 5GAEc 1IW7D 1S2ZA 1S30A 1LKPA 3MSUA 5JVH1 2ZIXA 2ERJA 1YUZA 3LNLA 4TPUA 2H12A 1VCXA 2J9UB 3KYWA 1SMUA 1S24A 4AHZA 3K35A 5GAGc 1BQ8A 4AR6A 2QL0A 1YV1A 2GMGA 2BE5D 1R0IA 4G6BA 2JI2A 1OWBA 5GADc 5EINC 1JYBA 5AN9H 1DX8A 2K2DA 1CADA 5DM71 5JVG1 1VZIA 1BQ9A 3RZTA 3P8BA 1RDGA 2A69D 4ZN3B 3KYUA 1B71A 3PWFA 1R0HA 1RDVA 2M4VA 2A6ED 4V196 4AR5A 3ZG6A 3RZ6A 2B5ID 2V0EA 2A68D 2DSXA 1ZRPA 2L0ZA 2XJVA 3RYGA 4AI1A 4AI0A 3P2AA 6RXNA 3B0AB 3B08B 8RXNA 1H7VA 2LCQA 2PVEA 1QCVA 5K2ME 1IU6A 2VL6A 4JADA 2NYDA 1RWDA 4XXBB 4JAEA 1T9QA 3J7Y1 2CKAA 3PIP1 2V3BB 4ZN1B 5DM61 3MPSA 4GS7D 1NXEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LKM A;  1BRF A;  4ME3 A;  1BE7 A;  5AI3 A;  2HR5 A;  2M4Y A;  2RDV A;  3KYV A;  4YWL A;  4POG A;  1CAA A;  1C09 A;  1FHM A;  1SMW A;  1YK4 A;  4POF A;  1RB9 A;  2MS3 A;  1IRO A;  1IRN A;  1B13 A;  1NNQ A;  1IU5 A;  1FHH A;  1YK5 A;  1R0G A;  5IY0 A;  4YWM A;  5RXN A;  2KKD A;  3A44 A;  1YUX A;  1E8J A;  1QYB A;  1R0J A;  1B2O A;  3KYX A;  1T9P A;  1T9O A;  2PVX A;  3KYY A;  1R0F A;  3SS2 A;  1LTL A;  3QVD A;  1BFY A;  1SMM A;  1LKO A;  2KN9 A;  1DVB A;  7RXN A;  1B2J A;  3PZA A;  1RYT A;  4AR3 A;  4AR4 A;  4RXN A;  5AI2 A;  4K9F A;  2PYA A;  1S2Z A;  1S30 A;  1LKP A;  1YUZ A;  4TPU A;  1VCX A;  3KYW A;  1SMU A;  1S24 A;  1BQ8 A;  4AR6 A;  2QL0 A;  1YV1 A;  2GMG A;  1R0I A;  1JYB A;  1DX8 A;  2K2D A;  1CAD A;  1BQ9 A;  3RZT A;  1RDG A;  3KYU A;  1B71 A;  3PWF A;  1R0H A;  1RDV A;  4AR5 A;  3RZ6 A;  3RYG A;  2DSX A;  1ZRP A;  6RXN A;  8RXN A;  1H7V A;  2LCQ A;  2PVE A;  1QCV A;  1IU6 A;  2VL6 A;  1RWD A;  1T9Q A;  2V3B B;  3MPS A; 
#chains in the Genus database with same CATH topology
 1LKM A;  5MFZ A;  2XJR A;  2JI1 A;  4U67 1;  2C6A A;  1FHM A;  5C3E L;  4A3I L;  1RYQ A;  4XGH A;  1RB9 A;  2AUS B;  4TVM A;  4JAG A;  1OWC A;  3PKI A;  3GTL L;  1YK5 A;  2PSM C;  5RXN A;  1QYB A;  1R0J A;  1T9P A;  2PPT A;  1T9O A;  4C2M 1;  3KYY A;  3S17 L;  4BBS L;  1PFU A;  4AHY A;  3M4O L;  5IYB L;  1Z92 B;  1DVB A;  7RXN A;  3S1M L;  1TWG L;  2XJU A;  1Y1W L;  3IU3 I;  4K9F A;  2JA8 L;  4A3J L;  5JVH 1;  2JA6 L;  3LNL A;  3FDJ A;  4TPU A;  1R9T L;  3GTK L;  1SMU A;  2WB1 P;  1BQ8 A;  2YU9 L;  1R0I A;  1JYB A;  1K83 L;  2K2D A;  5DM7 1;  1VZI A;  2A69 D;  2Y0S P;  3KYU A;  4A3E L;  1R0H A;  2A6E D;  3H97 A;  4AR5 A;  2L0Z A;  3LWQ B;  8RXN A;  1H7V A;  2PVE A;  1IU6 A;  2VL6 A;  3HOW L;  5C4J L;  1RWD A;  3HKZ P;  2V3B B;  5IP9 L;  4C3H L;  3MPS A;  3RZD L;  3RZO L;  2JA5 L;  3I4M L;  3HOY L;  1BRF A;  4ME3 A;  5GAD c;  2RDV A;  4POG A;  1CAA A;  4AI3 A;  4QIW P;  1QQT A;  4POF A;  3S2D L;  2C6B A;  3PKJ A;  2Z3R B;  1IRO A;  1B13 A;  1IU5 A;  4BXX L;  1PFW A;  3PO3 L;  2KKD A;  3HOZ L;  2NVT L;  1Y1V L;  5MLC 3;  4BY7 L;  4E6Y A;  3HAX C;  4WFN 1;  2M6O A;  4A3M L;  1TWA L;  1R0F A;  3WWL A;  3QVD A;  3LWP B;  3MQK B;  1SMM A;  5M3F L;  3LWR B;  1VZH A;  3PZA A;  2E2I L;  1I3Q L;  2XJT A;  3HJY B;  2APO B;  3PIO 1;  4UY8 1;  2PYA A;  1IW7 D;  1S2Z A;  3MSU A;  2ZIX A;  3GTJ L;  2J9U B;  3GTQ L;  3K35 A;  5GAG c;  5IYC L;  4AYB P;  3S1Q L;  3P8B A;  5FJ8 L;  1I50 L;  3CQZ L;  2A68 D;  5M5Y L;  2XJV A;  4AI0 A;  6RXN A;  4BY1 L;  3B08 B;  1QCV A;  3S14 L;  4JAE A;  3J7Y 1;  2CKA A;  3GTP L;  3PIP 1;  3PO2 L;  4GS7 D;  1BE7 A;  4AHW A;  3NFP I;  4JAF A;  2HR5 A;  5C44 L;  2HVY C;  4LHL A;  4A3L L;  2Z3Q B;  5MF6 A;  1IRN A;  2B63 L;  3VPB E;  5FLM L;  3WWN B;  2E2J L;  2O5J D;  2V0F A;  3H9C A;  3J7Z 1;  5GAH c;  1SFO L;  2JA7 L;  3LPE B;  5IY0 A;  4C3J L;  3S16 L;  4YWM A;  4A3D L;  2M6P A;  1YUX A;  3LWV B;  5MGN A;  4AHX A;  3I4N L;  3H9B A;  1LTL A;  1BFY A;  3GTG L;  2KN9 A;  4BBR L;  4A3C L;  5M5W L;  2WAQ P;  2NVQ L;  4A3B L;  1TWH L;  1B2J A;  3HOU L;  3M3Y L;  4B8C D;  4AR3 A;  4A3F L;  3S2H L;  4AI2 A;  1ODH A;  4RXN A;  1NXG A;  5AI2 A;  5H1S c;  2XJS A;  2RFK B;  5GAE c;  1S30 A;  2ERJ A;  1VCX A;  3KYW A;  3H99 A;  4AHZ A;  1TWF L;  2QL0 A;  1YV1 A;  2GMG A;  4G6B A;  2JI2 A;  5AN9 H;  1DX8 A;  1PZX A;  3GTO L;  1CAD A;  1F4L A;  3H0G L;  1P7P A;  1BQ9 A;  3RZT A;  1RDG A;  2E2H L;  1B71 A;  3PWF A;  2NVY L;  2VUM L;  2V0E A;  1ZRP A;  3JR7 A;  4JAD A;  2PMZ P;  3S15 L;  3PL5 A;  2R7Z L;  5AI3 A;  2M4Y A;  3KYV A;  4YWL A;  2JI3 A;  2R92 L;  2R93 L;  2AYJ A;  2CR8 A;  2A6H D;  1C09 A;  1SMW A;  1YK4 A;  4A3K L;  4LHN A;  2MS3 A;  4X6A L;  3GTM L;  1NNQ A;  1WJV A;  1PFY A;  1FHH A;  3FKI L;  1R0G A;  3H3V M;  1I6H L;  2XJP A;  4C3I L;  3A44 A;  2XJQ A;  1E8J A;  1B2O A;  3KYX A;  5C4X L;  2CKC A;  2PVX A;  3S1R L;  3SS2 A;  2NVX L;  1LKO A;  2ERS A;  1PFV A;  3LWO B;  1VZG A;  1RYT A;  5MFP A;  3HJW B;  2AQC A;  4AR4 A;  3QQC E;  5EIO C;  4Y52 L;  3S1N L;  3K7A L;  1LKP A;  1TWC L;  1YUZ A;  2EY4 E;  2H12 A;  1S24 A;  4AR6 A;  2BE5 D;  1OWB A;  5EIN C;  4A3G L;  5JVG 1;  5IYD L;  5IP7 L;  5M3M L;  4ZN3 B;  1WCM L;  1RDV A;  2M4V A;  4V19 6;  3ZG6 A;  3RZ6 A;  2B5I D;  3RYG A;  2DSX A;  5M5X L;  4A93 L;  4AI1 A;  3P2A A;  3B0A B;  2LCQ A;  4Y7N L;  5K2M E;  2NYD A;  4XXB B;  1T9Q A;  3HOX L;  4ZN1 B;  5DM6 1;  3HOV L;  1NXE A; 
#chains in the Genus database with same CATH homology
 1LKM A;  1BRF A;  4U67 1;  4ME3 A;  1BE7 A;  4AHW A;  5MFZ A;  3NFP I;  4JAF A;  5AI3 A;  2HR5 A;  2M4Y A;  2RDV A;  2JI3 A;  2XJR A;  2JI1 A;  3KYV A;  2AYJ A;  2C6A A;  1CAA A;  2CR8 A;  4LHL A;  4YWL A;  2A6H D;  4AI3 A;  1C09 A;  1FHM A;  1SMW A;  1YK4 A;  4POF A;  2Z3Q B;  2C6B A;  1RYQ A;  3PKJ A;  4XGH A;  4LHN A;  1RB9 A;  2MS3 A;  4TVM A;  5MF6 A;  2Z3R B;  1IRO A;  1IRN A;  1B13 A;  4JAG A;  3VPB E;  1NNQ A;  1OWC A;  3PKI A;  1WJV A;  3WWN B;  2O5J D;  1IU5 A;  2V0F A;  1FHH A;  3J7Z 1;  5GAH c;  1YK5 A;  2PSM C;  1R0G A;  3LPE B;  5IY0 A;  2XJP A;  4YWM A;  5RXN A;  2KKD A;  2M6P A;  3A44 A;  1YUX A;  2XJQ A;  5MLC 3;  1E8J A;  1QYB A;  4E6Y A;  1R0J A;  1B2O A;  5MGN A;  4POG A;  3KYX A;  1T9P A;  2PPT A;  4WFN 1;  4AHX A;  2M6O A;  1T9O A;  2CKC A;  2PVX A;  3KYY A;  1R0F A;  3SS2 A;  3WWL A;  1LTL A;  3QVD A;  1BFY A;  4AHY A;  1SMM A;  1LKO A;  2KN9 A;  2ERS A;  1Z92 B;  1DVB A;  7RXN A;  1B2J A;  1VZG A;  1VZH A;  3PZA A;  1RYT A;  2XJU A;  5MFP A;  4B8C D;  4AR3 A;  2XJT A;  3IU3 I;  4AI2 A;  4AR4 A;  1ODH A;  4RXN A;  1NXG A;  3QQC E;  5AI2 A;  5EIO C;  3PIO 1;  4K9F A;  5H1S c;  2XJS A;  4UY8 1;  2PYA A;  5GAE c;  1IW7 D;  1S2Z A;  1S30 A;  1LKP A;  3MSU A;  5JVH 1;  2ZIX A;  2ERJ A;  1YUZ A;  3LNL A;  4TPU A;  2H12 A;  1VCX A;  2J9U B;  3KYW A;  1SMU A;  1S24 A;  4AHZ A;  3K35 A;  5GAG c;  1BQ8 A;  4AR6 A;  2QL0 A;  1YV1 A;  2GMG A;  2BE5 D;  1R0I A;  4G6B A;  2JI2 A;  1OWB A;  5GAD c;  5EIN C;  1JYB A;  5AN9 H;  1DX8 A;  2K2D A;  1CAD A;  5DM7 1;  5JVG 1;  1VZI A;  1BQ9 A;  3RZT A;  3P8B A;  1RDG A;  2A69 D;  4ZN3 B;  3KYU A;  1B71 A;  3PWF A;  1R0H A;  1RDV A;  2M4V A;  2A6E D;  4V19 6;  4AR5 A;  3ZG6 A;  3RZ6 A;  2B5I D;  2V0E A;  2A68 D;  2DSX A;  1ZRP A;  2L0Z A;  2XJV A;  3RYG A;  4AI1 A;  4AI0 A;  3P2A A;  6RXN A;  3B0A B;  3B08 B;  8RXN A;  1H7V A;  2LCQ A;  2PVE A;  1QCV A;  5K2M E;  1IU6 A;  2VL6 A;  4JAD A;  2NYD A;  1RWD A;  4XXB B;  4JAE A;  1T9Q A;  3J7Y 1;  2CKA A;  3PIP 1;  2V3B B;  4ZN1 B;  5DM6 1;  3MPS A;  4GS7 D;  1NXE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...