1SMXA

Crystal structure of the s1 domain of rnase e from e. coli (native)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
87
structure length
87
Chain Sequence
ANIYKGKITRIEPSLEAAFVDYGAERHGFLPLKEIAREYFPANYSAHGRPNIKDVLREGQEVIVQIDKEERGNKGAALTTFISLAGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease E
publication title Structural characterization of the RNase E S1 domain and identification of its oligonucleotide-binding and dimerization interfaces.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 16
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature ec 3.1.26.12: Ribonuclease E.
pdb deposition date 2004-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1smxA00
1TXYA 4DV1L 1Y1WH 2VUMH 1AE2A 3HOWG 3CCVA 4A3DH 2CKZB 3HOUH 5HY6A 1X3EA 3KDFB 1VQKA 4JV5Q 4B3SQ 4JI0L 3M9BA 1JB7A 4KHPQ 2JEBI 5C0XJ 4QY7A 2GVBA 3ULLA 4X65L 2Q2HA 4Y7NH 4POFA 5C4JH 4YHHL 4KHZA 3T1HL 1QZGA 2KBNA 1FJGL 5IP9H 3RZDH 2F4VQ 1OXXK 2EQSA 4QQBX 2LXJA 2MFIA 4TVAB 4EX5A 3UE0A 4DV1Q 1PH1A 3PCOB 1UE7A 5IT9c 1Y1VH 1NMGA 1KRSA 1VQ8A 1YVCA 1Q86C 3CCQA 2E2JH 4LF9L 1Q8KA 2WAQG 5C3EG 3A0JA 2BA1A 4IJHA 3HKZG 1S3OA 4C3IH 1A8VA 3F2CA 3CQZH 4LNQA 3HOYH 2NVYH 1V1QA 3HOZG 1TWGH 3PO3H 4X65Q 1N36L 3T1HQ 4JI8L 4L5RC 4YHHQ 5C4XG 3F2BA 2ZTDA 1QVFA 2JE6I 3G6EA 2VL6A 4DV4Q 2JA6G 1SRUA 1K9MC 2R92H 1VQGA 3M3YH 1PYBA 1T9HA 5GROA 3HOVG 4TQUS 1X9NA 2JA8H 1IL2A 4DK3C 4JBMA 5FJ8H 1IBKL 1GVPA 2R6GA 3ULJA 4BY7H 3KJPA 3CMEA 2GVAA 3NENA 2ZM6L 4A3JG 3GTQH 4JI6Q 4A3BG 3CC7A 3UDXA 1HZ9A 4JI1L 3OTOL 2E2IH 2UXDQ 3BJUA 5GQOA 5IYCH 2N78A 3S15H 2E2HH 2Q2UA 4XTCS 2VQFL 1L1OA 2K5HA 1AE3A 5AJ3L 2VUMG 3VDYA 1CKNA 1EIYB 1TWHH 1S72A 1HNXQ 2R7ZH 1UE6A 4PZ6A 4APVA 4A3DG 1L2FA 4IJLA 1QUQB 5IYBG 3HOUG 3RR5A 1K83H 1Q7YC 1IBKQ 3CC4A 3A5ZB 2ZM6Q 2NVTH 4YCVA 4DR4L 4R4QA 1BBUA 2ALYB 5M5XH 1XTDA 4JI1Q 3NBHB 4MNOA 3OTOQ 3G4SA 3PF4A 3TRZA 3S1NH 4C3HH 3CCJA 1R9TH 1SROA 2VQFQ 3M4QA 3PUWA 1XPRA 5LMUL 3HOXG 4DR2L 1YJNA 2YYZA 2IHEA 2MNAA 1U5KA 1OXVA 2NVXH 4OO1I 1Q1EA 2VS1A 3PO2G 2VNUD 1YJ9A 1UEBA 2UUAL 3HOYG 3A74A 4JBWA 3M4PA 1YHAA 5M3FH 1N34L 4HJ5A 4O0AA 3BZKA 3GD7A 1D8LA 5DLQE 4LF8L 3GTPH 1NTGA 2WAQE 3UDIA 5H1SE 5LMUQ 4IFDI 1UE5A 2Y0SE 3PUVA 4DR2Q 1P16A 1OTCA 3HKZE 2JA8G 4LF4L 1I50H 1VQDA 1VQCA 4AYBE 1XNQL 1SFOH 3PIPA 4GKJL 4UP8A 3KLWA 3U4ZA 3F2DA 3GDEA 1VQLA 2NZOA 3W5OA 4IPHA 1YNXA 1XNRL 2I5MX 1XMQQ 4GS3A 2UUAQ 3J81j 4P74A 3UDFA 5K36G 3TS0A 4A3KH 3HOVH 4BA2I 3GTOH 4A93H 3AEVA 1N8RC 2JA5G 3M85A 1J5EL 3PUXA 5M5YH 1AH9A 4JCVE 1JT8A 2R7ZG 3SGIA 4BBSH 3AYHB 1KHIA 1WCMG 4DR6L 4LF4Q 2AMCB 4C2MH 4HIOA 5E7NA 4B3RL 2R7FA 2BA0A 1Q82C 1RL2A 4IOCA 4DV0L 3AFPA 3PIOA 2L15A 1XJVA 1XNRQ 1J6QA 1M1KC 1O7IA 2Z6KC 3PUYA 1HJPA 2N3SA 5GAGC 4JI3L 1IYJB 3GTLH 1KL9A 1UE1A 4AQYQ 5IYBH 4GN5A 1J5EQ 4A3CH 4BXXH 3J7A5 1PYSB 3GTMH 3G71A 1YHBA 1YI2A 2E5LL 1MIUA 4DR6Q 3KFUA 4JOIC 4HJAA 2E8GA 3KOJA 4P73A 4B3RQ 3RLFA 2UUCL 4DV0Q 4DV4L 1LM0A 4DR3Q 2IX1A 1QZHA 3ICEA 1Y14B 4BBRH 1VQAA 1ASYA 1BKBA 3HOXH 5M3FG 1Q81C 4WJ4A 4GN4B 4DV3L 2K5VA 4LF5L 2RHQB 1X6OA 4JI3Q 1VQMA 2UXCL 5IP7H 3I4NH 4IFDG 4A3FH 2WFWA 1FGUA 3PSIA 3CPWA 4P72A 2OCEA 3PO2H 1PH2A 1VQHA 2Y0SG 3GTGH 1N32L 4JI6L 2E5LQ 4JBKA 4A3IG 1VQNA 1XPUA 4DK6C 1X3GA 3F1ZA 4AYBG 1K73C 2ES2A 2VW9A 1E22A 2UUCQ 1BBWA 2WB1E 1W3SA 2NVQH 2CQOA 2PQAB 2VQEL 4GNXB 2CWAA 4A3KG 1HNXL 4C3JH 4A93G 4DV3Q 4LF5Q 4JC0A 3W1BA 4UP7A 1PV4A 2RHSB 3S17H 4OONA 2HIVA 5LMNL 3MXNB 1PHJA 2R93G 1HNWQ 3H15A 4BBSG 1HZAA 1N32Q 4GOPB 1VQIA 1JE5A 1KRTA 1V9PA 2YTVA 2Z0SA 3MEFA 2K50A 3HFZB 1HZCA 4JI5L 3S1QH 1KQSA 4JI4Q 1PH3A 3CMAA 1Q1BA 1LTLA 2HIXA 3RLNA 1WI5A 2JA5H 2VQEQ 4HIDA 4NB3A 1H95A 4IFDJ 5IWAL 3UDGA 4R4TA 2LSSA 4X66L 1WCMH 3L7ZC 3I7FA 1VQ4A 4A3CG 4BXXG 3GO5A 4KLKA 5LMNQ 2A19A 4A75A 4YCUA 2Q2TA 1TWFH 4X64Q 4OWXB 4RG1A 4JYAL 2Z6KA 2DUDA 1NY4A 5C0XI 3CCUA 4RMFA 2JK8A 1HNZL 2VZAA 3STBD 3BU2A 5BR8Q 1EYGA 1WOCA 1PVOA 2D62A 1EQQA 1HR0L 4HJ9A 1OXSC 4JI5Q 3RN2A 4BBRG 1K8GA 2K14A 2JJQA 4UY8C 2UXCQ 1XMOQ 3S2DH 4JOIA 3ER0A 5IWAQ 5IP7G 3I4NG 4LUVA 4X66Q 3CCSA 2JA7H 1KAWA 4A3FG 1QVGA 1TWAH 4L5QA 1PA6A 4LUZA 3F8TA 1XMQL 4BY1G 1JJCB 2OQKA 1X56A 4JYAQ 4DR5Q 3T1YL 1G291 1YIJA 1HNZQ 4ME3A 1UWVA 1Q46A 2YTYA 3RLOA 4AH6A 3ZJYC 3S14H 4GLAC 3FKIG 1HR0Q 1D7QA 4DNIA 1P8LA 4A3GH 3RZOH 2WB1G 4XIGS 3EBEA 3CW2C 3U58A 1N33L 1KXLA 2OWOA 3JAMi 1CUKA 1MKHA 4A3IH 1N9WA 4QJFA 2AWNA 4MTNA 4DUZL 1VQBA 2IT1A 4X6AH 3CP0A 1NBWA 5C4XH 1YITA 2B63G 4A3MG 1WYDA 3T1YQ 4A3EG 3GTKH 4LFBQ 2HHHL 3HKSA 5C44H 3W1GA 2PMZE 4B3TL 4IPGA 4R1JA 5EAYA 4AQYL 3S24A 3CF5A 3TS2A 2QEXA 1QUQA 1L0WA 4YCWA 3H3VI 2R93H 1M90C 1GO3E 4OXPA 1WFQA 1N33Q 1I94L 3TREA 3J81i 3S16H 1FVIA 3B6YA 3WWVA 4DV5L 2N49A 3KF6A 3CCMA 3OYYA 2K75A 4QIWE 3K81C 1KIXA 1A63A 1EWIA 4DUZQ 4DR3L 2KENA 3I2ZA 5IYDG 4YWLA 1YBYA 2EIFA 4DV2L 3S2HH 3DLLA 4IO9A 3LGJA 4DR7Q 1IXRA 3EN2A 2YU9H 2AHOB 3D31A 2HHHQ 5JJIA 3CCLA 2UXDL 4OX9L 2ZJRA 1PH9A 4B3TQ 1IZ6A 5FLXc 3RN5A 3AQQA 4QL5A 2VY3A 5LMNW 1YZ6A 3DM3A 1ASZA 4ALPA 1LUZA 1PH4A 1PFSA 2CWPA 4LF7Q 3G48A 2BH8A 2JA9A 4LFCL 3CXCA 1I94Q 2JA7G 4OO1G 1HZBA 4DV5Q 5ELOA 1Q12A 1IBML 5J3BA 4FDBA 1X3FA 1PH6A 3CCRA 2A1AA 4IPCA 4DV2Q 1K0RA 3CAMA 4LUOA 4X62L 4MZ9A 1SN8A 2ASBA 1Z9FA 1S40A 3GTJH 2PNHA 4DPGA 3U50C 2Q2IA 4GN3B 2OQ0A 1U0LA 4DAYB 1L1OB 3KJOA 3ULPA 1VQPA 5ELNA 3J80i 4GNXC 1XPOA 4JI2L 4OX9Q 2ATWA 2ZJQA 4A3GG 4GKKL 1HNWL 1C9OA 1CKNB 4UPAA 2ZJPA 4LWCA 3CCEA 3S1MH 2NZHA 2GN5A 2NN6I 4HJ8A 4BY1H 4LFCQ 1B70B 2C35B 2HT1A 4NPSA 5M3MG 3K8AA 1IBMQ 2CFMA 4OWTB 1CSPA 4AIMA 4BA1I 4R4CA 4DR1L 4GOPC 1HR0W 3FKIH 5GAHC 1VQ9A 4JI4L 1IBLL 4A76A 2JEAI 4K0KQ 1E24A 4X62Q 4HIMA 4L5SA 3AFQA 3I4OA 5C44G 1EOVA 1E1TA 2FXQA 4P71A 1K3RA 4JI2Q 1FL0A 4GKKQ 2AKWB 4NXML 2LXKA 4JBJA 4LW1A 4PZ7A 2F3IA 1BVSA 2I0QA 4Y52H 4X64L 1EFWA 4JI0Q 4JI7L 4EQ5A 1W2BA 2KCTA 1V43A 1A62A 2N8NA 5BR8L 1YHQA 2IX0A 4A3EH 4A3MH 1JJ2A 2B63H 1JJGA 1VQFA 2OTJA 1VQEA 1HH2P 4DR1Q 2B29A 1PH7A 2MO1A 3PUZA 4A3LH 1RIPA 2XTIA 1QVCA 2IHFA 1G51A 2HQLA 3JC66 1IBLQ 1FJGQ 3I4MG 3IRBA 3KDFA 4PG3A 2XGTA 1E7ZA 4R4OA 1XMOL 2KHIA 1SMXA 4B3ML 3EIVA 4LF6L 4O2DA 1VQJA 1MJEA 4NXNL 4DUYL 1Z47A 3H0GG 4NXMQ 4GLVB 4HIKA 1LYLA 2K52A 4IPDA 2ZTEA 5JEAG 3L2PA 1EQRA 3STBC 1I3QH 4LFAL 2YV5A 1VCIA 4LF9Q 1VS0A 5IE8A 1YJWA 1SR3A 5JJKA 4JI7Q 4DV6L 5IYDH 4DR5L 1TWCH 5M5WH 4HJ7A 2UXBL 3JAMc 2B3GA 1OXTA 1N36Q 3UE1A 4JI8Q 1NJIC 3E9HA 2KCMA 1NMFA 2EXDA 4H02A 5FLMH 1Y1WG 1VQ6A 3PGZA 3Q8DA 4B3MQ 3RNUA 4LF6Q 4DV7L 1PH8A 4NXNQ 4DUYQ 4DKAC 1I5FA 3PF5A 4LFAQ 3S1RH 2NN6G 3J81c 4DV6Q 3KF6B 2UXBQ 4LFBL 2UUBL 1X65A 3NEMA 2BH2A 2PQAA 4GNXA 5IP9G 1NE3A 1WJJA 1KD1C 3L0OA 4P75A 3HOWH 2WP8J 3KYHC 2PI2E 2AWOA 4PZ8A 2RF4A 3K7UC 2YTXA 5AJ3Q 4IOAA 1E1OA 2V1CC 5JEAJ 1Y1VG 4DV7Q 4WJ3M 3FHWA 2JQOA 2H5XA 5GAEC 4GOPA 4J15A 5M3MH 3M7NA 1I6HH 1DGSA 4JG2A 2KHJA 2RCNA 4R4IA 2D0OA 2QA4A 3E0EA 1CKMA 4DR7L 2OTLA 4PMWA 3E9IA 4QGUA 4GLXA 2UUBQ 1YEZA 3PO3G 1VQOA 3D0FA 4OWWB 4DR4Q 1G6PA 4A3LG 2I5LX 3K0XA 3K80C 1CSQA 1EIFA 2MO0A 4UP9A 4POGA 3NELA 2R92G 1GD7A 2K4KA 3H3VH 4LF7L 4YY3L 3U4VA 2R7DA 3CPFA 3M4OH 2UU9L 4DAMA 5C3EH 3OW2A 2MQHA 5FJ8G 3J80c 4BY7G 4L5TA 1SE8A 1GKHA 2D0PA 2IY5B 2CCZA 5GADC 3HOZH 2QGQA 2DGYA 2F52A 2ID0A 3KF8B 1K8AC 2K5NA 5C0XG 2JA6H 3I4MH 4YWMA 1C0AA 3CD6A 3I55A 1B8AA 1GM5A 2ZTCA 4YWKA 2A8VA 3FP9A 5IYCG 1X54A 1CKOA 1N34Q 5HGQA 5FLMG 3A5UA 1EUJA 3H0GH 5IY0A 1KC8C 4LF8Q 5JJLA 4JV5L 1L1OC 1VQ5A 1VQ7A 4B3SL 1E3PA 3ERSX 4YY3Q 1PH5A 4A3JH 3I56A 2I5HA 2UU9Q 4KHPL 1B7YB 1SLJA 1A0IA 1JMCA 1C7YA 1XNQQ 3BZCA 3CC2A 4KI0A 4A3BH 1OXUA 3TEHB 4GKJQ 3J7ZC 2PI2A 3PV0A 4K0KL 2F4VL 3TQYA 1MJCA 4A4IA 3K7AH 1X55A
chains in the Genus database with same CATH superfamily
4DV1L 1Y1WH 2VUMH 1AE2A 5IGDA 1ICFB 2P5ZX 1AFPA 3KDFB 4JV5Q 4C1NI 3R3OA 1YNNC 1C8CA 5C0XJ 3ULLA 3QR8A 3T1HL 1CI3M 4POFA 4YHHL 1D5ZC 1CA6A 1FJGL 2F4VQ 1AW7A 1I6VC 3AMUA 3NPPA 2MFIA 1ENAA 4NP5A 5J22A 4BY1B 1PH1A 1Y1VH 1KRSA 3VR6A 1YVCA 4TKOB 3CCQA 1Q86C 1VQ8A 3MEHA 2K5DA 3DXJC 4LF9L 3FKIB 2NB0A 2PPBC 4IJHA 3Q22A 2WB1B 1NCVA 1A8VA 3F2CA 3CQZH 4ZRZA 3HOZG 1F9SA 4X65Q 5CC4A 1N36L 1ET9A 2K1BA 4KTAA 1SRUA 1K9MC 4DNTB 4IN3A 5GROA 1X9NA 4DK3C 4A3EB 1IBKL 3BDLA 1EQVA 1FGBD 1BO0A 2QEJC 4A3BG 3CC7A 1HZ9A 1DYQA 3J81E 5FO7B 5EBCA 1L1OA 2C9OA 2K5HA 2RDFA 1EIYB 1BOSA 3E3XA 5M5WB 1UE6A 5BN5A 1L2FA 1NUCA 4IJLA 5IYBG 3HOUG 2A68C 4JK1C 1XYIA 1D5XC 4XT3B 4Z9CB 4KD3A 4DR4L 2L1BA 1BBUA 3J7AF 3NBHB 3G4SA 1TWAB 1R9TH 2H4OA 1XPRA 3OWEB 1QNUA 2D9UA 2ENBA 1FR3A 3D3RA 3H6MA 2NVXH 3TN2A 1A3VA 2G9HD 1B1ZA 3J80E 5D65A 3HOYG 3GQBA 5CV6A 4HJ5A 3BZKA 4LAAA 3GTPH 1I6HB 1NTGA 2WAQE 4IFDI 1UE5A 2KVMA 4DR2Q 1P16A 1JB3A 3GV3A 4AYBE 2A69C 1ONLA 4GKJL 3M4YA 1SSOA 2EY6A 3F2DA 1Q8IA 1VQLA 3W5OA 1TVXA 1LTAD 3UDFA 3TS0A 4A3KH 4HR7B 2F0SA 3AEVA 1EY9A 1AH9A 3HOZB 4JCVE 2R7ZG 2VXWA 4BBSH 3QB3A 3K57A 1S4ZA 4B3RL 2NBFA 1Q82C 5EKKA 2LKVA 2L15A 5EKIA 3H0GB 1XNRQ 1PFBA 5C3XA 1O7IA 1EYAA 2N3SA 1IYJB 4K5WA 4A3BB 4AQYQ 5IYBH 1ZYRC 2F0HA 5DAUA 3KFUA 4KJOA 2LFNA 3RLFA 1RJTA 1ICWA 2EZVA 3HOUB 1QZHA 1Y14B 1EY8A 1VQAA 3S1MB 4GN4B 3RD4A 1RCVD 4JI3Q 1LTTD 1VQMA 5IP7H 4Y7NB 3TP7A 1PTOC 2OCEA 1PH2A 2FHTA 2E5LQ 3KF8A 4JBKA 4A3IG 1VQNA 2L0CA 1XPUA 4FO2A 1TY0A 1V8QA 2UUCQ 2E2JB 2WB1E 2O4XA 2CQOA 2PQAB 3J80L 1HNXL 1GHKA 4C3JH 4DV3Q 4Q5VA 2F1MA 2FMCA 4IQZA 3HOYB 3PO3B 1LT4D 5LMNL 1TWGB 1HNWQ 4HEDA 3H15A 4M1UB 1HZAA 3NWSA 5EPJA 1N32Q 2R92B 3BDCA 1JE5A 4MTKA 1KDCA 5JOBA 5FLXL 3M3YB 3E5SA 3D4RA 3MEFA 3HFZB 4CKEA 1PH3A 3BVZA 1Q1BA 3RLNA 1WI5A 2VQEQ 1VF7A 1TWCB 4K6LA 5IWAL 3MZ5A 3L7ZC 3I7FA 1JOOA 4A3CG 4BXXG 2A19A 2E2HB 3MA2B 1I4QA 3K6OA 4X64Q 3CCUA 5C0XI 4IALA 3STBD 2JSOA 2D62A 1EQQA 1LTGD 3RMHA 4ODGA 4UY8C 3S2DH 2NVTB 3ER0A 3QG1A 1S5ED 3I4NG 3CCSA 1F2YA 1B44D 4L5QA 1HXYD 1PA6A 5IGFA 1H9JA 4LMQD 1JJCB 2OQKA 1WTXA 4JYAQ 2KUMA 1UWVA 4N8FA 3V05A 1PRTD 1EYDA 1D7QA 1HTPA 2KOLA 1MHWC 1SYDA 4J1MA 1JC7A 1KTKA 4P2CB 4ZAIA 5I2XA 4NKLA 5ELBA 3U58A 1BF4A 1ENCA 1QILA 5IOCA 4CKCA 4A3IH 1A3UA 4QJFA 2CQAA 4MTNA 1VQBA 4X6AH 3CP0A 4IUUA 1NBWA 3OIPA 1YITA 1A15A 5M9OA 3MXPA 4A3MG 3M4OB 1EZ6A 4DXGA 3C46A 1S5CD 1QJOA 3HKZB 4IPGA 5C6AA 3CF5A 3KBXA 2Z8LA 2JA6B 1I94L 3NSWA 3S16H 1FVIA 3KF6A 4DNRB 1BCPC 4E6IA 2K75A 4LJZC 3HOVB 2KENA 1HRJA 1HUNA 4DV2L 4HCEA 4ILWA 1LTSD 2BE5C 2KCNA 2K7VA 1WTQA 1RDPD 2RKSA 4OX9L 4K8IA 3I90A 5LMNW 1II3A 3A8KE 1PH4A 1PFSA 2CWPA 2BH8A 4LFCL 1DD2A 4OO1G 2M00A 1Q12A 2J4XA 3T56B 2SDFA 5CV8A 1X3FA 3GTLB 4A3DB 3CCRA 2A1AA 4IPCA 2HD3A 4X62L 2PQEA 1SN8A 1S40A 2PNHA 3U50C 2Q2IA 2EOTA 5CORA 4JI2L 5ELNA 4GKKL 1TT2A 1C9OA 1CKNB 1TS2A 4K5VA 1PXUA 2GN5A 4KN4C 2CW0D 3P7JA 4UAIA 1LO5D 4NMZA 1JQYD 4DR1L 1IKLA 3FVQA 5GAHC 3I4NB 1SDFA 4K0KQ 2HCIA 3PO2B 1EOVA 2SOBA 5COYA 1B53A 2F3IA 2PZUA 4Y52H 1B9NA 1LTID 1A2UA 4EQ5A 1W2BA 2KCTA 3EJIA 2N8NA 1YHQA 4A3MH 2JA8B 1HH2P 4PMCA 4A3LH 3PUZA 4ZCKA 3I4MG 4CHTB 3PMFA 3N6RA 4RKBA 2K04A 4PG3A 2XGTA 4R4OA 3GTQB 4B3ML 4LF6L 4DUYL 4NXMQ 4GLVB 4HIKA 2K52A 5JEAG 1I3QH 2I46A 2VB3X 3S1QB 4JI7Q 2JA5B 4HJ7A 3JAMc 3R2IA 3BZDB 1ILQA 4L6TB 4QUCA 1Y8PB 1SNQA 1B3QA 4H02A 1MBYA 3Q6SA 3PGZA 3Q8DA 3RNUA 4FXDA 5CV9A 2RDHA 4OO1H 1LV9A 1I5FA 4V190 2NN6G 2D2CC 2BH2A 1RODA 5IP9G 1NE3A 1KD1C 3NHHA 3L0OA 4P75A 3TZUA 4S3SA 4EQPA 4IOAA 5KIXA 2F0PA 2F4IA 3FHWA 4XQNA 1G2TA 4J15A 1DOKA 2MP1A 1DGSA 4JG2A 2KHJA 2K6AA 3RZOB 2OTLA 4GLXA 2Y0SB 2SEBD 1TR5A 3LWUA 1JOKA 1CSQA 1EIFA 1T5EA 3TBIB 2Z9HA 5KEEA 3H3VH 4LF7L 3CPFA 4DAMA 5C3EH 2MQHA 5IGCA 3GTKB 1SE8A 5C3WA 3C3LA 1F77A 2ID0A 3I4MH 2R93B 4YWKA 2A8VA 3FP9A 4HAEA 2JYOA 2K5WA 4LF8Q 5JJLA 4G4KA 4JV5L 5JEAH 3R8BA 5EGTA 1VQ7A 3S2HB 3ERSX 1A0IA 3BZCA 1A3TA 1WTWA 1Y69U 1TY2A 3PV0A 2F4VL 3TQYA 1KLUD 2F3WA 3QOLA 3E0JA 1U4PA 2RDGA 2RBMA 4C3HG 3HOWG 1SNCA 2L5TA 1IW7C 3CRKC 1Y8OB 3NTIA 5LL6S 4B3SQ 1HUMA 2NN6H 1JB7A 4KHPQ 2JN4A 3GTJB 2GVBA 4X65L 2Q2HA 1V1PB 2IW3A 4RA8A 5IP9H 3NP8A 2XVSA 5IIFA 2LXJA 4TVAB 1C4QA 3UE0A 5C4HA 1SJHD 1UE7A 2HDLA 2WAQG 3A0JA 3TMEA 2BA1A 1ENFA 3QOJA 1S3OA 2L11A 1YNJC 2PNRC 1V1QA 2Q8RE 1KXLA 4L5RC 2VL6A 5KNBA 4EVOA 3A8IE 2DNEA 4K2KA 2B63B 4OELB 2R6GA 3ULJA 2GVAA 2RA4A 4A3JG 4DAPA 4JI6Q 1SMYD 2PZTA 5LL6X 3BJUA 1PFNA 2N78A 4DAYA 2VUMG 2WACA 1TWHH 1S72A 4APVA 4WFN3 1STEA 3RR5A 2XNAC 3CC4A 4DAVA 1JICA 2EJMA 2NYZD 3URYA 3PQIA 4R4QA 2EYHA 1ILPA 4MNOA 3S1NH 5I6WA 4C3HH 3HOXG 1SEBD 4DR2L 1YJNA 3DWPA 3VR2A 1OXVA 3ND9A 3HGBA 1M8AA 2B2TC 4R8IA 2AQ1B 4CBVA 3WOEA 4F88A 2B8FA 5DM63 1YJ9A 3HOWB 1F9RA 1O80A 3D8GA 1BBXC 3A74A 3FPPA 2WV6D 1D8LA 2OT2A 5DLQE 3UDIA 1IHZA 4RWSC 5E4XA 4H0LC 2Y0SE 3X3MA 1VQDA 1SFOH 4XQJA 5JPNC 3X3NA 1GUOA 3GDEA 4ZUIA 2NZOA 1XNRL 1YNXA 2PMZB 4GS3A 2UUAQ 1QB5D 5G3LF 5JAVA 1XX8A 4KKUA 2ZXPA 2B2UC 5C4ZA 4A93H 3GTOH 1PYWD 3DWQA 3PUXA 1JT8A 1IYVA 1ZXTA 1KHIA 1CA5A 4LF4Q 2AMCB 1SBBB 1R4QB 2R7FA 5C5LA 2BA0A 3DEPA 1RL2A 3AFPA 1XJVA 1ZEQX 4IUVA 3V96A 4A3JB 4DK1A 2NTTA 1GJXA 5GAGC 4JI3L 1Z6HA 1TS5A 3K5LA 1KL9A 1UE1A 5EKLA 3OMCA 5IGBA 3GTMH 3VYTA 1YHBA 2E5LL 4HJAA 4DFAA 3KOJA 1Y1WB 2EJGC 2ICIA 2WIIB 2UUCL 4DV4L 1LM0A 4DR3Q 2IX1A 2K5QA 2O5IC 1ASYA 1BKBA 4DK0A 3HOXH 4DV3L 2B2TA 1JOQA 1O7LA 2CH4A 3W3AA 4IFDG 3SK4A 1FGUA 3PSIA 2KECA 1N32L 1WD0A 2WKDA 3ND8A 1B4OA 1EY7A 1Y1VB 1BBWA 2NVQH 2WINB 2VQEL 1G8ZD 2CWAA 4A3KG 1JWUD 4LF5Q 4EQNA 3W1BA 1PV4A 3CQZB 2HIVA 2OF1A 4BBSG 1HHVA 4GOPB 1KRTA 3DMUA 5CYUA 2YTVA 1KQSA 4KV6A 3FPUB 2NZ1D 5CMDA 3A55A 3Q23A 3SK8A 1DOMA 4DN4M 1H95A 4R4TA 2LSSA 4IUNA 4RHRA 3GO5A 5JVG3 3I73A 3KLRA 4RG1A 4JYAL 1NY4A 1PVOA 1HTLD 1U4MA 5TSSA 5EPKA 4JI5Q 2SNSA 2V4DA 2Q8TA 3NWTA 2EPBA 4KD4A 2B2WC 2UXCQ 1XMOQ 5IP7G 4LUVA 4X66Q 1KAWA 4XYOA 1TWAH 4R8NA 1R9TB 1XMQL 3OSOA 1X56A 4DR5Q 1BDOA 2NVXB 1Q46A 2YTYA 4GLAC 1HR0Q 2E75C 4OHJA 4FP5D 1VDZA 4IFDH 4C3JG 4EQOA 1FNVA 5T1IA 1HQMC 1CUKA 3OW7A 1SAPA 2QF7A 3IFDA 3GTPB 1A2TA 1K3BC 2QKIC 3T1YQ 4LFBQ 3IKJA 2F0UA 3W1GA 2PMZE 4R1JA 3S24A 3TS2A 2ZXOA 1L0WA 4YCWA 4OXPA 4ZUJA 1WFQA 1N33Q 3J81i 2L4NA 3P1HA 4IUPA 3SDZA 2HQEA 3CCMA 3OYYA 4A3KB 3K81C 1KIXA 1EWIA 4DUZQ 1B3AA 1F2ZA 5IYDG 1YBYA 2EIFA 1LTBD 3LGJA 4DR7Q 4XT1B 1IXRA 1R4PB 5CV5A 4BBSB 3D31A 2HHHQ 4J6HA 5JJIA 5FLXc 3P75A 3AQQA 4QL5A 3J81L 1ASZA 3DM3A 4ALPA 1KDAA 3G48A 2F3VA 3KUPA 5ELOA 3H94A 1BQQT 2ZXRA 4ABNA 4LUOA 4ID6A 2B2WA 2ASBA 3EQLC 1PDQA 1PLFA 1U0LA 3KJOA 2ATWA 3J80i 5C5MA 2ZJQA 2IJ0A 1SE4A 4UPAA 1U4RA 2EYLA 4LWCA 1B9MA 5FK9C 3CCEA 2EYMA 3S1MH 1G6ZA 1B70B 1H9SA 5M3MG 1IBMQ 2FINB 4BA1I 4AIMA 4JI4L 4A76A 1JORA 1E24A 2ZT9C 2XIWA 1E1TA 1RTOA 4P71A 1K3RA 1W6JA 2AQ3B 2NVYB 4NXML 1SNOA 1A6XA 4LW1A 3A8JE 2LS01 2KHSA 1DJRD 1H9RA 3A56A 3C1FA 4JI7L 4H44C 1V43A 1PTOH 5BR8L 2IX0A 4ME5A 2PZWA 1EY5A 1XTCD 1BR9A 3QO2A 1VQEA 2A6ED 2MO1A 3I4LA 2F0TA 1FJGQ 3OMGA 4M8AA 1X3PA 5T1GA 2OXPA 5KRUA 1VQJA 3DUZA 1Z47A 3AU7A 1LYLA 2K03A 3STBC 4LF9Q 2YV5A 3G6JB 5J39A 1VS0A 1YJWA 1SR3A 1UNSA 5IYDH 1TWCH 5C0XH 2R7ZB 2PO4A 1N36Q 2R3ZA 2WKCA 5FLMH 1EU4A 4HCSA 3PIO3 5KYLA 3NXWA 5M5XB 1PH8A 4NXNQ 5CR3A 3PF5A 4LFAQ 1PRTC 3S1RH 1GOZA 3KF6B 4PQXA 1SYCA 3KK7A 1X65A 1K0SA 4DXFA 3NEMA 2PQAA 3S2DB 3NBIA 4DU9A 2WP8J 2QDLA 2PI2E 2F03A 2RF4A 3K7UC 2YTXA 1E1OA 2V1CC 5JEAJ 1PRTB 2I07B 2MHVA 3I72A 5M3MH 3M7NA 3LX0A 5DNFA 3MHBA 2QA4A 1STGA 4C3IG 4PMWA 4QGUA 1SYGA 2UUBQ 1YEZA 4DR4Q 1VQOA 1HCZA 5KYIA 4A3LG 2F0VA 4A3IB 2CVRA 3M4OH 1CTMA 3OW2A 4BY7G 1MSHA 1GKHA 2LMCB 4PMBA 1PTOF 2Z6BA 2QGQA 2DGYA 2F52A 3G7LA 2IWHA 3F2UA 1K8AC 3SK5A 2JA6H 2F0KA 4YWMA 3T13A 2G9DA 1KNEA 1X54A 3S16B 4C2MB 5I4DA 1EUJA 3CHBD 1KC8C 1PZID 4XXEA 3T4AC 1K8MA 4B3SL 2EY5A 4YY3Q 1AEXA 4KHPL 1RKNA 1JMCA 1EZ8A 1C7YA 2Z1CA 3CC2A 4GKJQ 3K5OA 2E76C 1QG7A 2OEOA 2EYFA 3K7AH 2F0NA 4HTHA 2Q8IB 3CCVA 4A3DH 5HURA 5HY6A 2CW0C 4JI0L 3M9BA 4XDXA 3AB9A 1EEFD 3BG3A 4ZKBB 4FF3A 1XXGA 4QY7A 5C4JH 4CKBA 4KHZA 3OIQA 3RZDH 2XN9C 1OXXK 2EQSA 4C1NK 4EX5A 3VYRA 5IT9c 1NMGA 1Q8KA 1GHJA 5C3EG 3UI2A 2NUCA 2QCPX 1TIID 2K01A 4C3IH 2K05A 4LNQA 3RUZA 1C0AA 5KNDA 4HSPA 4JI8L 1BUVT 3JAME 1HPCA 3HG9A 1VQGA 4OEMB 1QWYA 2JA8H 1CQVA 4A3MB 4JBMA 1GVPA 4BY7H 2F0OA 3FEWX 3KJPA 4JVZA 1NAPA 3NENA 4FYDA 2E74C 3GTQH 2NTSA 2RCFA 1MGSA 2E2IH 5CV4A 1SXTA 5GQOA 2XWJB 5I6YA 4MIUA 3S15H 2Q2UA 4XYQA 4IUQA 1SE3A 1O7YA 4FNFA 1LT3D 4MHEA 1I3QB 5AJ3L 4B08A 3VDYA 1CKNA 1HNXQ 1RTNA 3V2TA 1CFMA 4PZ6A 1QUQB 1Q7YC 1K83H 3ONAB 4G7OC 2ZM6Q 1GUWA 1BCPF 1E2WA 4JI1Q 3TZDA 3OTOQ 3C2PA 3TRZA 2N55A 2O5JC 2L9HA 1GUSA 2VQFQ 5L37A 1STNA 3MXGA 4FF4A 2CHBD 4QMGA 1DXMA 1HA6A 4QF4A 4OO1I 5EBDA 1ESFA 1Q1EA 2R61A 2VS1A 2HUGA 4MN3A 3N52A 2UUAL 2M2LA 1GXDC 4K8JA 3M4PA 1SE2A 5M3FH 4RHSA 1N34L 1AZPA 2HDMA 4O0AA 3GD7A 5LMUQ 1OTCA 3PUVA 3HKZE 3ERQA 4LF4L 1I50H 1VQCA 2KJXA 1XNQL 4FXKC 4UP8A 3KLWA 3U4ZA 2I5MX 4WORA 5BN3A 4P74A 5I9OA 2X69A 2A6HD 3OOCA 3M85A 5M5YH 5I2YA 3JAML 4QIWB 2Z4IA 4KKTA 1EY4A 3AYHB 1WCMG 3I4MB 1LACA 4HIOA 3OWFA 1QNKA 1UEAB 5E7NA 3R2TA 3BVGA 3J7YW 3NE5B 3PIOA 1SJED 3NK9A 1M1KC 2Z6KC 1HJPA 4RAUC 3BVMA 2EXZA 1E2VA 4GN5A 1J5EQ 3ZYYX 3G71A 5KNCA 3NTHA 1Z7TA 1MIUA 4DR6Q 4JOIC 2E8GA 4P73A 3QWNA 1TS3A 4DV0Q 1K8OA 4BBRH 5ISRA 4KHVA 1Q81C 4WJ4A 1PZJD 4LF5L 2K5VA 5D14A 1X6OA 1M4VA 4A3FH 2WFWA 4P72A 4IUTA 1VQHA 3GTGH 3U9OA 1IKMA 4DK6C 3F1ZA 4AYBG 1WD1A 1KDBA 1F2MA 2KQ3A 1BNZA 2VW9A 4TSSA 1E22A 5ELCA 1E0BA 3BYYB 5G3LD 4PNYA 4GNXB 4A93G 3MXUA 1CM9A 3S17H 3MXNB 1EY0A 1SMYC 5EQ0A 3I70A 1VQIA 3K58A 4QCLA 3MAQA 1V9PA 2K28A 3HZXA 3NQTA 3TP6A 4JI5L 1F2LA 3CMAA 4PV1C 1LTLA 5EJWA 2EE1A 4HIDA 4IFDJ 2DNCA 4X66L 1WCMH 3BS1A 1I4HA 4KLKA 4A75A 3P20A 1TWFH 2D5DA 5A2QE 1JWMD 3SEBA 2Z6KA 4BS9A 2F0JA 3BU2A 1TWHB 1MSGA 1HR0L 1K8GA 2K14A 1O7ZA 4JOIA 2JA7H 1QVGA 3S1NB 4C3HB 4LUZA 3F8TA 1I4GA 4BY1G 3T1YL 1HNZQ 4OIKA 4ME3A 3RLOA 3S14H 1TU2B 3ZJYC 3FKIG 3L9AX 4A3GH 1X3QA 1FYCA 2WB1G 3VA5A 1RHPA 3CW2C 3EBEA 4U673 1N33L 1LT6D 5DEHA 3R93A 2OWOA 1N9WA 5FO8B 2B39A 5ELEA 4DUZL 3MC0B 1F9QA 2IT1A 3VR3A 3A54A 3NUCA 5C4XH 3EVQA 1WYDA 4A3EG 2SNMA 4TRDA 1I4XA 5FOBB 2WAQB 2HHHL 2RVLA 5C44H 2TMPA 1W6KA 4AQYL 1SFOB 2JXMB 1CZGA 3A7LA 1M90C 4IURA 4X3TA 3WWVA 2N49A 4QIWE 4U68A 5KGUA 1A63A 4A93B 4ZK9B 1TQOA 4NDXA 3DLLA 1F9PA 4IO9A 3IFTA 3K5NA 3EN2A 2YU9H 3VR4A 3CCLA 2ZJRA 1PH9A 4B3TQ 1IZ6A 3RN5A 3BYTB 2VY3A 1YZ6A 1LUZA 4RCOA 1G2SA 3EFXD 5D3DA 4LF7Q 3IAYA 3BDOA 3CXCA 1HZBA 4DV5Q 2VUMB 1IBML 1GUNA 1PH6A 1ML0D 4O42A 1K0RA 3GTMB 4MZ9A 4DPGA 4GN3B 2OQ0A 1L1OB 3ULPA 2UXDQ 1ESRA 1HNWL 2EY2A 3NQIA 1O78A 4HJ8A 3HS0C 1EYCA 4BY1H 3KBGA 3HOXB 4NPSA 2CFMA 1U9RA 4IZ8A 4GOPC 1B50A 4G57A 1YNND 1HR0W 1VQ9A 3FKIH 3C1EA 1NNXA 1CK1A 4L5SA 1DZ1A 3AFQA 1I4RA 2H1EA 5E3FA 4K2LA 1EWHA 2FXQA 5CBAE 1FL0A 2AKWB 2LXKA 4PZ7A 4RH6A 4UDUC 2B2YC 1BVSA 4X64L 2NVQB 3H91A 4B9WA 2A74C 1A62A 2B2UA 4K14A 4A3EH 1VQFA 1PH7A 2B29A 4HN7A 3PIP3 1QVCA 1U4LA 1G51A 2HQLA 3JC66 1IBLQ 3IRBA 3SR1A 2X6LA 3KDFA 3O13A 1TKWB 1E7ZA 1SMXA 4RFBA 5I9PA 4O2DA 4NXNL 3H0GG 2MJ8A 1QOHA 4ULLA 2F0IA 3L2PA 1STAA 1EQRA 3D6WA 4LFAL 1UUPA 1VCIA 5IE8A 2B8GA 3FMCA 1AZQA 5JJKA 1AP0A 4RGMA 5M5WH 1EIGA 2X6GA 2BOSA 3UE1A 4F87A 2KCMA 1NMFA 1STHA 3IL8A 4HSVA 3WDNA 1FNUA 4DKAC 4DGZA 1HQRD 3J81c 4DV6Q 2A68D 3D4WA 2UXBQ 2UUBL 1D6EC 4KK7A 5JVH3 2EVBA 4KY6A 1WJJA 2A5HA 5EPLA 4CGYB 1DONA 2AWOA 4PZ8A 1EIHA 2MPMA 3K5MA 4DV7Q 4WJ3M 2JQOA 4GOPA 1I6HH 2RCNA 4R4IA 3T53B 1JR0D 3K59A 3E0EA 5FKAC 2VNUD 1JCKB 3PO3G 4OWWB 3DM1A 1J9OA 1TS4A 1VMCA 2I5LX 3K0XA 3K80C 1DOLA 2L12A 4ZLTF 2B2YA 4UP9A 2R92G 3NELA 1GD7A 4G7ZC 2K4KA 3SE0A 4YY3L 3U4VA 2R7DA 5FLXE 5FJ8G 1FD7D 3J80c 2IY5B 1QE6A 2CCZA 1HFGA 3HOZH 3NBHA 3KF8B 5C0XG 1H9SB 2A69D 1B8AA 2J7ZA 1GM5A 4KN7C 5IYCG 1ZKOA 2F0EA 4DA2A 1CKOA 5HGQA 5FLMG 3A5UA 1IYUA 3H0GH 3J7AV 1VQ5A 1E3PA 1S5DD 2UU9Q 1B7YB 1DCZA 1SLJA 4A3BH 1NSNS 4KI0A 2PI2A 3OPOA 2XWBB 4K0KL 1JE4A 2B2VC 4WJWA 5D3IB 1TXYA 4KJNA 1T5XD 1OO9B 4WRDA 2CKZB 3HOUH 1X3EA 1SYEA 5J1ZA 1VQKA 1HFNA 1I4PA 4V0BA 3KLSX 1ZYRD 3DHQA 2JEBI 1EQTA 4Y7NH 1D2BA 1QZGA 1EU3A 5BN4A 2KBNA 1CT1D 2LY7A 4QQBX 2F0DA 4LK1C 2PCFB 4XQQA 2IX3A 4DV1Q 3PCOB 3SK6A 4B9XA 2E2JH 3I91A 2F0LA 4UHVA 2DY7A 5IGEA 1S5FD 2A6EC 3HKZG 4C3JB 3HOYH 1PTOD 3PO3H 2NVYH 1VF5C 1TWGH 3T1HQ 4YHHQ 3F2BA 2ZTDA 1QVFA 2JE6I 3G6EA 4DV4Q 2JA6G 2R92H 1DM0B 3M3YH 1PYBA 1T9HA 3TP8A 2PW5A 3HOVG 4TQUS 2JP1A 2PYKA 1IL2A 1PTOB 2C5CA 4N8X1 5FJ8H 1EL0A 3CMEA 3E6ZX 4ZQ3A 2ZM6L 4RGTA 1EEID 1H9KA 3UDXA 4JI1L 3OTOL 4O1NA 3VR5A 5IYCH 3MVVA 2E2HH 4XTCS 2VQFL 2KEEA 1C48A 1AE3A 3SHLA 1QCBD 2BDOA 1SNPA 3KLSA 2R7ZH 4A3DG 1EFID 2DJFC 1H9MA 5CGKA 1IBKQ 3A5ZB 4FXGC 1WTVA 2B2VA 1V1OA 5JPMC 2NVTH 4YCVA 3I8ZA 2ALYB 5M5XH 1XTDA 3PF4A 4RGOS 1BXTA 3CCJA 3MTSA 4X3UA 1VMPA 4CDFC 1SROA 3M4QA 3PUWA 4ZKCB 5LMUL 1KNAA 2FFKB 3S1RB 2YYZA 2IHEA 2MNAA 1U5KA 4YIJA 3HP3A 1SYFA 3PO2G 1WTPA 1UEBA 2NWGA 3CRLC 1K28A 3ITPA 1LTRD 4FF1A 4K5XA 4JBWA 2ICEC 1YHAA 5CBEE 4JPBW 3VYUA 4LF8L 5M3MB 5H1SE 5LHY1 1NR4A 2JA8G 3EA6A 1STYA 3PIPA 2QILA 4IPHA 2AUKA 1S5BD 1XMQQ 3J81j 2F0GA 3FRPB 4H7BA 3LWEA 5K36G 3HOVH 4CDEC 1N8RC 2JA5G 1J5EL 2XSCA 4HMJA 1UAPA 3QIAA 1PMRA 3SGIA 3OHXC 4DR6L 4C2MH 4QB4A 2M9VA 4IOCA 2TSSA 2F0MA 4DV0L 1BCPD 1J6QA 3HEJA 1J8IA 2CH4W 3PUYA 1PFMA 3GTLH 3VYSA 4A3CH 2BE5D 4BXXH 3J7A5 1PYSB 1STBA 2IPKD 3MFGA 1BCPB 3LNNA 2GA4B 4JW0A 5IT9E 1B2TA 1YI2A 1E2ZA 2F0WA 4CDCC 3K7AB 4KY7A 1CZWA 3S9WA 1EWCA 3VA7A 4B3RQ 3WOFA 2PW7A 1MI2A 3ICEA 5M3FG 4H13C 1SYBA 2RHQB 4HMIA 5C4JB 3I4NH 3CPWA 3PO2H 3GP7A 3RZDB 2Y0SG 4JI6L 1SNDA 2HCCA 4DF7A 1X3GA 2XRSD 1PRTF 1K73C 2ES2A 1GUTA 1W3SA 2O2LD 2IL8A 4JC0A 4C3IB 4UP7A 3Q0AA 2RHSB 4OONA 1PHJA 1L0YB 2DY8A 2R93G 3U9SA 4C56C 1LT5D 5K36H 2Z0SA 3D4DA 2K50A 2BDNA 1HZCA 3S1QH 5F2DA 4BY7B 4JI4Q 1KABA 2HIXA 2JA5H 4FVMA 2MGSA 3TSSA 4NB3A 3UDGA 2DN8A 1VQ4A 2E2IB 2RQXA 5LMNQ 1WTHA 4I7AA 2KCCA 4BWGB 2Q2TA 4YCUA 3S15B 4OWXB 1Y8NB 4BA2I 2DUDA 1HNZL 4RMFA 2JK8A 2VZAA 1EYGA 5BR8Q 1WOCA 4HJ9A 1OXSC 1JWSD 1XWEA 3SVMA 1K83B 3D6CA 3RN2A 4BBRG 4EGVA 2JJQA 5IWAQ 1WVLA 2EYJA 4A3FG 4KMUC 1D5MC 2Z4HA 3H09A 1WTRA 1CHPD 1EOTA 1G291 5IT9L 5A35A 1YIJA 4R9WA 2F0QA 4AH6A 3H3VC 4DNIA 1P8LA 2G5DA 3M7GA 3RZOH 4XIGS 3NTKA 1CHQD 2QDBA 2BCOA 1PZKD 3JAMi 1MKHA 2K32A 5IGGA 5IODA 5M3FB 2AQ2B 2AWNA 2EDGA 1CQFA 2E2DC 2EJFC 5NUCA 1G91A 2A6HC 2B63G 3GTKH 5C3EB 3TDQA 3HKSA 2L55A 1I50B 1D1KA 4B3TL 5EAYA 2QW7A 2F0FA 3TP5A 2QEXA 1QUQA 3H3VI 2R93H 1GO3E 3TREA 3B6YA 1L0XB 4DV5L 4FF2A 4OIJA 4DR3L 3HRZC 3I2ZA 4YWLA 3S2HH 5M5YB 1HA5A 1Q90A 2VB2X 2EY1A 4J8QA 2AHOB 2UXDL 5K5PA 4CJ0B 3MWYW 3Q24A 5E1FA 1FNWA 2KA7A 2JA7G 2JA9A 1I94Q 4L8JA 2AUJD 4NW2A 5J3BA 4FDBA 4DV2Q 3CAMA 4KY5A 3GV6A 1Z9FA 3GTJH 4DAYB 4F8MA 1VQPA 4A3GG 4OX9Q 4GNXC 1XPOA 3T16A 3FDTA 2ZJPA 2DJGC 2XRQD 4GZYC 2NZHA 2NN6I 1LABA 4BBRB 4LFCQ 1IW7D 1AN8A 2C35B 2HT1A 4I65A 3K8AA 4OWTB 1CSPA 4F7XA 4R4CA 2MUYA 5C4XG 2JEAI 4OGQC 4Q0FA 1IBLL 4A3FB 4N9TA 4X62Q 4HIMA 5C44G 3I4OA 3GTGB 3CKIB 4JI2Q 4CJ2C 4GKKQ 4JBJA 1D1IA 2RSOA 4OL7A 2I0QA 1EFWA 4JI0Q 5ELDA 2KEDA 2B63H 1JJGA 1JJ2A 1WTOA 2OTJA 1GUGA 4DR1Q 3S17B 1YNJD 1RIPA 2XTIA 2IHFA 3A7AB 2UXCL 1XMOL 5JJZA 2KHIA 3EIVA 5DM73 1MJEA 2EYPA 4I7ZC 2FJ2A 2RSNA 4IPDA 2ZTEA 1V1PA 1MD2D 4DV6L 4DR5L 2UXBL 3QJYA 4CJ1B 4X3KA 4N9PA 2B3GA 1OXTA 1WCMB 3MFYA 4JI8Q 1NJIC 3E9HA 1NR2A 2EXDA 1KAAA 1TWFB 1Y1WG 1VQ6A 1RD9D 4B3MQ 4LF6Q 4DV7L 4QUFA 3I3CA 4DUYQ 1IL8A 1SNMA 3DWAA 5HGTA 2N88A 2A73B 2K33A 4LFBL 4X3SA 1Q3LA 4GNXA 2JA7B 3HOWH 3KYHC 3DEOA 3EROA 3CU7A 3MXNA 5AJ3Q 1Y1VG 2H5XA 4K6DA 5GAEC 3S14B 1RF2D 2D0OA 2J0TD 4A3GB 1CKMA 4DR7L 3E9IA 2FMMA 1G6PA 4CDDC 3D0FA 4RCNA 2MO0A 4KKSA 1KLGD 5AFWA 3SXHA 4AYBB 4POGA 4G7HC 5C4XB 2UU9L 5FO9B 4L5TA 2D0PA 5GADC 5C44B 3GTOB 1X32A 2K5NA 4RGNA 4RKLA 3CD6A 3I55A 2ZTCA 5CV7A 2EYOA 3W2DA 1N34Q 5E4WC 3T51B 5IY0A 1L1OC 5ELFA 1PH5A 4A3JH 3I56A 2I5HA 4L63B 2YU9B 1XNQQ 1ET6A 1OXUA 3TEHB 3J7ZC 3L3OC 4ZYSA 1MJCA 4A4IA 5A2QL 1EY6A 3K0YA 1X55A 1LLRD
chains in the Genus database with same CATH topology
1TXYA 4DV1L 1Y1WH 2VUMH 1AE2A 3HOWG 3CCVA 4A3DH 2CKZB 3HOUH 5HY6A 1X3EA 3KDFB 1VQKA 4JV5Q 4B3SQ 4JI0L 3M9BA 1JB7A 4KHPQ 2JEBI 5C0XJ 4QY7A 2GVBA 3ULLA 4X65L 2Q2HA 4Y7NH 4POFA 5C4JH 4YHHL 4KHZA 3T1HL 1QZGA 2KBNA 1FJGL 5IP9H 3RZDH 2F4VQ 1OXXK 2EQSA 4QQBX 2LXJA 2MFIA 4TVAB 4EX5A 3UE0A 4DV1Q 1PH1A 3PCOB 1UE7A 5IT9c 1Y1VH 1NMGA 1KRSA 1VQ8A 1YVCA 1Q86C 3CCQA 2E2JH 4LF9L 1Q8KA 2WAQG 5C3EG 3A0JA 2BA1A 4IJHA 3HKZG 1S3OA 4C3IH 1A8VA 3F2CA 3CQZH 4LNQA 3HOYH 2NVYH 1V1QA 3HOZG 1TWGH 3PO3H 4X65Q 1N36L 3T1HQ 4JI8L 4L5RC 4YHHQ 5C4XG 3F2BA 2ZTDA 1QVFA 2JE6I 3G6EA 2VL6A 4DV4Q 2JA6G 1SRUA 1K9MC 2R92H 1VQGA 3M3YH 1PYBA 1T9HA 5GROA 3HOVG 4TQUS 1X9NA 2JA8H 1IL2A 4DK3C 4JBMA 5FJ8H 1IBKL 1GVPA 2R6GA 3ULJA 4BY7H 3KJPA 3CMEA 2GVAA 3NENA 2ZM6L 4A3JG 3GTQH 4JI6Q 4A3BG 3CC7A 3UDXA 1HZ9A 4JI1L 3OTOL 2E2IH 2UXDQ 3BJUA 5GQOA 5IYCH 2N78A 3S15H 2E2HH 2Q2UA 4XTCS 2VQFL 1L1OA 2K5HA 1AE3A 5AJ3L 2VUMG 3VDYA 1CKNA 1EIYB 1TWHH 1S72A 1HNXQ 2R7ZH 1UE6A 4PZ6A 4APVA 4A3DG 1L2FA 4IJLA 1QUQB 5IYBG 3HOUG 3RR5A 1K83H 1Q7YC 1IBKQ 3CC4A 3A5ZB 2ZM6Q 2NVTH 4YCVA 4DR4L 4R4QA 1BBUA 2ALYB 5M5XH 1XTDA 4JI1Q 3NBHB 4MNOA 3OTOQ 3G4SA 3PF4A 3TRZA 3S1NH 4C3HH 3CCJA 1R9TH 1SROA 2VQFQ 3M4QA 3PUWA 1XPRA 5LMUL 3HOXG 4DR2L 1YJNA 2YYZA 2IHEA 2MNAA 1U5KA 1OXVA 2NVXH 4OO1I 1Q1EA 2VS1A 3PO2G 2VNUD 1YJ9A 1UEBA 2UUAL 3HOYG 3A74A 4JBWA 3M4PA 1YHAA 5M3FH 1N34L 4HJ5A 4O0AA 3BZKA 3GD7A 1D8LA 5DLQE 4LF8L 3GTPH 1NTGA 2WAQE 3UDIA 5H1SE 5LMUQ 4IFDI 1UE5A 2Y0SE 3PUVA 4DR2Q 1P16A 1OTCA 3HKZE 2JA8G 4LF4L 1I50H 1VQDA 1VQCA 4AYBE 1XNQL 1SFOH 3PIPA 4GKJL 4UP8A 3KLWA 3U4ZA 3F2DA 3GDEA 1VQLA 2NZOA 3W5OA 4IPHA 1YNXA 1XNRL 2I5MX 1XMQQ 4GS3A 2UUAQ 3J81j 4P74A 3UDFA 5K36G 3TS0A 4A3KH 3HOVH 4BA2I 3GTOH 4A93H 3AEVA 1N8RC 2JA5G 3M85A 1J5EL 3PUXA 5M5YH 1AH9A 4JCVE 1JT8A 2R7ZG 3SGIA 4BBSH 3AYHB 1KHIA 1WCMG 4DR6L 4LF4Q 2AMCB 4C2MH 4HIOA 5E7NA 4B3RL 2R7FA 2BA0A 1Q82C 1RL2A 4IOCA 4DV0L 3AFPA 3PIOA 2L15A 1XJVA 1XNRQ 1J6QA 1M1KC 1O7IA 2Z6KC 3PUYA 1HJPA 2N3SA 5GAGC 4JI3L 1IYJB 3GTLH 1KL9A 1UE1A 4AQYQ 5IYBH 4GN5A 1J5EQ 4A3CH 4BXXH 3J7A5 1PYSB 3GTMH 3G71A 1YHBA 1YI2A 2E5LL 1MIUA 4DR6Q 3KFUA 4JOIC 4HJAA 2E8GA 3KOJA 4P73A 4B3RQ 3RLFA 2UUCL 4DV0Q 4DV4L 1LM0A 4DR3Q 2IX1A 1QZHA 3ICEA 1Y14B 4BBRH 1VQAA 1ASYA 1BKBA 3HOXH 5M3FG 1Q81C 4WJ4A 4GN4B 4DV3L 2K5VA 4LF5L 2RHQB 1X6OA 4JI3Q 1VQMA 2UXCL 5IP7H 3I4NH 4IFDG 4A3FH 2WFWA 1FGUA 3PSIA 3CPWA 4P72A 2OCEA 3PO2H 1PH2A 1VQHA 2Y0SG 3GTGH 1N32L 4JI6L 2E5LQ 4JBKA 4A3IG 1VQNA 1XPUA 4DK6C 1X3GA 3F1ZA 4AYBG 1K73C 2ES2A 2VW9A 1E22A 2UUCQ 1BBWA 2WB1E 1W3SA 2NVQH 2CQOA 2PQAB 2VQEL 4GNXB 2CWAA 4A3KG 1HNXL 4C3JH 4A93G 4DV3Q 4LF5Q 4JC0A 3W1BA 4UP7A 1PV4A 2RHSB 3S17H 4OONA 2HIVA 5LMNL 3MXNB 1PHJA 2R93G 1HNWQ 3H15A 4BBSG 1HZAA 1N32Q 4GOPB 1VQIA 1JE5A 1KRTA 1V9PA 2YTVA 2Z0SA 3MEFA 2K50A 3HFZB 1HZCA 4JI5L 3S1QH 1KQSA 4JI4Q 1PH3A 3CMAA 1Q1BA 1LTLA 2HIXA 3RLNA 1WI5A 2JA5H 2VQEQ 4HIDA 4NB3A 1H95A 4IFDJ 5IWAL 3UDGA 4R4TA 2LSSA 4X66L 1WCMH 3L7ZC 3I7FA 1VQ4A 4A3CG 4BXXG 3GO5A 4KLKA 5LMNQ 2A19A 4A75A 4YCUA 2Q2TA 1TWFH 4X64Q 4OWXB 4RG1A 4JYAL 2Z6KA 2DUDA 1NY4A 5C0XI 3CCUA 4RMFA 2JK8A 1HNZL 2VZAA 3STBD 3BU2A 5BR8Q 1EYGA 1WOCA 1PVOA 2D62A 1EQQA 1HR0L 4HJ9A 1OXSC 4JI5Q 3RN2A 4BBRG 1K8GA 2K14A 2JJQA 4UY8C 2UXCQ 1XMOQ 3S2DH 4JOIA 3ER0A 5IWAQ 5IP7G 3I4NG 4LUVA 4X66Q 3CCSA 2JA7H 1KAWA 4A3FG 1QVGA 1TWAH 4L5QA 1PA6A 4LUZA 3F8TA 1XMQL 4BY1G 1JJCB 2OQKA 1X56A 4JYAQ 4DR5Q 3T1YL 1G291 1YIJA 1HNZQ 4ME3A 1UWVA 1Q46A 2YTYA 3RLOA 4AH6A 3ZJYC 3S14H 4GLAC 3FKIG 1HR0Q 1D7QA 4DNIA 1P8LA 4A3GH 3RZOH 2WB1G 4XIGS 3EBEA 3CW2C 3U58A 1N33L 1KXLA 2OWOA 3JAMi 1CUKA 1MKHA 4A3IH 1N9WA 4QJFA 2AWNA 4MTNA 4DUZL 1VQBA 2IT1A 4X6AH 3CP0A 1NBWA 5C4XH 1YITA 2B63G 4A3MG 1WYDA 3T1YQ 4A3EG 3GTKH 4LFBQ 2HHHL 3HKSA 5C44H 3W1GA 2PMZE 4B3TL 4IPGA 4R1JA 5EAYA 4AQYL 3S24A 3CF5A 3TS2A 2QEXA 1QUQA 1L0WA 4YCWA 3H3VI 2R93H 1M90C 1GO3E 4OXPA 1WFQA 1N33Q 1I94L 3TREA 3J81i 3S16H 1FVIA 3B6YA 3WWVA 4DV5L 2N49A 3KF6A 3CCMA 3OYYA 2K75A 4QIWE 3K81C 1KIXA 1A63A 1EWIA 4DUZQ 4DR3L 2KENA 3I2ZA 5IYDG 4YWLA 1YBYA 2EIFA 4DV2L 3S2HH 3DLLA 4IO9A 3LGJA 4DR7Q 1IXRA 3EN2A 2YU9H 2AHOB 3D31A 2HHHQ 5JJIA 3CCLA 2UXDL 4OX9L 2ZJRA 1PH9A 4B3TQ 1IZ6A 5FLXc 3RN5A 3AQQA 4QL5A 2VY3A 5LMNW 1YZ6A 3DM3A 1ASZA 4ALPA 1LUZA 1PH4A 1PFSA 2CWPA 4LF7Q 3G48A 2BH8A 2JA9A 4LFCL 3CXCA 1I94Q 2JA7G 4OO1G 1HZBA 4DV5Q 5ELOA 1Q12A 1IBML 5J3BA 4FDBA 1X3FA 1PH6A 3CCRA 2A1AA 4IPCA 4DV2Q 1K0RA 3CAMA 4LUOA 4X62L 4MZ9A 1SN8A 2ASBA 1Z9FA 1S40A 3GTJH 2PNHA 4DPGA 3U50C 2Q2IA 4GN3B 2OQ0A 1U0LA 4DAYB 1L1OB 3KJOA 3ULPA 1VQPA 5ELNA 3J80i 4GNXC 1XPOA 4JI2L 4OX9Q 2ATWA 2ZJQA 4A3GG 4GKKL 1HNWL 1C9OA 1CKNB 4UPAA 2ZJPA 4LWCA 3CCEA 3S1MH 2NZHA 2GN5A 2NN6I 4HJ8A 4BY1H 4LFCQ 1B70B 2C35B 2HT1A 4NPSA 5M3MG 3K8AA 1IBMQ 2CFMA 4OWTB 1CSPA 4AIMA 4BA1I 4R4CA 4DR1L 4GOPC 1HR0W 3FKIH 5GAHC 1VQ9A 4JI4L 1IBLL 4A76A 2JEAI 4K0KQ 1E24A 4X62Q 4HIMA 4L5SA 3AFQA 3I4OA 5C44G 1EOVA 1E1TA 2FXQA 4P71A 1K3RA 4JI2Q 1FL0A 4GKKQ 2AKWB 4NXML 2LXKA 4JBJA 4LW1A 4PZ7A 2F3IA 1BVSA 2I0QA 4Y52H 4X64L 1EFWA 4JI0Q 4JI7L 4EQ5A 1W2BA 2KCTA 1V43A 1A62A 2N8NA 5BR8L 1YHQA 2IX0A 4A3EH 4A3MH 1JJ2A 2B63H 1JJGA 1VQFA 2OTJA 1VQEA 1HH2P 4DR1Q 2B29A 1PH7A 2MO1A 3PUZA 4A3LH 1RIPA 2XTIA 1QVCA 2IHFA 1G51A 2HQLA 3JC66 1IBLQ 1FJGQ 3I4MG 3IRBA 3KDFA 4PG3A 2XGTA 1E7ZA 4R4OA 1XMOL 2KHIA 1SMXA 4B3ML 3EIVA 4LF6L 4O2DA 1VQJA 1MJEA 4NXNL 4DUYL 1Z47A 3H0GG 4NXMQ 4GLVB 4HIKA 1LYLA 2K52A 4IPDA 2ZTEA 5JEAG 3L2PA 1EQRA 3STBC 1I3QH 4LFAL 2YV5A 1VCIA 4LF9Q 1VS0A 5IE8A 1YJWA 1SR3A 5JJKA 4JI7Q 4DV6L 5IYDH 4DR5L 1TWCH 5M5WH 4HJ7A 2UXBL 3JAMc 2B3GA 1OXTA 1N36Q 3UE1A 4JI8Q 1NJIC 3E9HA 2KCMA 1NMFA 2EXDA 4H02A 5FLMH 1Y1WG 1VQ6A 3PGZA 3Q8DA 4B3MQ 3RNUA 4LF6Q 4DV7L 1PH8A 4NXNQ 4DUYQ 4DKAC 1I5FA 3PF5A 4LFAQ 3S1RH 2NN6G 3J81c 4DV6Q 3KF6B 2UXBQ 4LFBL 2UUBL 1X65A 3NEMA 2BH2A 2PQAA 4GNXA 5IP9G 1NE3A 1WJJA 1KD1C 3L0OA 4P75A 3HOWH 2WP8J 3KYHC 2PI2E 2AWOA 4PZ8A 2RF4A 3K7UC 2YTXA 5AJ3Q 4IOAA 1E1OA 2V1CC 5JEAJ 1Y1VG 4DV7Q 4WJ3M 3FHWA 2JQOA 2H5XA 5GAEC 4GOPA 4J15A 5M3MH 3M7NA 1I6HH 1DGSA 4JG2A 2KHJA 2RCNA 4R4IA 2D0OA 2QA4A 3E0EA 1CKMA 4DR7L 2OTLA 4PMWA 3E9IA 4QGUA 4GLXA 2UUBQ 1YEZA 3PO3G 1VQOA 3D0FA 4OWWB 4DR4Q 1G6PA 4A3LG 2I5LX 3K0XA 3K80C 1CSQA 1EIFA 2MO0A 4UP9A 4POGA 3NELA 2R92G 1GD7A 2K4KA 3H3VH 4LF7L 4YY3L 3U4VA 2R7DA 3CPFA 3M4OH 2UU9L 4DAMA 5C3EH 3OW2A 2MQHA 5FJ8G 3J80c 4BY7G 4L5TA 1SE8A 1GKHA 2D0PA 2IY5B 2CCZA 5GADC 3HOZH 2QGQA 2DGYA 2F52A 2ID0A 3KF8B 1K8AC 2K5NA 5C0XG 2JA6H 3I4MH 4YWMA 1C0AA 3CD6A 3I55A 1B8AA 1GM5A 2ZTCA 4YWKA 2A8VA 3FP9A 5IYCG 1X54A 1CKOA 1N34Q 5HGQA 5FLMG 3A5UA 1EUJA 3H0GH 5IY0A 1KC8C 4LF8Q 5JJLA 4JV5L 1L1OC 1VQ5A 1VQ7A 4B3SL 1E3PA 3ERSX 4YY3Q 1PH5A 4A3JH 3I56A 2I5HA 2UU9Q 4KHPL 1B7YB 1SLJA 1A0IA 1JMCA 1C7YA 1XNQQ 3BZCA 3CC2A 4KI0A 4A3BH 1OXUA 3TEHB 4GKJQ 3J7ZC 2PI2A 3PV0A 4K0KL 2F4VL 3TQYA 1MJCA 4A4IA 3K7AH 1X55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TXY A;  4DV1 L;  1Y1W H;  2VUM H;  1AE2 A;  3HOW G;  3CCV A;  4A3D H;  2CKZ B;  3HOU H;  5HY6 A;  1X3E A;  3KDF B;  1VQK A;  4JV5 Q;  4B3S Q;  4JI0 L;  3M9B A;  1JB7 A;  4KHP Q;  2JEB I;  5C0X J;  4QY7 A;  2GVB A;  3ULL A;  4X65 L;  2Q2H A;  4Y7N H;  4POF A;  5C4J H;  4YHH L;  4KHZ A;  3T1H L;  1QZG A;  2KBN A;  1FJG L;  5IP9 H;  3RZD H;  2F4V Q;  1OXX K;  2EQS A;  4QQB X;  2LXJ A;  2MFI A;  4TVA B;  4EX5 A;  3UE0 A;  4DV1 Q;  1PH1 A;  3PCO B;  1UE7 A;  5IT9 c;  1Y1V H;  1NMG A;  1KRS A;  1VQ8 A;  1YVC A;  1Q86 C;  3CCQ A;  2E2J H;  4LF9 L;  1Q8K A;  2WAQ G;  5C3E G;  3A0J A;  2BA1 A;  4IJH A;  3HKZ G;  1S3O A;  4C3I H;  1A8V A;  3F2C A;  3CQZ H;  4LNQ A;  3HOY H;  2NVY H;  1V1Q A;  3HOZ G;  1TWG H;  3PO3 H;  4X65 Q;  1N36 L;  3T1H Q;  4JI8 L;  4L5R C;  4YHH Q;  5C4X G;  3F2B A;  2ZTD A;  1QVF A;  2JE6 I;  3G6E A;  2VL6 A;  4DV4 Q;  2JA6 G;  1SRU A;  1K9M C;  2R92 H;  1VQG A;  3M3Y H;  1PYB A;  1T9H A;  5GRO A;  3HOV G;  4TQU S;  1X9N A;  2JA8 H;  1IL2 A;  4DK3 C;  4JBM A;  5FJ8 H;  1IBK L;  1GVP A;  2R6G A;  3ULJ A;  4BY7 H;  3KJP A;  3CME A;  2GVA A;  3NEN A;  2ZM6 L;  4A3J G;  3GTQ H;  4JI6 Q;  4A3B G;  3CC7 A;  3UDX A;  1HZ9 A;  4JI1 L;  3OTO L;  2E2I H;  2UXD Q;  3BJU A;  5GQO A;  5IYC H;  2N78 A;  3S15 H;  2E2H H;  2Q2U A;  4XTC S;  2VQF L;  1L1O A;  2K5H A;  1AE3 A;  5AJ3 L;  2VUM G;  3VDY A;  1CKN A;  1EIY B;  1TWH H;  1S72 A;  1HNX Q;  2R7Z H;  1UE6 A;  4PZ6 A;  4APV A;  4A3D G;  1L2F A;  4IJL A;  1QUQ B;  5IYB G;  3HOU G;  3RR5 A;  1K83 H;  1Q7Y C;  1IBK Q;  3CC4 A;  3A5Z B;  2ZM6 Q;  2NVT H;  4YCV A;  4DR4 L;  4R4Q A;  1BBU A;  2ALY B;  5M5X H;  1XTD A;  4JI1 Q;  3NBH B;  4MNO A;  3OTO Q;  3G4S A;  3PF4 A;  3TRZ A;  3S1N H;  4C3H H;  3CCJ A;  1R9T H;  1SRO A;  2VQF Q;  3M4Q A;  3PUW A;  1XPR A;  5LMU L;  3HOX G;  4DR2 L;  1YJN A;  2YYZ A;  2IHE A;  2MNA A;  1U5K A;  1OXV A;  2NVX H;  4OO1 I;  1Q1E A;  2VS1 A;  3PO2 G;  2VNU D;  1YJ9 A;  1UEB A;  2UUA L;  3HOY G;  3A74 A;  4JBW A;  3M4P A;  1YHA A;  5M3F H;  1N34 L;  4HJ5 A;  4O0A A;  3BZK A;  3GD7 A;  1D8L A;  5DLQ E;  4LF8 L;  3GTP H;  1NTG A;  2WAQ E;  3UDI A;  5H1S E;  5LMU Q;  4IFD I;  1UE5 A;  2Y0S E;  3PUV A;  4DR2 Q;  1P16 A;  1OTC A;  3HKZ E;  2JA8 G;  4LF4 L;  1I50 H;  1VQD A;  1VQC A;  4AYB E;  1XNQ L;  1SFO H;  3PIP A;  4GKJ L;  4UP8 A;  3KLW A;  3U4Z A;  3F2D A;  3GDE A;  1VQL A;  2NZO A;  3W5O A;  4IPH A;  1YNX A;  1XNR L;  2I5M X;  1XMQ Q;  4GS3 A;  2UUA Q;  3J81 j;  4P74 A;  3UDF A;  5K36 G;  3TS0 A;  4A3K H;  3HOV H;  4BA2 I;  3GTO H;  4A93 H;  3AEV A;  1N8R C;  2JA5 G;  3M85 A;  1J5E L;  3PUX A;  5M5Y H;  1AH9 A;  4JCV E;  1JT8 A;  2R7Z G;  3SGI A;  4BBS H;  3AYH B;  1KHI A;  1WCM G;  4DR6 L;  4LF4 Q;  2AMC B;  4C2M H;  4HIO A;  5E7N A;  4B3R L;  2R7F A;  2BA0 A;  1Q82 C;  1RL2 A;  4IOC A;  4DV0 L;  3AFP A;  3PIO A;  2L15 A;  1XJV A;  1XNR Q;  1J6Q A;  1M1K C;  1O7I A;  2Z6K C;  3PUY A;  1HJP A;  2N3S A;  5GAG C;  4JI3 L;  1IYJ B;  3GTL H;  1KL9 A;  1UE1 A;  4AQY Q;  5IYB H;  4GN5 A;  1J5E Q;  4A3C H;  4BXX H;  3J7A 5;  1PYS B;  3GTM H;  3G71 A;  1YHB A;  1YI2 A;  2E5L L;  1MIU A;  4DR6 Q;  3KFU A;  4JOI C;  4HJA A;  2E8G A;  3KOJ A;  4P73 A;  4B3R Q;  3RLF A;  2UUC L;  4DV0 Q;  4DV4 L;  1LM0 A;  4DR3 Q;  2IX1 A;  1QZH A;  3ICE A;  1Y14 B;  4BBR H;  1VQA A;  1ASY A;  1BKB A;  3HOX H;  5M3F G;  1Q81 C;  4WJ4 A;  4GN4 B;  4DV3 L;  2K5V A;  4LF5 L;  2RHQ B;  1X6O A;  4JI3 Q;  1VQM A;  2UXC L;  5IP7 H;  3I4N H;  4IFD G;  4A3F H;  2WFW A;  1FGU A;  3PSI A;  3CPW A;  4P72 A;  2OCE A;  3PO2 H;  1PH2 A;  1VQH A;  2Y0S G;  3GTG H;  1N32 L;  4JI6 L;  2E5L Q;  4JBK A;  4A3I G;  1VQN A;  1XPU A;  4DK6 C;  1X3G A;  3F1Z A;  4AYB G;  1K73 C;  2ES2 A;  2VW9 A;  1E22 A;  2UUC Q;  1BBW A;  2WB1 E;  1W3S A;  2NVQ H;  2CQO A;  2PQA B;  2VQE L;  4GNX B;  2CWA A;  4A3K G;  1HNX L;  4C3J H;  4A93 G;  4DV3 Q;  4LF5 Q;  4JC0 A;  3W1B A;  4UP7 A;  1PV4 A;  2RHS B;  3S17 H;  4OON A;  2HIV A;  5LMN L;  3MXN B;  1PHJ A;  2R93 G;  1HNW Q;  3H15 A;  4BBS G;  1HZA A;  1N32 Q;  4GOP B;  1VQI A;  1JE5 A;  1KRT A;  1V9P A;  2YTV A;  2Z0S A;  3MEF A;  2K50 A;  3HFZ B;  1HZC A;  4JI5 L;  3S1Q H;  1KQS A;  4JI4 Q;  1PH3 A;  3CMA A;  1Q1B A;  1LTL A;  2HIX A;  3RLN A;  1WI5 A;  2JA5 H;  2VQE Q;  4HID A;  4NB3 A;  1H95 A;  4IFD J;  5IWA L;  3UDG A;  4R4T A;  2LSS A;  4X66 L;  1WCM H;  3L7Z C;  3I7F A;  1VQ4 A;  4A3C G;  4BXX G;  3GO5 A;  4KLK A;  5LMN Q;  2A19 A;  4A75 A;  4YCU A;  2Q2T A;  1TWF H;  4X64 Q;  4OWX B;  4RG1 A;  4JYA L;  2Z6K A;  2DUD A;  1NY4 A;  5C0X I;  3CCU A;  4RMF A;  2JK8 A;  1HNZ L;  2VZA A;  3STB D;  3BU2 A;  5BR8 Q;  1EYG A;  1WOC A;  1PVO A;  2D62 A;  1EQQ A;  1HR0 L;  4HJ9 A;  1OXS C;  4JI5 Q;  3RN2 A;  4BBR G;  1K8G A;  2K14 A;  2JJQ A;  4UY8 C;  2UXC Q;  1XMO Q;  3S2D H;  4JOI A;  3ER0 A;  5IWA Q;  5IP7 G;  3I4N G;  4LUV A;  4X66 Q;  3CCS A;  2JA7 H;  1KAW A;  4A3F G;  1QVG A;  1TWA H;  4L5Q A;  1PA6 A;  4LUZ A;  3F8T A;  1XMQ L;  4BY1 G;  1JJC B;  2OQK A;  1X56 A;  4JYA Q;  4DR5 Q;  3T1Y L;  1G29 1;  1YIJ A;  1HNZ Q;  4ME3 A;  1UWV A;  1Q46 A;  2YTY A;  3RLO A;  4AH6 A;  3ZJY C;  3S14 H;  4GLA C;  3FKI G;  1HR0 Q;  1D7Q A;  4DNI A;  1P8L A;  4A3G H;  3RZO H;  2WB1 G;  4XIG S;  3EBE A;  3CW2 C;  3U58 A;  1N33 L;  1KXL A;  2OWO A;  3JAM i;  1CUK A;  1MKH A;  4A3I H;  1N9W A;  4QJF A;  2AWN A;  4MTN A;  4DUZ L;  1VQB A;  2IT1 A;  4X6A H;  3CP0 A;  1NBW A;  5C4X H;  1YIT A;  2B63 G;  4A3M G;  1WYD A;  3T1Y Q;  4A3E G;  3GTK H;  4LFB Q;  2HHH L;  3HKS A;  5C44 H;  3W1G A;  2PMZ E;  4B3T L;  4IPG A;  4R1J A;  5EAY A;  4AQY L;  3S24 A;  3CF5 A;  3TS2 A;  2QEX A;  1QUQ A;  1L0W A;  4YCW A;  3H3V I;  2R93 H;  1M90 C;  1GO3 E;  4OXP A;  1WFQ A;  1N33 Q;  1I94 L;  3TRE A;  3J81 i;  3S16 H;  1FVI A;  3B6Y A;  3WWV A;  4DV5 L;  2N49 A;  3KF6 A;  3CCM A;  3OYY A;  2K75 A;  4QIW E;  3K81 C;  1KIX A;  1A63 A;  1EWI A;  4DUZ Q;  4DR3 L;  2KEN A;  3I2Z A;  5IYD G;  4YWL A;  1YBY A;  2EIF A;  4DV2 L;  3S2H H;  3DLL A;  4IO9 A;  3LGJ A;  4DR7 Q;  1IXR A;  3EN2 A;  2YU9 H;  2AHO B;  3D31 A;  2HHH Q;  5JJI A;  3CCL A;  2UXD L;  4OX9 L;  2ZJR A;  1PH9 A;  4B3T Q;  1IZ6 A;  5FLX c;  3RN5 A;  3AQQ A;  4QL5 A;  2VY3 A;  5LMN W;  1YZ6 A;  3DM3 A;  1ASZ A;  4ALP A;  1LUZ A;  1PH4 A;  1PFS A;  2CWP A;  4LF7 Q;  3G48 A;  2BH8 A;  2JA9 A;  4LFC L;  3CXC A;  1I94 Q;  2JA7 G;  4OO1 G;  1HZB A;  4DV5 Q;  5ELO A;  1Q12 A;  1IBM L;  5J3B A;  4FDB A;  1X3F A;  1PH6 A;  3CCR A;  2A1A A;  4IPC A;  4DV2 Q;  1K0R A;  3CAM A;  4LUO A;  4X62 L;  4MZ9 A;  1SN8 A;  2ASB A;  1Z9F A;  1S40 A;  3GTJ H;  2PNH A;  4DPG A;  3U50 C;  2Q2I A;  4GN3 B;  2OQ0 A;  1U0L A;  4DAY B;  1L1O B;  3KJO A;  3ULP A;  1VQP A;  5ELN A;  3J80 i;  4GNX C;  1XPO A;  4JI2 L;  4OX9 Q;  2ATW A;  2ZJQ A;  4A3G G;  4GKK L;  1HNW L;  1C9O A;  1CKN B;  4UPA A;  2ZJP A;  4LWC A;  3CCE A;  3S1M H;  2NZH A;  2GN5 A;  2NN6 I;  4HJ8 A;  4BY1 H;  4LFC Q;  1B70 B;  2C35 B;  2HT1 A;  4NPS A;  5M3M G;  3K8A A;  1IBM Q;  2CFM A;  4OWT B;  1CSP A;  4AIM A;  4BA1 I;  4R4C A;  4DR1 L;  4GOP C;  1HR0 W;  3FKI H;  5GAH C;  1VQ9 A;  4JI4 L;  1IBL L;  4A76 A;  2JEA I;  4K0K Q;  1E24 A;  4X62 Q;  4HIM A;  4L5S A;  3AFQ A;  3I4O A;  5C44 G;  1EOV A;  1E1T A;  2FXQ A;  4P71 A;  1K3R A;  4JI2 Q;  1FL0 A;  4GKK Q;  2AKW B;  4NXM L;  2LXK A;  4JBJ A;  4LW1 A;  4PZ7 A;  2F3I A;  1BVS A;  2I0Q A;  4Y52 H;  4X64 L;  1EFW A;  4JI0 Q;  4JI7 L;  4EQ5 A;  1W2B A;  2KCT A;  1V43 A;  1A62 A;  2N8N A;  5BR8 L;  1YHQ A;  2IX0 A;  4A3E H;  4A3M H;  1JJ2 A;  2B63 H;  1JJG A;  1VQF A;  2OTJ A;  1VQE A;  1HH2 P;  4DR1 Q;  2B29 A;  1PH7 A;  2MO1 A;  3PUZ A;  4A3L H;  1RIP A;  2XTI A;  1QVC A;  2IHF A;  1G51 A;  2HQL A;  3JC6 6;  1IBL Q;  1FJG Q;  3I4M G;  3IRB A;  3KDF A;  4PG3 A;  2XGT A;  1E7Z A;  4R4O A;  1XMO L;  2KHI A;  1SMX A;  4B3M L;  3EIV A;  4LF6 L;  4O2D A;  1VQJ A;  1MJE A;  4NXN L;  4DUY L;  1Z47 A;  3H0G G;  4NXM Q;  4GLV B;  4HIK A;  1LYL A;  2K52 A;  4IPD A;  2ZTE A;  5JEA G;  3L2P A;  1EQR A;  3STB C;  1I3Q H;  4LFA L;  2YV5 A;  1VCI A;  4LF9 Q;  1VS0 A;  5IE8 A;  1YJW A;  1SR3 A;  5JJK A;  4JI7 Q;  4DV6 L;  5IYD H;  4DR5 L;  1TWC H;  5M5W H;  4HJ7 A;  2UXB L;  3JAM c;  2B3G A;  1OXT A;  1N36 Q;  3UE1 A;  4JI8 Q;  1NJI C;  3E9H A;  2KCM A;  1NMF A;  2EXD A;  4H02 A;  5FLM H;  1Y1W G;  1VQ6 A;  3PGZ A;  3Q8D A;  4B3M Q;  3RNU A;  4LF6 Q;  4DV7 L;  1PH8 A;  4NXN Q;  4DUY Q;  4DKA C;  1I5F A;  3PF5 A;  4LFA Q;  3S1R H;  2NN6 G;  3J81 c;  4DV6 Q;  3KF6 B;  2UXB Q;  4LFB L;  2UUB L;  1X65 A;  3NEM A;  2BH2 A;  2PQA A;  4GNX A;  5IP9 G;  1NE3 A;  1WJJ A;  1KD1 C;  3L0O A;  4P75 A;  3HOW H;  2WP8 J;  3KYH C;  2PI2 E;  2AWO A;  4PZ8 A;  2RF4 A;  3K7U C;  2YTX A;  5AJ3 Q;  4IOA A;  1E1O A;  2V1C C;  5JEA J;  1Y1V G;  4DV7 Q;  4WJ3 M;  3FHW A;  2JQO A;  2H5X A;  5GAE C;  4GOP A;  4J15 A;  5M3M H;  3M7N A;  1I6H H;  1DGS A;  4JG2 A;  2KHJ A;  2RCN A;  4R4I A;  2D0O A;  2QA4 A;  3E0E A;  1CKM A;  4DR7 L;  2OTL A;  4PMW A;  3E9I A;  4QGU A;  4GLX A;  2UUB Q;  1YEZ A;  3PO3 G;  1VQO A;  3D0F A;  4OWW B;  4DR4 Q;  1G6P A;  4A3L G;  2I5L X;  3K0X A;  3K80 C;  1CSQ A;  1EIF A;  2MO0 A;  4UP9 A;  4POG A;  3NEL A;  2R92 G;  1GD7 A;  2K4K A;  3H3V H;  4LF7 L;  4YY3 L;  3U4V A;  2R7D A;  3CPF A;  3M4O H;  2UU9 L;  4DAM A;  5C3E H;  3OW2 A;  2MQH A;  5FJ8 G;  3J80 c;  4BY7 G;  4L5T A;  1SE8 A;  1GKH A;  2D0P A;  2IY5 B;  2CCZ A;  5GAD C;  3HOZ H;  2QGQ A;  2DGY A;  2F52 A;  2ID0 A;  3KF8 B;  1K8A C;  2K5N A;  5C0X G;  2JA6 H;  3I4M H;  4YWM A;  1C0A A;  3CD6 A;  3I55 A;  1B8A A;  1GM5 A;  2ZTC A;  4YWK A;  2A8V A;  3FP9 A;  5IYC G;  1X54 A;  1CKO A;  1N34 Q;  5HGQ A;  5FLM G;  3A5U A;  1EUJ A;  3H0G H;  5IY0 A;  1KC8 C;  4LF8 Q;  5JJL A;  4JV5 L;  1L1O C;  1VQ5 A;  1VQ7 A;  4B3S L;  1E3P A;  3ERS X;  4YY3 Q;  1PH5 A;  4A3J H;  3I56 A;  2I5H A;  2UU9 Q;  4KHP L;  1B7Y B;  1SLJ A;  1A0I A;  1JMC A;  1C7Y A;  1XNQ Q;  3BZC A;  3CC2 A;  4KI0 A;  4A3B H;  1OXU A;  3TEH B;  4GKJ Q;  3J7Z C;  2PI2 A;  3PV0 A;  4K0K L;  2F4V L;  3TQY A;  1MJC A;  4A4I A;  3K7A H;  1X55 A; 
#chains in the Genus database with same CATH topology
 4DV1 L;  1Y1W H;  2VUM H;  1AE2 A;  5IGD A;  1ICF B;  2P5Z X;  1AFP A;  3KDF B;  4JV5 Q;  4C1N I;  3R3O A;  1YNN C;  1C8C A;  5C0X J;  3ULL A;  3QR8 A;  3T1H L;  1CI3 M;  4POF A;  4YHH L;  1D5Z C;  1CA6 A;  1FJG L;  2F4V Q;  1AW7 A;  1I6V C;  3AMU A;  3NPP A;  2MFI A;  1ENA A;  4NP5 A;  5J22 A;  4BY1 B;  1PH1 A;  1Y1V H;  1KRS A;  3VR6 A;  1YVC A;  4TKO B;  3CCQ A;  1Q86 C;  1VQ8 A;  3MEH A;  2K5D A;  3DXJ C;  4LF9 L;  3FKI B;  2NB0 A;  2PPB C;  4IJH A;  3Q22 A;  2WB1 B;  1NCV A;  1A8V A;  3F2C A;  3CQZ H;  4ZRZ A;  3HOZ G;  1F9S A;  4X65 Q;  5CC4 A;  1N36 L;  1ET9 A;  2K1B A;  4KTA A;  1SRU A;  1K9M C;  4DNT B;  4IN3 A;  5GRO A;  1X9N A;  4DK3 C;  4A3E B;  1IBK L;  3BDL A;  1EQV A;  1FGB D;  1BO0 A;  2QEJ C;  4A3B G;  3CC7 A;  1HZ9 A;  1DYQ A;  3J81 E;  5FO7 B;  5EBC A;  1L1O A;  2C9O A;  2K5H A;  2RDF A;  1EIY B;  1BOS A;  3E3X A;  5M5W B;  1UE6 A;  5BN5 A;  1L2F A;  1NUC A;  4IJL A;  5IYB G;  3HOU G;  2A68 C;  4JK1 C;  1XYI A;  1D5X C;  4XT3 B;  4Z9C B;  4KD3 A;  4DR4 L;  2L1B A;  1BBU A;  3J7A F;  3NBH B;  3G4S A;  1TWA B;  1R9T H;  2H4O A;  1XPR A;  3OWE B;  1QNU A;  2D9U A;  2ENB A;  1FR3 A;  3D3R A;  3H6M A;  2NVX H;  3TN2 A;  1A3V A;  2G9H D;  1B1Z A;  3J80 E;  5D65 A;  3HOY G;  3GQB A;  5CV6 A;  4HJ5 A;  3BZK A;  4LAA A;  3GTP H;  1I6H B;  1NTG A;  2WAQ E;  4IFD I;  1UE5 A;  2KVM A;  4DR2 Q;  1P16 A;  1JB3 A;  3GV3 A;  4AYB E;  2A69 C;  1ONL A;  4GKJ L;  3M4Y A;  1SSO A;  2EY6 A;  3F2D A;  1Q8I A;  1VQL A;  3W5O A;  1TVX A;  1LTA D;  3UDF A;  3TS0 A;  4A3K H;  4HR7 B;  2F0S A;  3AEV A;  1EY9 A;  1AH9 A;  3HOZ B;  4JCV E;  2R7Z G;  2VXW A;  4BBS H;  3QB3 A;  3K57 A;  1S4Z A;  4B3R L;  2NBF A;  1Q82 C;  5EKK A;  2LKV A;  2L15 A;  5EKI A;  3H0G B;  1XNR Q;  1PFB A;  5C3X A;  1O7I A;  1EYA A;  2N3S A;  1IYJ B;  4K5W A;  4A3B B;  4AQY Q;  5IYB H;  1ZYR C;  2F0H A;  5DAU A;  3KFU A;  4KJO A;  2LFN A;  3RLF A;  1RJT A;  1ICW A;  2EZV A;  3HOU B;  1QZH A;  1Y14 B;  1EY8 A;  1VQA A;  3S1M B;  4GN4 B;  3RD4 A;  1RCV D;  4JI3 Q;  1LTT D;  1VQM A;  5IP7 H;  4Y7N B;  3TP7 A;  1PTO C;  2OCE A;  1PH2 A;  2FHT A;  2E5L Q;  3KF8 A;  4JBK A;  4A3I G;  1VQN A;  2L0C A;  1XPU A;  4FO2 A;  1TY0 A;  1V8Q A;  2UUC Q;  2E2J B;  2WB1 E;  2O4X A;  2CQO A;  2PQA B;  3J80 L;  1HNX L;  1GHK A;  4C3J H;  4DV3 Q;  4Q5V A;  2F1M A;  2FMC A;  4IQZ A;  3HOY B;  3PO3 B;  1LT4 D;  5LMN L;  1TWG B;  1HNW Q;  4HED A;  3H15 A;  4M1U B;  1HZA A;  3NWS A;  5EPJ A;  1N32 Q;  2R92 B;  3BDC A;  1JE5 A;  4MTK A;  1KDC A;  5JOB A;  5FLX L;  3M3Y B;  3E5S A;  3D4R A;  3MEF A;  3HFZ B;  4CKE A;  1PH3 A;  3BVZ A;  1Q1B A;  3RLN A;  1WI5 A;  2VQE Q;  1VF7 A;  1TWC B;  4K6L A;  5IWA L;  3MZ5 A;  3L7Z C;  3I7F A;  1JOO A;  4A3C G;  4BXX G;  2A19 A;  2E2H B;  3MA2 B;  1I4Q A;  3K6O A;  4X64 Q;  3CCU A;  5C0X I;  4IAL A;  3STB D;  2JSO A;  2D62 A;  1EQQ A;  1LTG D;  3RMH A;  4ODG A;  4UY8 C;  3S2D H;  2NVT B;  3ER0 A;  3QG1 A;  1S5E D;  3I4N G;  3CCS A;  1F2Y A;  1B44 D;  4L5Q A;  1HXY D;  1PA6 A;  5IGF A;  1H9J A;  4LMQ D;  1JJC B;  2OQK A;  1WTX A;  4JYA Q;  2KUM A;  1UWV A;  4N8F A;  3V05 A;  1PRT D;  1EYD A;  1D7Q A;  1HTP A;  2KOL A;  1MHW C;  1SYD A;  4J1M A;  1JC7 A;  1KTK A;  4P2C B;  4ZAI A;  5I2X A;  4NKL A;  5ELB A;  3U58 A;  1BF4 A;  1ENC A;  1QIL A;  5IOC A;  4CKC A;  4A3I H;  1A3U A;  4QJF A;  2CQA A;  4MTN A;  1VQB A;  4X6A H;  3CP0 A;  4IUU A;  1NBW A;  3OIP A;  1YIT A;  1A15 A;  5M9O A;  3MXP A;  4A3M G;  3M4O B;  1EZ6 A;  4DXG A;  3C46 A;  1S5C D;  1QJO A;  3HKZ B;  4IPG A;  5C6A A;  3CF5 A;  3KBX A;  2Z8L A;  2JA6 B;  1I94 L;  3NSW A;  3S16 H;  1FVI A;  3KF6 A;  4DNR B;  1BCP C;  4E6I A;  2K75 A;  4LJZ C;  3HOV B;  2KEN A;  1HRJ A;  1HUN A;  4DV2 L;  4HCE A;  4ILW A;  1LTS D;  2BE5 C;  2KCN A;  2K7V A;  1WTQ A;  1RDP D;  2RKS A;  4OX9 L;  4K8I A;  3I90 A;  5LMN W;  1II3 A;  3A8K E;  1PH4 A;  1PFS A;  2CWP A;  2BH8 A;  4LFC L;  1DD2 A;  4OO1 G;  2M00 A;  1Q12 A;  2J4X A;  3T56 B;  2SDF A;  5CV8 A;  1X3F A;  3GTL B;  4A3D B;  3CCR A;  2A1A A;  4IPC A;  2HD3 A;  4X62 L;  2PQE A;  1SN8 A;  1S40 A;  2PNH A;  3U50 C;  2Q2I A;  2EOT A;  5COR A;  4JI2 L;  5ELN A;  4GKK L;  1TT2 A;  1C9O A;  1CKN B;  1TS2 A;  4K5V A;  1PXU A;  2GN5 A;  4KN4 C;  2CW0 D;  3P7J A;  4UAI A;  1LO5 D;  4NMZ A;  1JQY D;  4DR1 L;  1IKL A;  3FVQ A;  5GAH C;  3I4N B;  1SDF A;  4K0K Q;  2HCI A;  3PO2 B;  1EOV A;  2SOB A;  5COY A;  1B53 A;  2F3I A;  2PZU A;  4Y52 H;  1B9N A;  1LTI D;  1A2U A;  4EQ5 A;  1W2B A;  2KCT A;  3EJI A;  2N8N A;  1YHQ A;  4A3M H;  2JA8 B;  1HH2 P;  4PMC A;  4A3L H;  3PUZ A;  4ZCK A;  3I4M G;  4CHT B;  3PMF A;  3N6R A;  4RKB A;  2K04 A;  4PG3 A;  2XGT A;  4R4O A;  3GTQ B;  4B3M L;  4LF6 L;  4DUY L;  4NXM Q;  4GLV B;  4HIK A;  2K52 A;  5JEA G;  1I3Q H;  2I46 A;  2VB3 X;  3S1Q B;  4JI7 Q;  2JA5 B;  4HJ7 A;  3JAM c;  3R2I A;  3BZD B;  1ILQ A;  4L6T B;  4QUC A;  1Y8P B;  1SNQ A;  1B3Q A;  4H02 A;  1MBY A;  3Q6S A;  3PGZ A;  3Q8D A;  3RNU A;  4FXD A;  5CV9 A;  2RDH A;  4OO1 H;  1LV9 A;  1I5F A;  4V19 0;  2NN6 G;  2D2C C;  2BH2 A;  1ROD A;  5IP9 G;  1NE3 A;  1KD1 C;  3NHH A;  3L0O A;  4P75 A;  3TZU A;  4S3S A;  4EQP A;  4IOA A;  5KIX A;  2F0P A;  2F4I A;  3FHW A;  4XQN A;  1G2T A;  4J15 A;  1DOK A;  2MP1 A;  1DGS A;  4JG2 A;  2KHJ A;  2K6A A;  3RZO B;  2OTL A;  4GLX A;  2Y0S B;  2SEB D;  1TR5 A;  3LWU A;  1JOK A;  1CSQ A;  1EIF A;  1T5E A;  3TBI B;  2Z9H A;  5KEE A;  3H3V H;  4LF7 L;  3CPF A;  4DAM A;  5C3E H;  2MQH A;  5IGC A;  3GTK B;  1SE8 A;  5C3W A;  3C3L A;  1F77 A;  2ID0 A;  3I4M H;  2R93 B;  4YWK A;  2A8V A;  3FP9 A;  4HAE A;  2JYO A;  2K5W A;  4LF8 Q;  5JJL A;  4G4K A;  4JV5 L;  5JEA H;  3R8B A;  5EGT A;  1VQ7 A;  3S2H B;  3ERS X;  1A0I A;  3BZC A;  1A3T A;  1WTW A;  1Y69 U;  1TY2 A;  3PV0 A;  2F4V L;  3TQY A;  1KLU D;  2F3W A;  3QOL A;  3E0J A;  1U4P A;  2RDG A;  2RBM A;  4C3H G;  3HOW G;  1SNC A;  2L5T A;  1IW7 C;  3CRK C;  1Y8O B;  3NTI A;  5LL6 S;  4B3S Q;  1HUM A;  2NN6 H;  1JB7 A;  4KHP Q;  2JN4 A;  3GTJ B;  2GVB A;  4X65 L;  2Q2H A;  1V1P B;  2IW3 A;  4RA8 A;  5IP9 H;  3NP8 A;  2XVS A;  5IIF A;  2LXJ A;  4TVA B;  1C4Q A;  3UE0 A;  5C4H A;  1SJH D;  1UE7 A;  2HDL A;  2WAQ G;  3A0J A;  3TME A;  2BA1 A;  1ENF A;  3QOJ A;  1S3O A;  2L11 A;  1YNJ C;  2PNR C;  1V1Q A;  2Q8R E;  1KXL A;  4L5R C;  2VL6 A;  5KNB A;  4EVO A;  3A8I E;  2DNE A;  4K2K A;  2B63 B;  4OEL B;  2R6G A;  3ULJ A;  2GVA A;  2RA4 A;  4A3J G;  4DAP A;  4JI6 Q;  1SMY D;  2PZT A;  5LL6 X;  3BJU A;  1PFN A;  2N78 A;  4DAY A;  2VUM G;  2WAC A;  1TWH H;  1S72 A;  4APV A;  4WFN 3;  1STE A;  3RR5 A;  2XNA C;  3CC4 A;  4DAV A;  1JIC A;  2EJM A;  2NYZ D;  3URY A;  3PQI A;  4R4Q A;  2EYH A;  1ILP A;  4MNO A;  3S1N H;  5I6W A;  4C3H H;  3HOX G;  1SEB D;  4DR2 L;  1YJN A;  3DWP A;  3VR2 A;  1OXV A;  3ND9 A;  3HGB A;  1M8A A;  2B2T C;  4R8I A;  2AQ1 B;  4CBV A;  3WOE A;  4F88 A;  2B8F A;  5DM6 3;  1YJ9 A;  3HOW B;  1F9R A;  1O80 A;  3D8G A;  1BBX C;  3A74 A;  3FPP A;  2WV6 D;  1D8L A;  2OT2 A;  5DLQ E;  3UDI A;  1IHZ A;  4RWS C;  5E4X A;  4H0L C;  2Y0S E;  3X3M A;  1VQD A;  1SFO H;  4XQJ A;  5JPN C;  3X3N A;  1GUO A;  3GDE A;  4ZUI A;  2NZO A;  1XNR L;  1YNX A;  2PMZ B;  4GS3 A;  2UUA Q;  1QB5 D;  5G3L F;  5JAV A;  1XX8 A;  4KKU A;  2ZXP A;  2B2U C;  5C4Z A;  4A93 H;  3GTO H;  1PYW D;  3DWQ A;  3PUX A;  1JT8 A;  1IYV A;  1ZXT A;  1KHI A;  1CA5 A;  4LF4 Q;  2AMC B;  1SBB B;  1R4Q B;  2R7F A;  5C5L A;  2BA0 A;  3DEP A;  1RL2 A;  3AFP A;  1XJV A;  1ZEQ X;  4IUV A;  3V96 A;  4A3J B;  4DK1 A;  2NTT A;  1GJX A;  5GAG C;  4JI3 L;  1Z6H A;  1TS5 A;  3K5L A;  1KL9 A;  1UE1 A;  5EKL A;  3OMC A;  5IGB A;  3GTM H;  3VYT A;  1YHB A;  2E5L L;  4HJA A;  4DFA A;  3KOJ A;  1Y1W B;  2EJG C;  2ICI A;  2WII B;  2UUC L;  4DV4 L;  1LM0 A;  4DR3 Q;  2IX1 A;  2K5Q A;  2O5I C;  1ASY A;  1BKB A;  4DK0 A;  3HOX H;  4DV3 L;  2B2T A;  1JOQ A;  1O7L A;  2CH4 A;  3W3A A;  4IFD G;  3SK4 A;  1FGU A;  3PSI A;  2KEC A;  1N32 L;  1WD0 A;  2WKD A;  3ND8 A;  1B4O A;  1EY7 A;  1Y1V B;  1BBW A;  2NVQ H;  2WIN B;  2VQE L;  1G8Z D;  2CWA A;  4A3K G;  1JWU D;  4LF5 Q;  4EQN A;  3W1B A;  1PV4 A;  3CQZ B;  2HIV A;  2OF1 A;  4BBS G;  1HHV A;  4GOP B;  1KRT A;  3DMU A;  5CYU A;  2YTV A;  1KQS A;  4KV6 A;  3FPU B;  2NZ1 D;  5CMD A;  3A55 A;  3Q23 A;  3SK8 A;  1DOM A;  4DN4 M;  1H95 A;  4R4T A;  2LSS A;  4IUN A;  4RHR A;  3GO5 A;  5JVG 3;  3I73 A;  3KLR A;  4RG1 A;  4JYA L;  1NY4 A;  1PVO A;  1HTL D;  1U4M A;  5TSS A;  5EPK A;  4JI5 Q;  2SNS A;  2V4D A;  2Q8T A;  3NWT A;  2EPB A;  4KD4 A;  2B2W C;  2UXC Q;  1XMO Q;  5IP7 G;  4LUV A;  4X66 Q;  1KAW A;  4XYO A;  1TWA H;  4R8N A;  1R9T B;  1XMQ L;  3OSO A;  1X56 A;  4DR5 Q;  1BDO A;  2NVX B;  1Q46 A;  2YTY A;  4GLA C;  1HR0 Q;  2E75 C;  4OHJ A;  4FP5 D;  1VDZ A;  4IFD H;  4C3J G;  4EQO A;  1FNV A;  5T1I A;  1HQM C;  1CUK A;  3OW7 A;  1SAP A;  2QF7 A;  3IFD A;  3GTP B;  1A2T A;  1K3B C;  2QKI C;  3T1Y Q;  4LFB Q;  3IKJ A;  2F0U A;  3W1G A;  2PMZ E;  4R1J A;  3S24 A;  3TS2 A;  2ZXO A;  1L0W A;  4YCW A;  4OXP A;  4ZUJ A;  1WFQ A;  1N33 Q;  3J81 i;  2L4N A;  3P1H A;  4IUP A;  3SDZ A;  2HQE A;  3CCM A;  3OYY A;  4A3K B;  3K81 C;  1KIX A;  1EWI A;  4DUZ Q;  1B3A A;  1F2Z A;  5IYD G;  1YBY A;  2EIF A;  1LTB D;  3LGJ A;  4DR7 Q;  4XT1 B;  1IXR A;  1R4P B;  5CV5 A;  4BBS B;  3D31 A;  2HHH Q;  4J6H A;  5JJI A;  5FLX c;  3P75 A;  3AQQ A;  4QL5 A;  3J81 L;  1ASZ A;  3DM3 A;  4ALP A;  1KDA A;  3G48 A;  2F3V A;  3KUP A;  5ELO A;  3H94 A;  1BQQ T;  2ZXR A;  4ABN A;  4LUO A;  4ID6 A;  2B2W A;  2ASB A;  3EQL C;  1PDQ A;  1PLF A;  1U0L A;  3KJO A;  2ATW A;  3J80 i;  5C5M A;  2ZJQ A;  2IJ0 A;  1SE4 A;  4UPA A;  1U4R A;  2EYL A;  4LWC A;  1B9M A;  5FK9 C;  3CCE A;  2EYM A;  3S1M H;  1G6Z A;  1B70 B;  1H9S A;  5M3M G;  1IBM Q;  2FIN B;  4BA1 I;  4AIM A;  4JI4 L;  4A76 A;  1JOR A;  1E24 A;  2ZT9 C;  2XIW A;  1E1T A;  1RTO A;  4P71 A;  1K3R A;  1W6J A;  2AQ3 B;  2NVY B;  4NXM L;  1SNO A;  1A6X A;  4LW1 A;  3A8J E;  2LS0 1;  2KHS A;  1DJR D;  1H9R A;  3A56 A;  3C1F A;  4JI7 L;  4H44 C;  1V43 A;  1PTO H;  5BR8 L;  2IX0 A;  4ME5 A;  2PZW A;  1EY5 A;  1XTC D;  1BR9 A;  3QO2 A;  1VQE A;  2A6E D;  2MO1 A;  3I4L A;  2F0T A;  1FJG Q;  3OMG A;  4M8A A;  1X3P A;  5T1G A;  2OXP A;  5KRU A;  1VQJ A;  3DUZ A;  1Z47 A;  3AU7 A;  1LYL A;  2K03 A;  3STB C;  4LF9 Q;  2YV5 A;  3G6J B;  5J39 A;  1VS0 A;  1YJW A;  1SR3 A;  1UNS A;  5IYD H;  1TWC H;  5C0X H;  2R7Z B;  2PO4 A;  1N36 Q;  2R3Z A;  2WKC A;  5FLM H;  1EU4 A;  4HCS A;  3PIO 3;  5KYL A;  3NXW A;  5M5X B;  1PH8 A;  4NXN Q;  5CR3 A;  3PF5 A;  4LFA Q;  1PRT C;  3S1R H;  1GOZ A;  3KF6 B;  4PQX A;  1SYC A;  3KK7 A;  1X65 A;  1K0S A;  4DXF A;  3NEM A;  2PQA A;  3S2D B;  3NBI A;  4DU9 A;  2WP8 J;  2QDL A;  2PI2 E;  2F03 A;  2RF4 A;  3K7U C;  2YTX A;  1E1O A;  2V1C C;  5JEA J;  1PRT B;  2I07 B;  2MHV A;  3I72 A;  5M3M H;  3M7N A;  3LX0 A;  5DNF A;  3MHB A;  2QA4 A;  1STG A;  4C3I G;  4PMW A;  4QGU A;  1SYG A;  2UUB Q;  1YEZ A;  4DR4 Q;  1VQO A;  1HCZ A;  5KYI A;  4A3L G;  2F0V A;  4A3I B;  2CVR A;  3M4O H;  1CTM A;  3OW2 A;  4BY7 G;  1MSH A;  1GKH A;  2LMC B;  4PMB A;  1PTO F;  2Z6B A;  2QGQ A;  2DGY A;  2F52 A;  3G7L A;  2IWH A;  3F2U A;  1K8A C;  3SK5 A;  2JA6 H;  2F0K A;  4YWM A;  3T13 A;  2G9D A;  1KNE A;  1X54 A;  3S16 B;  4C2M B;  5I4D A;  1EUJ A;  3CHB D;  1KC8 C;  1PZI D;  4XXE A;  3T4A C;  1K8M A;  4B3S L;  2EY5 A;  4YY3 Q;  1AEX A;  4KHP L;  1RKN A;  1JMC A;  1EZ8 A;  1C7Y A;  2Z1C A;  3CC2 A;  4GKJ Q;  3K5O A;  2E76 C;  1QG7 A;  2OEO A;  2EYF A;  3K7A H;  2F0N A;  4HTH A;  2Q8I B;  3CCV A;  4A3D H;  5HUR A;  5HY6 A;  2CW0 C;  4JI0 L;  3M9B A;  4XDX A;  3AB9 A;  1EEF D;  3BG3 A;  4ZKB B;  4FF3 A;  1XXG A;  4QY7 A;  5C4J H;  4CKB A;  4KHZ A;  3OIQ A;  3RZD H;  2XN9 C;  1OXX K;  2EQS A;  4C1N K;  4EX5 A;  3VYR A;  5IT9 c;  1NMG A;  1Q8K A;  1GHJ A;  5C3E G;  3UI2 A;  2NUC A;  2QCP X;  1TII D;  2K01 A;  4C3I H;  2K05 A;  4LNQ A;  3RUZ A;  1C0A A;  5KND A;  4HSP A;  4JI8 L;  1BUV T;  3JAM E;  1HPC A;  3HG9 A;  1VQG A;  4OEM B;  1QWY A;  2JA8 H;  1CQV A;  4A3M B;  4JBM A;  1GVP A;  4BY7 H;  2F0O A;  3FEW X;  3KJP A;  4JVZ A;  1NAP A;  3NEN A;  4FYD A;  2E74 C;  3GTQ H;  2NTS A;  2RCF A;  1MGS A;  2E2I H;  5CV4 A;  1SXT A;  5GQO A;  2XWJ B;  5I6Y A;  4MIU A;  3S15 H;  2Q2U A;  4XYQ A;  4IUQ A;  1SE3 A;  1O7Y A;  4FNF A;  1LT3 D;  4MHE A;  1I3Q B;  5AJ3 L;  4B08 A;  3VDY A;  1CKN A;  1HNX Q;  1RTN A;  3V2T A;  1CFM A;  4PZ6 A;  1QUQ B;  1Q7Y C;  1K83 H;  3ONA B;  4G7O C;  2ZM6 Q;  1GUW A;  1BCP F;  1E2W A;  4JI1 Q;  3TZD A;  3OTO Q;  3C2P A;  3TRZ A;  2N55 A;  2O5J C;  2L9H A;  1GUS A;  2VQF Q;  5L37 A;  1STN A;  3MXG A;  4FF4 A;  2CHB D;  4QMG A;  1DXM A;  1HA6 A;  4QF4 A;  4OO1 I;  5EBD A;  1ESF A;  1Q1E A;  2R61 A;  2VS1 A;  2HUG A;  4MN3 A;  3N52 A;  2UUA L;  2M2L A;  1GXD C;  4K8J A;  3M4P A;  1SE2 A;  5M3F H;  4RHS A;  1N34 L;  1AZP A;  2HDM A;  4O0A A;  3GD7 A;  5LMU Q;  1OTC A;  3PUV A;  3HKZ E;  3ERQ A;  4LF4 L;  1I50 H;  1VQC A;  2KJX A;  1XNQ L;  4FXK C;  4UP8 A;  3KLW A;  3U4Z A;  2I5M X;  4WOR A;  5BN3 A;  4P74 A;  5I9O A;  2X69 A;  2A6H D;  3OOC A;  3M85 A;  5M5Y H;  5I2Y A;  3JAM L;  4QIW B;  2Z4I A;  4KKT A;  1EY4 A;  3AYH B;  1WCM G;  3I4M B;  1LAC A;  4HIO A;  3OWF A;  1QNK A;  1UEA B;  5E7N A;  3R2T A;  3BVG A;  3J7Y W;  3NE5 B;  3PIO A;  1SJE D;  3NK9 A;  1M1K C;  2Z6K C;  1HJP A;  4RAU C;  3BVM A;  2EXZ A;  1E2V A;  4GN5 A;  1J5E Q;  3ZYY X;  3G71 A;  5KNC A;  3NTH A;  1Z7T A;  1MIU A;  4DR6 Q;  4JOI C;  2E8G A;  4P73 A;  3QWN A;  1TS3 A;  4DV0 Q;  1K8O A;  4BBR H;  5ISR A;  4KHV A;  1Q81 C;  4WJ4 A;  1PZJ D;  4LF5 L;  2K5V A;  5D14 A;  1X6O A;  1M4V A;  4A3F H;  2WFW A;  4P72 A;  4IUT A;  1VQH A;  3GTG H;  3U9O A;  1IKM A;  4DK6 C;  3F1Z A;  4AYB G;  1WD1 A;  1KDB A;  1F2M A;  2KQ3 A;  1BNZ A;  2VW9 A;  4TSS A;  1E22 A;  5ELC A;  1E0B A;  3BYY B;  5G3L D;  4PNY A;  4GNX B;  4A93 G;  3MXU A;  1CM9 A;  3S17 H;  3MXN B;  1EY0 A;  1SMY C;  5EQ0 A;  3I70 A;  1VQI A;  3K58 A;  4QCL A;  3MAQ A;  1V9P A;  2K28 A;  3HZX A;  3NQT A;  3TP6 A;  4JI5 L;  1F2L A;  3CMA A;  4PV1 C;  1LTL A;  5EJW A;  2EE1 A;  4HID A;  4IFD J;  2DNC A;  4X66 L;  1WCM H;  3BS1 A;  1I4H A;  4KLK A;  4A75 A;  3P20 A;  1TWF H;  2D5D A;  5A2Q E;  1JWM D;  3SEB A;  2Z6K A;  4BS9 A;  2F0J A;  3BU2 A;  1TWH B;  1MSG A;  1HR0 L;  1K8G A;  2K14 A;  1O7Z A;  4JOI A;  2JA7 H;  1QVG A;  3S1N B;  4C3H B;  4LUZ A;  3F8T A;  1I4G A;  4BY1 G;  3T1Y L;  1HNZ Q;  4OIK A;  4ME3 A;  3RLO A;  3S14 H;  1TU2 B;  3ZJY C;  3FKI G;  3L9A X;  4A3G H;  1X3Q A;  1FYC A;  2WB1 G;  3VA5 A;  1RHP A;  3CW2 C;  3EBE A;  4U67 3;  1N33 L;  1LT6 D;  5DEH A;  3R93 A;  2OWO A;  1N9W A;  5FO8 B;  2B39 A;  5ELE A;  4DUZ L;  3MC0 B;  1F9Q A;  2IT1 A;  3VR3 A;  3A54 A;  3NUC A;  5C4X H;  3EVQ A;  1WYD A;  4A3E G;  2SNM A;  4TRD A;  1I4X A;  5FOB B;  2WAQ B;  2HHH L;  2RVL A;  5C44 H;  2TMP A;  1W6K A;  4AQY L;  1SFO B;  2JXM B;  1CZG A;  3A7L A;  1M90 C;  4IUR A;  4X3T A;  3WWV A;  2N49 A;  4QIW E;  4U68 A;  5KGU A;  1A63 A;  4A93 B;  4ZK9 B;  1TQO A;  4NDX A;  3DLL A;  1F9P A;  4IO9 A;  3IFT A;  3K5N A;  3EN2 A;  2YU9 H;  3VR4 A;  3CCL A;  2ZJR A;  1PH9 A;  4B3T Q;  1IZ6 A;  3RN5 A;  3BYT B;  2VY3 A;  1YZ6 A;  1LUZ A;  4RCO A;  1G2S A;  3EFX D;  5D3D A;  4LF7 Q;  3IAY A;  3BDO A;  3CXC A;  1HZB A;  4DV5 Q;  2VUM B;  1IBM L;  1GUN A;  1PH6 A;  1ML0 D;  4O42 A;  1K0R A;  3GTM B;  4MZ9 A;  4DPG A;  4GN3 B;  2OQ0 A;  1L1O B;  3ULP A;  2UXD Q;  1ESR A;  1HNW L;  2EY2 A;  3NQI A;  1O78 A;  4HJ8 A;  3HS0 C;  1EYC A;  4BY1 H;  3KBG A;  3HOX B;  4NPS A;  2CFM A;  1U9R A;  4IZ8 A;  4GOP C;  1B50 A;  4G57 A;  1YNN D;  1HR0 W;  1VQ9 A;  3FKI H;  3C1E A;  1NNX A;  1CK1 A;  4L5S A;  1DZ1 A;  3AFQ A;  1I4R A;  2H1E A;  5E3F A;  4K2L A;  1EWH A;  2FXQ A;  5CBA E;  1FL0 A;  2AKW B;  2LXK A;  4PZ7 A;  4RH6 A;  4UDU C;  2B2Y C;  1BVS A;  4X64 L;  2NVQ B;  3H91 A;  4B9W A;  2A74 C;  1A62 A;  2B2U A;  4K14 A;  4A3E H;  1VQF A;  1PH7 A;  2B29 A;  4HN7 A;  3PIP 3;  1QVC A;  1U4L A;  1G51 A;  2HQL A;  3JC6 6;  1IBL Q;  3IRB A;  3SR1 A;  2X6L A;  3KDF A;  3O13 A;  1TKW B;  1E7Z A;  1SMX A;  4RFB A;  5I9P A;  4O2D A;  4NXN L;  3H0G G;  2MJ8 A;  1QOH A;  4ULL A;  2F0I A;  3L2P A;  1STA A;  1EQR A;  3D6W A;  4LFA L;  1UUP A;  1VCI A;  5IE8 A;  2B8G A;  3FMC A;  1AZQ A;  5JJK A;  1AP0 A;  4RGM A;  5M5W H;  1EIG A;  2X6G A;  2BOS A;  3UE1 A;  4F87 A;  2KCM A;  1NMF A;  1STH A;  3IL8 A;  4HSV A;  3WDN A;  1FNU A;  4DKA C;  4DGZ A;  1HQR D;  3J81 c;  4DV6 Q;  2A68 D;  3D4W A;  2UXB Q;  2UUB L;  1D6E C;  4KK7 A;  5JVH 3;  2EVB A;  4KY6 A;  1WJJ A;  2A5H A;  5EPL A;  4CGY B;  1DON A;  2AWO A;  4PZ8 A;  1EIH A;  2MPM A;  3K5M A;  4DV7 Q;  4WJ3 M;  2JQO A;  4GOP A;  1I6H H;  2RCN A;  4R4I A;  3T53 B;  1JR0 D;  3K59 A;  3E0E A;  5FKA C;  2VNU D;  1JCK B;  3PO3 G;  4OWW B;  3DM1 A;  1J9O A;  1TS4 A;  1VMC A;  2I5L X;  3K0X A;  3K80 C;  1DOL A;  2L12 A;  4ZLT F;  2B2Y A;  4UP9 A;  2R92 G;  3NEL A;  1GD7 A;  4G7Z C;  2K4K A;  3SE0 A;  4YY3 L;  3U4V A;  2R7D A;  5FLX E;  5FJ8 G;  1FD7 D;  3J80 c;  2IY5 B;  1QE6 A;  2CCZ A;  1HFG A;  3HOZ H;  3NBH A;  3KF8 B;  5C0X G;  1H9S B;  2A69 D;  1B8A A;  2J7Z A;  1GM5 A;  4KN7 C;  5IYC G;  1ZKO A;  2F0E A;  4DA2 A;  1CKO A;  5HGQ A;  5FLM G;  3A5U A;  1IYU A;  3H0G H;  3J7A V;  1VQ5 A;  1E3P A;  1S5D D;  2UU9 Q;  1B7Y B;  1DCZ A;  1SLJ A;  4A3B H;  1NSN S;  4KI0 A;  2PI2 A;  3OPO A;  2XWB B;  4K0K L;  1JE4 A;  2B2V C;  4WJW A;  5D3I B;  1TXY A;  4KJN A;  1T5X D;  1OO9 B;  4WRD A;  2CKZ B;  3HOU H;  1X3E A;  1SYE A;  5J1Z A;  1VQK A;  1HFN A;  1I4P A;  4V0B A;  3KLS X;  1ZYR D;  3DHQ A;  2JEB I;  1EQT A;  4Y7N H;  1D2B A;  1QZG A;  1EU3 A;  5BN4 A;  2KBN A;  1CT1 D;  2LY7 A;  4QQB X;  2F0D A;  4LK1 C;  2PCF B;  4XQQ A;  2IX3 A;  4DV1 Q;  3PCO B;  3SK6 A;  4B9X A;  2E2J H;  3I91 A;  2F0L A;  4UHV A;  2DY7 A;  5IGE A;  1S5F D;  2A6E C;  3HKZ G;  4C3J B;  3HOY H;  1PTO D;  3PO3 H;  2NVY H;  1VF5 C;  1TWG H;  3T1H Q;  4YHH Q;  3F2B A;  2ZTD A;  1QVF A;  2JE6 I;  3G6E A;  4DV4 Q;  2JA6 G;  2R92 H;  1DM0 B;  3M3Y H;  1PYB A;  1T9H A;  3TP8 A;  2PW5 A;  3HOV G;  4TQU S;  2JP1 A;  2PYK A;  1IL2 A;  1PTO B;  2C5C A;  4N8X 1;  5FJ8 H;  1EL0 A;  3CME A;  3E6Z X;  4ZQ3 A;  2ZM6 L;  4RGT A;  1EEI D;  1H9K A;  3UDX A;  4JI1 L;  3OTO L;  4O1N A;  3VR5 A;  5IYC H;  3MVV A;  2E2H H;  4XTC S;  2VQF L;  2KEE A;  1C48 A;  1AE3 A;  3SHL A;  1QCB D;  2BDO A;  1SNP A;  3KLS A;  2R7Z H;  4A3D G;  1EFI D;  2DJF C;  1H9M A;  5CGK A;  1IBK Q;  3A5Z B;  4FXG C;  1WTV A;  2B2V A;  1V1O A;  5JPM C;  2NVT H;  4YCV A;  3I8Z A;  2ALY B;  5M5X H;  1XTD A;  3PF4 A;  4RGO S;  1BXT A;  3CCJ A;  3MTS A;  4X3U A;  1VMP A;  4CDF C;  1SRO A;  3M4Q A;  3PUW A;  4ZKC B;  5LMU L;  1KNA A;  2FFK B;  3S1R B;  2YYZ A;  2IHE A;  2MNA A;  1U5K A;  4YIJ A;  3HP3 A;  1SYF A;  3PO2 G;  1WTP A;  1UEB A;  2NWG A;  3CRL C;  1K28 A;  3ITP A;  1LTR D;  4FF1 A;  4K5X A;  4JBW A;  2ICE C;  1YHA A;  5CBE E;  4JPB W;  3VYU A;  4LF8 L;  5M3M B;  5H1S E;  5LHY 1;  1NR4 A;  2JA8 G;  3EA6 A;  1STY A;  3PIP A;  2QIL A;  4IPH A;  2AUK A;  1S5B D;  1XMQ Q;  3J81 j;  2F0G A;  3FRP B;  4H7B A;  3LWE A;  5K36 G;  3HOV H;  4CDE C;  1N8R C;  2JA5 G;  1J5E L;  2XSC A;  4HMJ A;  1UAP A;  3QIA A;  1PMR A;  3SGI A;  3OHX C;  4DR6 L;  4C2M H;  4QB4 A;  2M9V A;  4IOC A;  2TSS A;  2F0M A;  4DV0 L;  1BCP D;  1J6Q A;  3HEJ A;  1J8I A;  2CH4 W;  3PUY A;  1PFM A;  3GTL H;  3VYS A;  4A3C H;  2BE5 D;  4BXX H;  3J7A 5;  1PYS B;  1STB A;  2IPK D;  3MFG A;  1BCP B;  3LNN A;  2GA4 B;  4JW0 A;  5IT9 E;  1B2T A;  1YI2 A;  1E2Z A;  2F0W A;  4CDC C;  3K7A B;  4KY7 A;  1CZW A;  3S9W A;  1EWC A;  3VA7 A;  4B3R Q;  3WOF A;  2PW7 A;  1MI2 A;  3ICE A;  5M3F G;  4H13 C;  1SYB A;  2RHQ B;  4HMI A;  5C4J B;  3I4N H;  3CPW A;  3PO2 H;  3GP7 A;  3RZD B;  2Y0S G;  4JI6 L;  1SND A;  2HCC A;  4DF7 A;  1X3G A;  2XRS D;  1PRT F;  1K73 C;  2ES2 A;  1GUT A;  1W3S A;  2O2L D;  2IL8 A;  4JC0 A;  4C3I B;  4UP7 A;  3Q0A A;  2RHS B;  4OON A;  1PHJ A;  1L0Y B;  2DY8 A;  2R93 G;  3U9S A;  4C56 C;  1LT5 D;  5K36 H;  2Z0S A;  3D4D A;  2K50 A;  2BDN A;  1HZC A;  3S1Q H;  5F2D A;  4BY7 B;  4JI4 Q;  1KAB A;  2HIX A;  2JA5 H;  4FVM A;  2MGS A;  3TSS A;  4NB3 A;  3UDG A;  2DN8 A;  1VQ4 A;  2E2I B;  2RQX A;  5LMN Q;  1WTH A;  4I7A A;  2KCC A;  4BWG B;  2Q2T A;  4YCU A;  3S15 B;  4OWX B;  1Y8N B;  4BA2 I;  2DUD A;  1HNZ L;  4RMF A;  2JK8 A;  2VZA A;  1EYG A;  5BR8 Q;  1WOC A;  4HJ9 A;  1OXS C;  1JWS D;  1XWE A;  3SVM A;  1K83 B;  3D6C A;  3RN2 A;  4BBR G;  4EGV A;  2JJQ A;  5IWA Q;  1WVL A;  2EYJ A;  4A3F G;  4KMU C;  1D5M C;  2Z4H A;  3H09 A;  1WTR A;  1CHP D;  1EOT A;  1G29 1;  5IT9 L;  5A35 A;  1YIJ A;  4R9W A;  2F0Q A;  4AH6 A;  3H3V C;  4DNI A;  1P8L A;  2G5D A;  3M7G A;  3RZO H;  4XIG S;  3NTK A;  1CHQ D;  2QDB A;  2BCO A;  1PZK D;  3JAM i;  1MKH A;  2K32 A;  5IGG A;  5IOD A;  5M3F B;  2AQ2 B;  2AWN A;  2EDG A;  1CQF A;  2E2D C;  2EJF C;  5NUC A;  1G91 A;  2A6H C;  2B63 G;  3GTK H;  5C3E B;  3TDQ A;  3HKS A;  2L55 A;  1I50 B;  1D1K A;  4B3T L;  5EAY A;  2QW7 A;  2F0F A;  3TP5 A;  2QEX A;  1QUQ A;  3H3V I;  2R93 H;  1GO3 E;  3TRE A;  3B6Y A;  1L0X B;  4DV5 L;  4FF2 A;  4OIJ A;  4DR3 L;  3HRZ C;  3I2Z A;  4YWL A;  3S2H H;  5M5Y B;  1HA5 A;  1Q90 A;  2VB2 X;  2EY1 A;  4J8Q A;  2AHO B;  2UXD L;  5K5P A;  4CJ0 B;  3MWY W;  3Q24 A;  5E1F A;  1FNW A;  2KA7 A;  2JA7 G;  2JA9 A;  1I94 Q;  4L8J A;  2AUJ D;  4NW2 A;  5J3B A;  4FDB A;  4DV2 Q;  3CAM A;  4KY5 A;  3GV6 A;  1Z9F A;  3GTJ H;  4DAY B;  4F8M A;  1VQP A;  4A3G G;  4OX9 Q;  4GNX C;  1XPO A;  3T16 A;  3FDT A;  2ZJP A;  2DJG C;  2XRQ D;  4GZY C;  2NZH A;  2NN6 I;  1LAB A;  4BBR B;  4LFC Q;  1IW7 D;  1AN8 A;  2C35 B;  2HT1 A;  4I65 A;  3K8A A;  4OWT B;  1CSP A;  4F7X A;  4R4C A;  2MUY A;  5C4X G;  2JEA I;  4OGQ C;  4Q0F A;  1IBL L;  4A3F B;  4N9T A;  4X62 Q;  4HIM A;  5C44 G;  3I4O A;  3GTG B;  3CKI B;  4JI2 Q;  4CJ2 C;  4GKK Q;  4JBJ A;  1D1I A;  2RSO A;  4OL7 A;  2I0Q A;  1EFW A;  4JI0 Q;  5ELD A;  2KED A;  2B63 H;  1JJG A;  1JJ2 A;  1WTO A;  2OTJ A;  1GUG A;  4DR1 Q;  3S17 B;  1YNJ D;  1RIP A;  2XTI A;  2IHF A;  3A7A B;  2UXC L;  1XMO L;  5JJZ A;  2KHI A;  3EIV A;  5DM7 3;  1MJE A;  2EYP A;  4I7Z C;  2FJ2 A;  2RSN A;  4IPD A;  2ZTE A;  1V1P A;  1MD2 D;  4DV6 L;  4DR5 L;  2UXB L;  3QJY A;  4CJ1 B;  4X3K A;  4N9P A;  2B3G A;  1OXT A;  1WCM B;  3MFY A;  4JI8 Q;  1NJI C;  3E9H A;  1NR2 A;  2EXD A;  1KAA A;  1TWF B;  1Y1W G;  1VQ6 A;  1RD9 D;  4B3M Q;  4LF6 Q;  4DV7 L;  4QUF A;  3I3C A;  4DUY Q;  1IL8 A;  1SNM A;  3DWA A;  5HGT A;  2N88 A;  2A73 B;  2K33 A;  4LFB L;  4X3S A;  1Q3L A;  4GNX A;  2JA7 B;  3HOW H;  3KYH C;  3DEO A;  3ERO A;  3CU7 A;  3MXN A;  5AJ3 Q;  1Y1V G;  2H5X A;  4K6D A;  5GAE C;  3S14 B;  1RF2 D;  2D0O A;  2J0T D;  4A3G B;  1CKM A;  4DR7 L;  3E9I A;  2FMM A;  1G6P A;  4CDD C;  3D0F A;  4RCN A;  2MO0 A;  4KKS A;  1KLG D;  5AFW A;  3SXH A;  4AYB B;  4POG A;  4G7H C;  5C4X B;  2UU9 L;  5FO9 B;  4L5T A;  2D0P A;  5GAD C;  5C44 B;  3GTO B;  1X32 A;  2K5N A;  4RGN A;  4RKL A;  3CD6 A;  3I55 A;  2ZTC A;  5CV7 A;  2EYO A;  3W2D A;  1N34 Q;  5E4W C;  3T51 B;  5IY0 A;  1L1O C;  5ELF A;  1PH5 A;  4A3J H;  3I56 A;  2I5H A;  4L63 B;  2YU9 B;  1XNQ Q;  1ET6 A;  1OXU A;  3TEH B;  3J7Z C;  3L3O C;  4ZYS A;  1MJC A;  4A4I A;  5A2Q L;  1EY6 A;  3K0Y A;  1X55 A;  1LLR D; 
#chains in the Genus database with same CATH homology
 1TXY A;  4DV1 L;  1Y1W H;  2VUM H;  1AE2 A;  3HOW G;  3CCV A;  4A3D H;  2CKZ B;  3HOU H;  5HY6 A;  1X3E A;  3KDF B;  1VQK A;  4JV5 Q;  4B3S Q;  4JI0 L;  3M9B A;  1JB7 A;  4KHP Q;  2JEB I;  5C0X J;  4QY7 A;  2GVB A;  3ULL A;  4X65 L;  2Q2H A;  4Y7N H;  4POF A;  5C4J H;  4YHH L;  4KHZ A;  3T1H L;  1QZG A;  2KBN A;  1FJG L;  5IP9 H;  3RZD H;  2F4V Q;  1OXX K;  2EQS A;  4QQB X;  2LXJ A;  2MFI A;  4TVA B;  4EX5 A;  3UE0 A;  4DV1 Q;  1PH1 A;  3PCO B;  1UE7 A;  5IT9 c;  1Y1V H;  1NMG A;  1KRS A;  1VQ8 A;  1YVC A;  1Q86 C;  3CCQ A;  2E2J H;  4LF9 L;  1Q8K A;  2WAQ G;  5C3E G;  3A0J A;  2BA1 A;  4IJH A;  3HKZ G;  1S3O A;  4C3I H;  1A8V A;  3F2C A;  3CQZ H;  4LNQ A;  3HOY H;  2NVY H;  1V1Q A;  3HOZ G;  1TWG H;  3PO3 H;  4X65 Q;  1N36 L;  3T1H Q;  4JI8 L;  4L5R C;  4YHH Q;  5C4X G;  3F2B A;  2ZTD A;  1QVF A;  2JE6 I;  3G6E A;  2VL6 A;  4DV4 Q;  2JA6 G;  1SRU A;  1K9M C;  2R92 H;  1VQG A;  3M3Y H;  1PYB A;  1T9H A;  5GRO A;  3HOV G;  4TQU S;  1X9N A;  2JA8 H;  1IL2 A;  4DK3 C;  4JBM A;  5FJ8 H;  1IBK L;  1GVP A;  2R6G A;  3ULJ A;  4BY7 H;  3KJP A;  3CME A;  2GVA A;  3NEN A;  2ZM6 L;  4A3J G;  3GTQ H;  4JI6 Q;  4A3B G;  3CC7 A;  3UDX A;  1HZ9 A;  4JI1 L;  3OTO L;  2E2I H;  2UXD Q;  3BJU A;  5GQO A;  5IYC H;  2N78 A;  3S15 H;  2E2H H;  2Q2U A;  4XTC S;  2VQF L;  1L1O A;  2K5H A;  1AE3 A;  5AJ3 L;  2VUM G;  3VDY A;  1CKN A;  1EIY B;  1TWH H;  1S72 A;  1HNX Q;  2R7Z H;  1UE6 A;  4PZ6 A;  4APV A;  4A3D G;  1L2F A;  4IJL A;  1QUQ B;  5IYB G;  3HOU G;  3RR5 A;  1K83 H;  1Q7Y C;  1IBK Q;  3CC4 A;  3A5Z B;  2ZM6 Q;  2NVT H;  4YCV A;  4DR4 L;  4R4Q A;  1BBU A;  2ALY B;  5M5X H;  1XTD A;  4JI1 Q;  3NBH B;  4MNO A;  3OTO Q;  3G4S A;  3PF4 A;  3TRZ A;  3S1N H;  4C3H H;  3CCJ A;  1R9T H;  1SRO A;  2VQF Q;  3M4Q A;  3PUW A;  1XPR A;  5LMU L;  3HOX G;  4DR2 L;  1YJN A;  2YYZ A;  2IHE A;  2MNA A;  1U5K A;  1OXV A;  2NVX H;  4OO1 I;  1Q1E A;  2VS1 A;  3PO2 G;  2VNU D;  1YJ9 A;  1UEB A;  2UUA L;  3HOY G;  3A74 A;  4JBW A;  3M4P A;  1YHA A;  5M3F H;  1N34 L;  4HJ5 A;  4O0A A;  3BZK A;  3GD7 A;  1D8L A;  5DLQ E;  4LF8 L;  3GTP H;  1NTG A;  2WAQ E;  3UDI A;  5H1S E;  5LMU Q;  4IFD I;  1UE5 A;  2Y0S E;  3PUV A;  4DR2 Q;  1P16 A;  1OTC A;  3HKZ E;  2JA8 G;  4LF4 L;  1I50 H;  1VQD A;  1VQC A;  4AYB E;  1XNQ L;  1SFO H;  3PIP A;  4GKJ L;  4UP8 A;  3KLW A;  3U4Z A;  3F2D A;  3GDE A;  1VQL A;  2NZO A;  3W5O A;  4IPH A;  1YNX A;  1XNR L;  2I5M X;  1XMQ Q;  4GS3 A;  2UUA Q;  3J81 j;  4P74 A;  3UDF A;  5K36 G;  3TS0 A;  4A3K H;  3HOV H;  4BA2 I;  3GTO H;  4A93 H;  3AEV A;  1N8R C;  2JA5 G;  3M85 A;  1J5E L;  3PUX A;  5M5Y H;  1AH9 A;  4JCV E;  1JT8 A;  2R7Z G;  3SGI A;  4BBS H;  3AYH B;  1KHI A;  1WCM G;  4DR6 L;  4LF4 Q;  2AMC B;  4C2M H;  4HIO A;  5E7N A;  4B3R L;  2R7F A;  2BA0 A;  1Q82 C;  1RL2 A;  4IOC A;  4DV0 L;  3AFP A;  3PIO A;  2L15 A;  1XJV A;  1XNR Q;  1J6Q A;  1M1K C;  1O7I A;  2Z6K C;  3PUY A;  1HJP A;  2N3S A;  5GAG C;  4JI3 L;  1IYJ B;  3GTL H;  1KL9 A;  1UE1 A;  4AQY Q;  5IYB H;  4GN5 A;  1J5E Q;  4A3C H;  4BXX H;  3J7A 5;  1PYS B;  3GTM H;  3G71 A;  1YHB A;  1YI2 A;  2E5L L;  1MIU A;  4DR6 Q;  3KFU A;  4JOI C;  4HJA A;  2E8G A;  3KOJ A;  4P73 A;  4B3R Q;  3RLF A;  2UUC L;  4DV0 Q;  4DV4 L;  1LM0 A;  4DR3 Q;  2IX1 A;  1QZH A;  3ICE A;  1Y14 B;  4BBR H;  1VQA A;  1ASY A;  1BKB A;  3HOX H;  5M3F G;  1Q81 C;  4WJ4 A;  4GN4 B;  4DV3 L;  2K5V A;  4LF5 L;  2RHQ B;  1X6O A;  4JI3 Q;  1VQM A;  2UXC L;  5IP7 H;  3I4N H;  4IFD G;  4A3F H;  2WFW A;  1FGU A;  3PSI A;  3CPW A;  4P72 A;  2OCE A;  3PO2 H;  1PH2 A;  1VQH A;  2Y0S G;  3GTG H;  1N32 L;  4JI6 L;  2E5L Q;  4JBK A;  4A3I G;  1VQN A;  1XPU A;  4DK6 C;  1X3G A;  3F1Z A;  4AYB G;  1K73 C;  2ES2 A;  2VW9 A;  1E22 A;  2UUC Q;  1BBW A;  2WB1 E;  1W3S A;  2NVQ H;  2CQO A;  2PQA B;  2VQE L;  4GNX B;  2CWA A;  4A3K G;  1HNX L;  4C3J H;  4A93 G;  4DV3 Q;  4LF5 Q;  4JC0 A;  3W1B A;  4UP7 A;  1PV4 A;  2RHS B;  3S17 H;  4OON A;  2HIV A;  5LMN L;  3MXN B;  1PHJ A;  2R93 G;  1HNW Q;  3H15 A;  4BBS G;  1HZA A;  1N32 Q;  4GOP B;  1VQI A;  1JE5 A;  1KRT A;  1V9P A;  2YTV A;  2Z0S A;  3MEF A;  2K50 A;  3HFZ B;  1HZC A;  4JI5 L;  3S1Q H;  1KQS A;  4JI4 Q;  1PH3 A;  3CMA A;  1Q1B A;  1LTL A;  2HIX A;  3RLN A;  1WI5 A;  2JA5 H;  2VQE Q;  4HID A;  4NB3 A;  1H95 A;  4IFD J;  5IWA L;  3UDG A;  4R4T A;  2LSS A;  4X66 L;  1WCM H;  3L7Z C;  3I7F A;  1VQ4 A;  4A3C G;  4BXX G;  3GO5 A;  4KLK A;  5LMN Q;  2A19 A;  4A75 A;  4YCU A;  2Q2T A;  1TWF H;  4X64 Q;  4OWX B;  4RG1 A;  4JYA L;  2Z6K A;  2DUD A;  1NY4 A;  5C0X I;  3CCU A;  4RMF A;  2JK8 A;  1HNZ L;  2VZA A;  3STB D;  3BU2 A;  5BR8 Q;  1EYG A;  1WOC A;  1PVO A;  2D62 A;  1EQQ A;  1HR0 L;  4HJ9 A;  1OXS C;  4JI5 Q;  3RN2 A;  4BBR G;  1K8G A;  2K14 A;  2JJQ A;  4UY8 C;  2UXC Q;  1XMO Q;  3S2D H;  4JOI A;  3ER0 A;  5IWA Q;  5IP7 G;  3I4N G;  4LUV A;  4X66 Q;  3CCS A;  2JA7 H;  1KAW A;  4A3F G;  1QVG A;  1TWA H;  4L5Q A;  1PA6 A;  4LUZ A;  3F8T A;  1XMQ L;  4BY1 G;  1JJC B;  2OQK A;  1X56 A;  4JYA Q;  4DR5 Q;  3T1Y L;  1G29 1;  1YIJ A;  1HNZ Q;  4ME3 A;  1UWV A;  1Q46 A;  2YTY A;  3RLO A;  4AH6 A;  3ZJY C;  3S14 H;  4GLA C;  3FKI G;  1HR0 Q;  1D7Q A;  4DNI A;  1P8L A;  4A3G H;  3RZO H;  2WB1 G;  4XIG S;  3EBE A;  3CW2 C;  3U58 A;  1N33 L;  1KXL A;  2OWO A;  3JAM i;  1CUK A;  1MKH A;  4A3I H;  1N9W A;  4QJF A;  2AWN A;  4MTN A;  4DUZ L;  1VQB A;  2IT1 A;  4X6A H;  3CP0 A;  1NBW A;  5C4X H;  1YIT A;  2B63 G;  4A3M G;  1WYD A;  3T1Y Q;  4A3E G;  3GTK H;  4LFB Q;  2HHH L;  3HKS A;  5C44 H;  3W1G A;  2PMZ E;  4B3T L;  4IPG A;  4R1J A;  5EAY A;  4AQY L;  3S24 A;  3CF5 A;  3TS2 A;  2QEX A;  1QUQ A;  1L0W A;  4YCW A;  3H3V I;  2R93 H;  1M90 C;  1GO3 E;  4OXP A;  1WFQ A;  1N33 Q;  1I94 L;  3TRE A;  3J81 i;  3S16 H;  1FVI A;  3B6Y A;  3WWV A;  4DV5 L;  2N49 A;  3KF6 A;  3CCM A;  3OYY A;  2K75 A;  4QIW E;  3K81 C;  1KIX A;  1A63 A;  1EWI A;  4DUZ Q;  4DR3 L;  2KEN A;  3I2Z A;  5IYD G;  4YWL A;  1YBY A;  2EIF A;  4DV2 L;  3S2H H;  3DLL A;  4IO9 A;  3LGJ A;  4DR7 Q;  1IXR A;  3EN2 A;  2YU9 H;  2AHO B;  3D31 A;  2HHH Q;  5JJI A;  3CCL A;  2UXD L;  4OX9 L;  2ZJR A;  1PH9 A;  4B3T Q;  1IZ6 A;  5FLX c;  3RN5 A;  3AQQ A;  4QL5 A;  2VY3 A;  5LMN W;  1YZ6 A;  3DM3 A;  1ASZ A;  4ALP A;  1LUZ A;  1PH4 A;  1PFS A;  2CWP A;  4LF7 Q;  3G48 A;  2BH8 A;  2JA9 A;  4LFC L;  3CXC A;  1I94 Q;  2JA7 G;  4OO1 G;  1HZB A;  4DV5 Q;  5ELO A;  1Q12 A;  1IBM L;  5J3B A;  4FDB A;  1X3F A;  1PH6 A;  3CCR A;  2A1A A;  4IPC A;  4DV2 Q;  1K0R A;  3CAM A;  4LUO A;  4X62 L;  4MZ9 A;  1SN8 A;  2ASB A;  1Z9F A;  1S40 A;  3GTJ H;  2PNH A;  4DPG A;  3U50 C;  2Q2I A;  4GN3 B;  2OQ0 A;  1U0L A;  4DAY B;  1L1O B;  3KJO A;  3ULP A;  1VQP A;  5ELN A;  3J80 i;  4GNX C;  1XPO A;  4JI2 L;  4OX9 Q;  2ATW A;  2ZJQ A;  4A3G G;  4GKK L;  1HNW L;  1C9O A;  1CKN B;  4UPA A;  2ZJP A;  4LWC A;  3CCE A;  3S1M H;  2NZH A;  2GN5 A;  2NN6 I;  4HJ8 A;  4BY1 H;  4LFC Q;  1B70 B;  2C35 B;  2HT1 A;  4NPS A;  5M3M G;  3K8A A;  1IBM Q;  2CFM A;  4OWT B;  1CSP A;  4AIM A;  4BA1 I;  4R4C A;  4DR1 L;  4GOP C;  1HR0 W;  3FKI H;  5GAH C;  1VQ9 A;  4JI4 L;  1IBL L;  4A76 A;  2JEA I;  4K0K Q;  1E24 A;  4X62 Q;  4HIM A;  4L5S A;  3AFQ A;  3I4O A;  5C44 G;  1EOV A;  1E1T A;  2FXQ A;  4P71 A;  1K3R A;  4JI2 Q;  1FL0 A;  4GKK Q;  2AKW B;  4NXM L;  2LXK A;  4JBJ A;  4LW1 A;  4PZ7 A;  2F3I A;  1BVS A;  2I0Q A;  4Y52 H;  4X64 L;  1EFW A;  4JI0 Q;  4JI7 L;  4EQ5 A;  1W2B A;  2KCT A;  1V43 A;  1A62 A;  2N8N A;  5BR8 L;  1YHQ A;  2IX0 A;  4A3E H;  4A3M H;  1JJ2 A;  2B63 H;  1JJG A;  1VQF A;  2OTJ A;  1VQE A;  1HH2 P;  4DR1 Q;  2B29 A;  1PH7 A;  2MO1 A;  3PUZ A;  4A3L H;  1RIP A;  2XTI A;  1QVC A;  2IHF A;  1G51 A;  2HQL A;  3JC6 6;  1IBL Q;  1FJG Q;  3I4M G;  3IRB A;  3KDF A;  4PG3 A;  2XGT A;  1E7Z A;  4R4O A;  1XMO L;  2KHI A;  1SMX A;  4B3M L;  3EIV A;  4LF6 L;  4O2D A;  1VQJ A;  1MJE A;  4NXN L;  4DUY L;  1Z47 A;  3H0G G;  4NXM Q;  4GLV B;  4HIK A;  1LYL A;  2K52 A;  4IPD A;  2ZTE A;  5JEA G;  3L2P A;  1EQR A;  3STB C;  1I3Q H;  4LFA L;  2YV5 A;  1VCI A;  4LF9 Q;  1VS0 A;  5IE8 A;  1YJW A;  1SR3 A;  5JJK A;  4JI7 Q;  4DV6 L;  5IYD H;  4DR5 L;  1TWC H;  5M5W H;  4HJ7 A;  2UXB L;  3JAM c;  2B3G A;  1OXT A;  1N36 Q;  3UE1 A;  4JI8 Q;  1NJI C;  3E9H A;  2KCM A;  1NMF A;  2EXD A;  4H02 A;  5FLM H;  1Y1W G;  1VQ6 A;  3PGZ A;  3Q8D A;  4B3M Q;  3RNU A;  4LF6 Q;  4DV7 L;  1PH8 A;  4NXN Q;  4DUY Q;  4DKA C;  1I5F A;  3PF5 A;  4LFA Q;  3S1R H;  2NN6 G;  3J81 c;  4DV6 Q;  3KF6 B;  2UXB Q;  4LFB L;  2UUB L;  1X65 A;  3NEM A;  2BH2 A;  2PQA A;  4GNX A;  5IP9 G;  1NE3 A;  1WJJ A;  1KD1 C;  3L0O A;  4P75 A;  3HOW H;  2WP8 J;  3KYH C;  2PI2 E;  2AWO A;  4PZ8 A;  2RF4 A;  3K7U C;  2YTX A;  5AJ3 Q;  4IOA A;  1E1O A;  2V1C C;  5JEA J;  1Y1V G;  4DV7 Q;  4WJ3 M;  3FHW A;  2JQO A;  2H5X A;  5GAE C;  4GOP A;  4J15 A;  5M3M H;  3M7N A;  1I6H H;  1DGS A;  4JG2 A;  2KHJ A;  2RCN A;  4R4I A;  2D0O A;  2QA4 A;  3E0E A;  1CKM A;  4DR7 L;  2OTL A;  4PMW A;  3E9I A;  4QGU A;  4GLX A;  2UUB Q;  1YEZ A;  3PO3 G;  1VQO A;  3D0F A;  4OWW B;  4DR4 Q;  1G6P A;  4A3L G;  2I5L X;  3K0X A;  3K80 C;  1CSQ A;  1EIF A;  2MO0 A;  4UP9 A;  4POG A;  3NEL A;  2R92 G;  1GD7 A;  2K4K A;  3H3V H;  4LF7 L;  4YY3 L;  3U4V A;  2R7D A;  3CPF A;  3M4O H;  2UU9 L;  4DAM A;  5C3E H;  3OW2 A;  2MQH A;  5FJ8 G;  3J80 c;  4BY7 G;  4L5T A;  1SE8 A;  1GKH A;  2D0P A;  2IY5 B;  2CCZ A;  5GAD C;  3HOZ H;  2QGQ A;  2DGY A;  2F52 A;  2ID0 A;  3KF8 B;  1K8A C;  2K5N A;  5C0X G;  2JA6 H;  3I4M H;  4YWM A;  1C0A A;  3CD6 A;  3I55 A;  1B8A A;  1GM5 A;  2ZTC A;  4YWK A;  2A8V A;  3FP9 A;  5IYC G;  1X54 A;  1CKO A;  1N34 Q;  5HGQ A;  5FLM G;  3A5U A;  1EUJ A;  3H0G H;  5IY0 A;  1KC8 C;  4LF8 Q;  5JJL A;  4JV5 L;  1L1O C;  1VQ5 A;  1VQ7 A;  4B3S L;  1E3P A;  3ERS X;  4YY3 Q;  1PH5 A;  4A3J H;  3I56 A;  2I5H A;  2UU9 Q;  4KHP L;  1B7Y B;  1SLJ A;  1A0I A;  1JMC A;  1C7Y A;  1XNQ Q;  3BZC A;  3CC2 A;  4KI0 A;  4A3B H;  1OXU A;  3TEH B;  4GKJ Q;  3J7Z C;  2PI2 A;  3PV0 A;  4K0K L;  2F4V L;  3TQY A;  1MJC A;  4A4I A;  3K7A H;  1X55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...