1SN2A

Crystal structure of sea bream transthyretin at 1.90a resolution
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
118
structure length
118
Chain Sequence
CPLMVKILDAVKGTPAGSVALKVSQKTADGGWTQIATGVTDATGEIHNLITEQQFPAGVYRVEFDTKAYWTNQGSTPFHEVAEVVFDAHPEGHRHYTLALLLSPFSYTTTAVVSSVHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords transthyretin
publication title High resolution crystal structures of piscine transthyretin reveal different binding modes for triiodothyronine and thyroxine.
pubmed doi rcsb
source organism Sparus aurata
molecule tags Transport protein
total genus 25
structure length 118
sequence length 118
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 1sn2A00
1TTCA 1IE4A 2NOYA 1SOQA 4ABQA 1TTRA 4WNJA 2QGBA 3CN0A 3CXFA 4TM9A 5E4AA 1OO2A 3GPSA 3CFQA 1BM7A 2B15A 1DVUA 3DK2A 3CN4A 2H0FA 5DEJA 1DVSA 1BZEA 4IIZA 5FW6A 5A6IA 4PM1A 1DVYA 2FBRA 2ROXA 4Y9FA 4TNGA 1RLBA 1X7TA 1FHNA 4PMFA 4TKWA 5TTRA 4IKLA 4PWIA 4QXVA 1SOKA 3SSGA 1BZ8A 1E3FA 3IPBA 3DIDA 2H4EA 1GKOA 2H0EA 4PWJA 3IPEA 3ESNA 4MRBA 2B77A 3P3TA 1IIIA 3P3RA 1DVQA 4KY2A 4TQPA 3IMSA 4Y9GA 3DJRA 3B56A 3TCTA 5JIDA 2G3ZA 2F7IA 1ZD6A 4HIQA 2H0JA 3A4EA 4PVNA 1F41A 3GRBA 5JIMA 1IJNA 3NEXA 1TFPA 4PVMA 4IK6A 4YDMA 2TRYA 3CBRA 4I85A 4DERA 4D7BA 4QRFA 5IHHA 1F86A 3BT0A 2FLMA 3GS0A 3NEOA 4IKJA 5CLXA 4ANKA 2B9AA 5L4FA 5CM1A 4L1TA 2QPFA 1SN2A 3DO4A 1U21A 2IGLA 4PWEA 1DVZA 3GLZA 4TQIA 2G9KA 5EN3A 4IK7A 4PWFA 5CN3A 4FI8A 4ABWA 3D7PA 3Q1EA 1BMZA 1TYRA 4TLKA 4FI7A 4TQHA 1GKEA 4PWGA 5DWPA 5AKTA 3W3BA 4HJUA 4DEWA 2TRHA 3ESOA 2G2NA 1DVXA 1G1OA 2G2PA 1Y1DA 3DK0A 4IKKA 4PMEA 5K1JA 4I89A 4ABUA 5FW7A 4IKIA 4TNFA 3OZLA 1ETA1 3OZKA 1E5AA 2G4EA 4HJTA 3NEEA 3NG5A 4Y9BA 4DETA 3I9IA 1FH2A 3D2TA 4HISA 1QWHA 4QYAA 5BOJA 1KGIA 5CNHA 1X7SA 2F8IA 3GS7A 2H6UA 3A4FA 2PABA 5CLYA 5L4JA 5K1NA 4AC2A 1SN5A 2B16A 3IWVA 3U2JA 4N87A 3NESA 5EZPA 4N85A 4PWKA 3IMVA 4AC4A 1IIKA 2GPZA 1TTAA 3P3UA 4L1SA 2G4GA 1ETB1 3A4DA 5E4OA 3U2IA 2WQAA 4TL4A 4YDNA 4DEUA 5AYTA 1ZCRA 2G3XA 3BSZA 3FC8A 2QELA 3I9PA 4TLSA 3IMTA 2QGCA 4TLTA 1DVTA 2GABA 1Z7JA 2QGEA 3CFNA 3DGDA 4MASA 3CFMA 4Q14A 3FCBA 1TT6A 4WO0A 5AKSA 3GS4A 1SN0A 3DJZA 3HJ0A 3KGTA 3TFBA 5FO2A 2QGDA 1TLMA 5E23A 4Y9EA 3DJSA 3KGUA 3P3SA 3DJTA 3CFTA 4DESA 1E4HA 1TZ8A 4I87A 4N86A 5JIQA 4WNSA 3CN3A 4PVLA 5FW8A 5AL0A 1KGJA 3I9AA 3KGSA 5AKVA 5HJGA 4HJSA 1TSHA 4TLUA 3QVAA 1TTBA 4MRCA 2H1XA 1THAA 3ESPA 5L4MA 2G5UA 1BZDA 3IMRA 5L4IA 3IWUA 3GRGA 5AL8A 4TNEA 4TQ8A 4ACTA 5CLZA 1THCA 3IMUA 4ABVA 4TL5A 3CN2A 1QABA 5CR1A 4Y9CA 3IMWA 3CN1A 4PWHA 1ICTA 2ROYA 2B14A 3M1OA 4FI6A
chains in the Genus database with same CATH superfamily
2F61A 3WAJA 4ABQA 1NGYA 4OZHE 1LP9A 2ICEA 4ZQTA 2G3MA 1TZIB 3EBGA 4JFOA 4Z7NB 5C0CA 4HEMA 3M6DA 3QZBA 1W72A 4I3SH 2Y72A 3S3DB 3BVDB 1UUNA 4RMTA 5CZVL 4KXZI 3IDIA 5F1IA 3IDMA 4HX1B 3WS6A 4NHCL 4PRPE 5HJ3A 1KTKE 2F15A 1IM3B 4JVUA 2KZKA 3ETTA 1HI6B 2ZCHH 3LN5B 4RFNB 5GGSY 5I6KA 2QPDB 5KVFH 3T0DA 4LCWA 4EBQH 1U8CB 4WI4A 4A2FA 4R83A 5JR1L 4C54A 4XI5D 2VLRE 3GSRB 2R2HA 4M48H 2O26U 1TQWA 2Q86A 4MCZB 1N67A 4NBXB 4PY7B 2L7QA 5JDJA 4Y7OC 1PDKB 1NANH 3MNZB 2GIXA 4GKLA 2VDKL 2ZCZA 2ZZUT 3QRGH 5CJBA 3HTLX 3MLZH 4L05A 3JYBA 2LFEA 1ZJBA 3DARA 2AKRA 1C5CH 5IWLA 4AIEA 2PYED 4OD1H 3KJ4C 3V0IA 5KS9B 3U1SL 1ID5I 3C60B 4OZFA 4OGXL 3LZRA 3AU1B 4GW1B 4LHUG 3E9TA 2Y69B 1WBXB 1ONQA 4RMUA 1GZPA 4KHTH 3WIIH 4AQAB 1XR8B 3X14B 3AM8A 5I1HH 5GSVA 5IKCB 1Z3GL 2CBPA 4IIQC 2UWEA 1WHPA 4P2OA 3WIAA 2GG1A 1F58H 3J8F7 3LN4A 4TUOB 3WSQH 1NUFA 4NKQB 1BFOB 5D1QA 4AYMC 4FMVA 5GGRB 1WYJA 3ISRA 1GZQA 3KYAA 4ORGA 2V17L 2YXVA 4WNQA 5KYUA 1T21A 5T1MB 2P26A 4K07A 3D85B 2KPWA 4ZS6C 4FLQA 2A9NH 3BYTA 2DKMA 3TLRA 3EO1B 2JLPA 2DWSA 3EJYD 4XCNB 1TDQA 3WLWC 3Q6FB 4WWKA 3UZVA 4XCFL 4ZFOB 1KFAL 3B7UX 2X0UA 1TQCC 3K7UA 4NUPA 1Q72H 3T8XA 4O00A 2BIMA 3EJZD 1AAJA 3ULSB 1CFVL 2NY6B 3N1MC 1WA0X 5B7FA 1Q4NX 3AVEA 3DJZA 3FTVA 5DZOA 2QGDA 1A3LH 2R27A 2GJZB 4TPRL 2A99A 3GBLA 1YAZA 4Z7OB 3VWKC 1DUYB 3QIWC 4ISVB 2V5TA 2FZ3A 3N1PC 5DJDB 3HC4H 1AQKL 4GXVL 3D39A 4MA3B 2DYPA 4RCAA 2WSDA 1EO7A 3S96A 4N5EC 4K5MA 3E0GA 6FABL 1RP8A 3LEXA 2ATKA 3CVIH 4NPJA 2NUTA 1TTCA 1L5GA 2WM0A 5D9SB 4KKAD 2D0GA 1OQXA 2WTRB 4MDJA 1AGDA 2AJZB 4Z7VB 2XICA 3GBDA 3CC5B 2APBA 5DEJA 1FCCA 3VFTB 3K2KA 3VI4F 4AUUA 4D8PA 4WI8A 5KBMA 4YO0B 4TNGA 2DQFA 3U0PB 4XCYA 3KPSA 2O5YL 3GO1L 5LGHH 5I1LA 5BW7C 3H2WA 2EIDA 5A2KH 5I0YA 3L3OC 2PTUA 1CI3M 1GY1A 4N2LA 3HJEA 2QPSA 4I18A 2YMOA 4LEXH 2D4FA 3UTOA 1BF8A 4GAGL 1G6VK 3GTNA 3VFMA 5IF0A 3ATFA 2OYLA 3CVDA 1KTBA 4OFQA 3MGOA 1E5UI 3MR9A 4LVHC 2XBTA 3PS6A 4N20A 4W6YB 3MLYL 5T5FL 4Y2DC 2OQJA 5GHWL 2R0ZL 3VXPB 5E2WL 1HT6A 4PP2B 1GGCL 1RJCA 3QUMA 4EDXB 4G7RB 5EU7E 5FUZL 1CK0L 1NWOA 1RPQA 3JTTA 3DV4A 1OGAB 3P9MA 2B8OT 4G8EB 4PWGA 1S9YA 1U8IB 3D4CA 2YK1L 4XNXH 4PLOB 4JMNA 4U1GC 3LKSB 4ZMNA 3CLEH 1S7WA 5L4JA 4Y9BA 4HIJA 1B0GA 1PKQE 2WOYA 3FT1A 5EBMA 4P3DA 3NABH 4HEPG 2OMUB 4JQVA 1TQSA 5KJ4A 1BA9A 5HYJB 5HHNA 5B22A 2BMKA 5L2KE 2B2XH 2BC4A 3KS0J 2ZX7A 4MNQB 1MFVA 3ZE0B 1A6ZB 2D7TH 4MD5A 2GCYB 5B1BB 4AM0A 3CFEB 4KNUA 4XN4A 4OIIL 2AMGA 5J56B 4PJGB 4PJ8C 4A55A 1RURL 2F54D 2QFPA 1QSFE 2PUQT 3CDZA 4UDTA 3QRLA 2BSED 3C08H 4GUCA 2WQ8A 3AT8A 3TT1H 5JXEA 1NC2B 5A3IC 5LCVA 2FAUA 5K9QI 1CBVH 4FGMA 5T3XL 4ZFOL 5J06A 5C09E 4F8OA 1KXQE 3VWJD 2HJKB 4AH2B 1S7TB 3CSGA 4H0LC 1INEH 1NGZA 3NCBB 2YPLB 1AMXA 3ARGA 3CGTA 3V4LA 5HPMB 1PCSA 1BD2D 3ESPA 4M7JH 4NNXA 4QRRE 2GJPA 4NNPL 4GSUA 1U92A 1KCLA 4G1EB 1CXEA 2DLFH 3PL6A 2BWDA 2E27L 3C9NB 2ZCKH 2IH8A 5LNGA 4XXCA 4XN2A 1J1PH 4JFFD 1H8NA 3O8XD 4LSVL 2OJ1A 4X99B 3FSOA 5CJXC 1LP9B 2ICEB 4JFOB 2COQA 2DS4A 2PO6A 5C0CB 2Y23A 1KGWA 4OGZA 1DQVA 3MLUL 4G8IA 3IDIB 5F1IB 3IDMB 2IANE 4UIKH 3R19A 4GBXA 2ERJC 5EO1A 5HJ3B 1VEPA 3FK3A 2R2BA 3EYOA 4C59B 2QMJA 5EC2B 3MV8E 5D1XA 5A2FA 3FRUA 2R2HB 3WNIA 4K3EL 2Q86B 2VDOB 4GKSA 3BIKA 2FSDA 2Z31A 2ZYSA 4LLYA 4Y4KA 4HPYH 4CGUB 1OP9A 5F6IB 1X7QA 3OX8B 43CAA 1ZGLA 1OVZA 2FT6A 5I8CA 3OJ2C 2A83A 1B2YA 2WBJC 5D70H 4XNAA 1UM5H 1RZ7L 3OF6D 3QI9C 4G3YH 1GZPB 4PP1C 1QP1A 4AM0Q 3BAJA 2CGRH 3NJIA 2FWOA 4M93B 1KELH 1AQDA 3TV3H 4P2OB 3GZQA 1D7FA 3FCUB 4L4TE 4R6UA 1I1YA 1N64H 1E50A 3PIQA 3LN4B 3O9WD 5D1QB 1ZS8B 2F1EA 3TN0C 5D2LE 2ZP9A 1E30A 1GZQB 4LRNL 4WTXA 1IM3D 1XD1A 5FYJU 4H8VA 1XF2B 1LEIA 2ZYIA 4DKEL 2BFVH 1UJTA 4NQDE 2BSSA 2E0PA 3Q48A 2VERN 1DQDH 5IQ7L 1J0HA 2VLRA 3FTUA 1KCVL 4M5TA 3UZVB 3VXSD 4OCWH 2X1XR 2R2CA 1CGSL 1RPUA 5EU5A 2Q3ZA 4N1CA 1JTPA 4AGPA 4HCFA 1J5OH 3ATBA 4RDBA 5KJ7E 4LSPH 4A04A 4ZO6A 2IPTL 3C60D 5HD8D 2NRDA 3L54A 1BAFH 3DJTA 3P0YH 4WO4C 3UYRL 1GYWA 4FNRA 5HHXH 1GIGL 4UQEA 3V55A 3MRQA 2NNFA 1JWSA 5FA4A 1FYTD 4AYFA 3NH7L 2EICA 4XMLL 5AL8A 1FFPA 1IAMA 1XGZA 1ADQL 2DYPB 3TBBA 2EEDA 2W8CA 5E5MB 1EJOL 2VKWA 3S96B 1XMWA 1NEZG 2VB5A 5IQ9A 2W38A 3QCTH 2NUTB 1V7NH 3KYKL 4MD0A 5L6YH 1G1CA 5DRWA 3D85D 4CKVX 1AGDB 2CJUH 2QZQA 2KL6A 5JORA 1ESOA 4YHYC 5B38G 4U6TA 5ANHA 5I66B 4U1HB 4M6ML 2JB5H 2H47C 2QHLA 2DQFB 2H1LM 3KPSB 1H6EA 1X9LA 1GKOA 2YZ8A 4JANA 5I1LB 2IWEA 3FQ1A 5EA0H 1L6PA 2B77A 2MH4A 3GLDA 3EJTA 3RVVC 2VSKB 4JG9A 2HT2C 1KBBA 1UT1A 4I18B 4XTRC 4C4KO 2QQQA 1W72L 1O7VA 2UZIL 4IDLA 2K45A 1FO0H 4B53A 3TGXA 2X05A 2I85A 2P5EB 1SMAA 3BDYL 2I69A 2XI9A 1MCFA 3P30L 4PJEE 2P46B 1T4KB 3Q44A 3REVB 2YOCA 1JCVA 2XIBA 3GS0A 4GG8A 4BFEA 2VM3A 1IGYA 1XMEB 5HJDA 2VDOL 1PY4A 1MW0A 3LS5H 4IMKC 1SJMA 2PP8A 3ZDXB 2Z6FA 1A1NB 4GPVA 4P2QE 5AVSB 4PGZA 5T3ZH 2VZSA 2ZCLH 4L1HA 3BHBA 1F3DJ 3JTTB 3V0HA 1INQA 3AG3B 3DV4B 4UTBL 4J3OH 2BW5A 3P9MB 4MS6A 5AW0B 3WYRA 2ZNXA 1IFHL 1S9YB 2H45A 5D5ME 1IARB 3IGFA 2G2NA 4ZNEA 5IQOA 1G94A 3EYVA 4QY8A 2ZXWB 1EGJA 1ZHLA 2QHRH 3Q01A 1B0GB 5EBMB 5I6PA 3AWFA 4P3DB 5DS2A 4G6JH 5JO5A 4JB9L 3ABGA 5DJYA 4PJIF 1ODUA 4F15B 1SFDA 3KYMB 3MXVH 2BC4B 5I19L 4KKZA 4YXKH 1KCUL 1RIVH 2FJGA 4AM0B 2F9BT 4YFDB 1RZIA 4PJFE 1OEZW 2NYYC 32C2A 1KJVB 1Y1UA 3EH1A 3CDZB 4UDTB 3E8UL 3BVNA 5CINL 5INCA 4WTZG 3ETBJ 5AVXB 1HIMH 4H40A 1HL5A 1OB1B 3ZE1F 4OLYH 2IO5A 5C70A 1J5DA 4OLUH 3SPIA 5CZXD 4G6KH 1OSZA 3GUFA 1U58A 3X3FH 1ES0A 3E80A 4ZMAT 4QHUB 4RWYH 3PY9A 4NNXB 2DKUA 3DETD 1OTUD 1AACA 2N7BA 1VPOH 4M1DH 1U92B 2W65B 1YN7A 3CN1A 4RVBA 1DQKA 3O4LB 4FNUA 2BHZA 2WQRA 3BVUA 2YMTA 1PKQA 2VDMH 2YD0A 2H8PA 3K6FA 2R0KH 1ZV5A 1IGCL 1OGTB 2NY5H 4J23A 5LBSA 5A16A 2NZ9C 5L2KA 4MNQD 4WFGE 3FUNA 5D96B 2FCBA 2XX0A 3UBXB 4BDVA 1MRDL 2KH2B 3U6XA 5EH1A 4PRHE 4GBXB 3CZJA 3ETSA 4O2EB 1YG9A 3IPFA 2R2BB 2ZXQA 3EYOB 2G60L 1MCWW 2E7CA 4IQHA 1DFBL 1QSFA 5D1XB 1F4AA 4DFHA 2WNWA 2K4AA 3FRUB 4M3HA 1NC2D 1F13A 4G11A 4GKSB 4BHUI 3CZGA 4FFYH 3ISYA 3W9DA 2AEPH 4LLYB 4OFVA 3S6CA 43CAB 4GRWH 1F5WA 1AGFA 2BRRL 5C09A 2EE2A 2OKMA 1QZ1A 1B0WA 1KXQA 1SXSA 1ZGLB 3SJVA 4OZGB 2EZ0C 1NBQA 2A83B 1P6AB 2IXQA 2R2EA 1X5ZA 2HFGH 4Z95L 2WHVA 5C9KA 2FYYA 3ZKSD 2DLGA 5BRQA 4QRRA 2EEAA 5GS1A 1G87A 2NUPA 3MROA 5KJRH 3V4PH 5IESL 4MSWA 2N1TE 2BNQA 1AQDB 3HB3C 3QYCA 4JW3A 1G1OA 3FU5A 1BFSA 1XF1A 2YGVA 3U2IA 4LIQH 1R46A 4R8WL 2YRBA 5C0CD 1I1YB 3PIQB 3QUML 5T1JA 3MRRA 3NOIA 3GINA 2XA3A 1PS3A 2KKQA 2GC7C 5BOPA 4X6DF 3ZDYB 1TJIL 1WFIA 2B16A 2IANA 1LEIB 2HTKD 1A8ZA 2GB2A 3MC0A 2AITA 3EF7A 4PCSA 2XA8H 4XAWH 3TIEB 3MV8A 3N04A 3RPIB 3VE0A 2EO1A 4KQ4H 1MJ8L 2K3TA 2EUWA 4Z7UF 1OM3H 3O6FA 1S9VB 2K7QA 4X4YA 4KI5F 3GEWB 2WQUA 2XV0A 5EU5B 1TO5A 5F1KC 5HBBA 1CICB 3LHPH 5MI0B 3L7FB 1RUMH 1RQ5A 2RACA 1HOEA 3O2DA 5GGVH 4OZIF 4ZOBA 5TQ2L 3KW8A 4XPGH 3F85A 3NZHH 4F5CE 4UNUA 4J4PA 2H2PD 4LCUA 5F9JB 5GZNC 1BIHA 4APQA 3VTTA 4ICXA 3PE9A 5J6HB 4YNYA 1RP9A 5LAXA 5FA4B 3NCMA 2Z65C 1QG3A 3N85L 1A6VH 5D71L 4ZOAA 5LCVL 2JQMA 4RRPM 35C8L 1RZQA 1FFPB 3D4GA 3C6EA 3SDXA 3A24A 2R0LH 1XGUA 4G82A 4XC1H 2DWDA 4L4TA 4PJ7F 5IQ9B 2OW7A 4WHDA 5FKPA 1M2OA 1ZK5A 4LP4A 3A0OA 4MD0B 5D2LA 2XV6B 3MJ8A 5KVGE 3QQ4A 5JORB 3HZMB 1AHWC 3FU9A 2PR4H 3LNEA 3DBXA 5HI4D 1JI1A 1I9IL 1S7VA 4K5NA 4NQDA 4QRQB 4HKJA 4EDWL 1PVHA 1A9BA 3PAVA 4DK6A 1OT1A 5ADOL 1U8QA 3TIDA 2WNGA 5D6DA 5ES4B 3WTYA 3CHPA 3SYAA 3GUTA 4FQ1H 1G9NH 1WDAA 1KXVA 2MNUA 5CEYA 4ZTOL 1NCCH 5KVFE 1DSYA 5AW8B 4M1GH 4FFZA 5GS0H 1D5BA 1OD7A 1DYZA 1HCZA 3HMXA 1GHFL 5I5IA 2F18A 4BUGA 3TBSB 1NJ9A 4JUTA 4KUCD 1MCBA 4NI6A 4CJ1A 3AZUA 3MBEA 2Z91A 3FT0A 4LEOA 3G9AB 1FDLL 1S2EA 1WCBB 2WYTA 5A7EA 4HBCL 4X9FA 3SQOH 1INQB 1QMUA 3CXHJ 1Z5YD 2Q0ZX 3F7YB 4HS8L 4X4ME 1JZ4A 4OW6A 5EEVA 3FOLA 4HDIB 4X4XA 3NSXA 2HT4D 4HYTB 3WN5C 4QY8B 5BMFH 1KEGL 1A4CA 4FZEH 1ZHLB 5I1KL 1PX3A 4BE5A 2ZKXA 4K9EL 4HH9A 1V3MA 1UFUA 5JO5B 5MEOA 4M02A 4JPVH 4N87A 5DJYB 5AW3B 1C8PA 3EJPA 1C5DA 3WE1A 5KVEL 5E5LA 1N9PA 3NZ8A 3WXVH 4Y5YC 4N2CA 4YIQA 4KKRA 2FJGB 2OV0A 5JYMA 3GI9H 3DXAE 2PN5A 1RZIB 4HUXB 32C2B 2P5ED 4Q14A 4BUHA 2RIKA 1JNLL 1SN0A 2Z8WC 1KOAA 2AABH 5GQBA 2DB8A 3GBNL 1J12A 1HX0A 2J6EH 1RHFA 2D0FA 3FCGA 1E4HA 4QRPE 4DESA 3GIZL 1KN2H 1U6AH 4K2UL 3MACL 1OSZB 3PWNA 3V4VH 1Y6MR 1E27A 4ZO7A 1PU0A 1OE2A 1ES0B 2HKFL 1I31A 2F19H 4YWGL 4FXLA 4MCYA 3H6JA 5DQDH 2IDQA 4JY5H 1J18A 1FAIL 1R5VA 5AW6B 3MRLA 3ZR6A 2DQJL 2E46A 1Y07A 3P4NB 5LXGH 2H8PB 4HWNA 4MJHA 5A16B 2W94A 2WKGA 2FEJA 2VLMD 4FULA 4HD5A 1RULL 1SOKA 2OXGA 1U41A 1HINH 1NC4D 2HP4A 4YDKH 2OYKA 3WKQA 3QDHA 4OB5L 3DX1A 1UA7A 1S7SB 3QAZC 4PJFA 4LNRA 3BQUD 2A4CA 4Q58C 4J3SA 3QXVA 1BWMA 4QTFA 3IT8D 4A1RA 4ZMZA 5JQ6H 1AGFB 4BSWA 4W9GC 2E6JA 2ZJSH 4YE0A 1KF9B 3QEUA 3SJVB 2V2XA 3ASOB 3VXRA 2C9PA 4UMSA 1E5ZA 4OY9A 5EN3A 3LV3A 1XL4A 5DVMA 3QEHA 5GS1B 3MROB 2NUPB 3ML8A 4IIQB 4K8RL 5EHFA 3O4LD 4NKOA 1YPZF 3FBKA 2BNQB 4QRUA 1F00I 5HHME 3RFZC 3ULUL 4KKCC 1KYOJ 1I8MA 3NEEA 3MV11 4HWZA 1FIGL 3MRRB 2DJSA 3GMLA 4HF5L 3QXUA 1AO7B 4N2AA 4X9GA 4YAQA 2X87A 5A6MA 1OLLA 4ZSOA 2O61A 4J8RA 4XVUD 3KM2A 2WXNA 2F68X 1EK3A 1URZA 2KLTA 1CLOL 5I8KH 2O5ZL 3T08A 5DVNA 1EGJL 1KTJA 2IDSA 4YC2B 3H7BB 2PWFA 3RNQA 4IBLT 4DP2X 1CE6A 5ESQB 1JVOA 3VRJA 2GABA 4X4YB 4P9HL 1MAML 1P4LB 1QBLL 1H3UA 5D7JA 5E8DH 1OOAA 3GS4A 2WVVB 1I7TB 1MJUH 5AKRA 2C4FT 4CU6A 4TUKH 3SPGA 2F7QA 2JNZA 2Z93A 1HKFA 2I07A 3VWKB 4S0HA 3QIWB 1HZHL 1WGVA 3LXCA 1ZHKA 4LCUB 3ISWA 4LSTH 3KWXA 3D34A 1ZSHA 3TM6A 1G7JA 4HJJL 1NCTA 4OZFG 4Z3FA 5LAXB 4DP7X 15C8H 3PXLA 5ESVB 4WGVB 3BWUC 2WAHA 2P5PA 4NN7B 3ZL2A 4DWHA 5AG8A 3CDYA 1IQWL 1YEDA 4B96A 2BCMA 2QVTA 3SDXB 2ZX9A 2JF1A 2VABA 4XXWA 2DWDB 3OQ3B 5FKPB 5HDQH 3B1TA 5IVXF 3T3PF 4DQOH 4FXGA 2CHDA 3MJ8B 3OMZA 1MCHA 4LZKA 4QHKJ 3QQ4B 4OZ4A 4PPTA 1PG7L 4XWOD 3DBXB 2AXGA 1S7VB 2YGNA 2R7EA 4HKJB 1MXDA 2VLJE 4MKTA 4YBLB 4WW2A 2BCKB 2E4TA 1QFWM 2LU3A 4WI0B 5I30H 1QNIA 1A9BB 2R51A 3EF4A 2W60A 1U8QB 5LBSL 1QTSA 3GUTB 5LXVA 3ZQ9A 2VMJA 1CICD 3NIDB 5CEYB 4WWKC 3DIVA 4RFOH 1T7XA 4KK6D 4O5LL 2H1PL 4D7PA 1VZIA 4NQVA 2N56A 2W9EH 3GZKA 4FQHB 1P84K 3X1GA 2IDCA 1OAQH 5I9QC 1CGUA 1A4KA 3TYFB 2XKNB 4LEOB 2LLLA 1CLYH 4KC3B 3W37A 3NFPA 2BSDA 4N3TA 2C3HA 4Q2ZA 2Y5TA 4MNHA 5H2BB 4GXUN 5D4HA 5L8KB 3FUFA 2NY1D 3FOLB 3FO0L 2EKSA 1ETA1 3S97C 4NJAL 1X9RA 4ES9A 3HS0B 1FH2A 4JREC 5LO7A 1GJIA 3IJEA 1JDAA 4FN0A 2F8IA 3B3IA 4F20A 2PCXA 3CH1A 4WUKL 3BSZL 4HH9B 5EPMA 3LVEA 5MEOB 2GJ6E 2A0LD 1N0XH 1J10A 1EMTL 1QNZH 1C5DB 4WHYH 2ICWB 1G9MC 3HI5H 4ZTEA 3ET9F 3SKMA 1EO8H 3QO0A 3JWNH 5DQJA 1AR1D 3ZL1A 4K0OA 5ICUA 5I82A 4BH8A 3WTUA 3KHOA 1R0AH 3L3DB 4DQAA 5T1LA 3QDJA 4MZ3A 2CLVA 2XDHA 1INDL 1P0SE 5GRVL 4O9HH 3RGVC 1E9OB 3S8FB 5D4QA 1CU4H 2BO0A 4QD2E 1GOHA 1XH2A 4QKTA 1OSYA 3T3MB 3K72B 2ZUQC 4NM8H 2AV1A 4NO5A 3SQBB 3AADB 4UQDA 5AYQA 5DI8A 3EO0A 1E27B 2VW6A 3GRGA 5CFAA 3O2DL 5T5NG 5GJTL 3VB8A 4M03A 5L9DL 1ZSDA 4K7FB 5DVOA 4K7PY 3C2AH 4XHJC 4RGOH 3VG0H 2WWMD 2Y5QA 3N44F 1S7QA 2NOYA 2Z4QA 3O41A 1E6JH 3IRCA 1DBAL 5DJ8A 5DWUH 2EEBA 4RISL 4ZAKC 2VDNB 3HBZA 2VWEC 1M71A 1CVSC 3MV7E 4LDOB 4KMLB 3BN9C 4JQVC 3FB5A 3GJFH 5EMYA 2OXGB 3QNFA 2VSCA 2XVLA 3V0VB 2AZAA 5DUMH 3WELA 4DK3A 3IJ8A 2EYTA 4NWUL 2MWCA 4TVPH 3GRWH 4LSUL 1AH1A 3T0XA 1A3ZA 1XGQB 4N26A 5KG9B 4WI3A 5B7EA 1IT9L 3QWOB 2Y25A 4O58L 3DHMA 3ZO9A 5I26A 1HHHA 3VGFA 3ZL4L 5ITFA 2VXTH 3NCJH 4YGAB 2Q7YA 5IHWA 4BSWB 2X4OB 5CMAA 2D03L 1UWEL 2E7MA 5TQ0H 5F3HA 3VXRB 4NGHL 3TNMA 1BMWA 3O3BA 4FFZL 5E9DE 4HOWA 3GFUA 4HIEA 2FT8A 5EOCH 2A9AA 5GZOC 3HMXL 3QEHB 1TNNA 2Y1VA 2ZKHL 2GHWB 4NKOB 1J8RA 3ZQXA 3FPXA 4QRUB 4LHQB 4H1LA 1AI1H 5FW7A 4JR9L 4J6RH 4ZMQA 3NJNA 4UT7H 2FB4H 1UACH 2P80D 4OLWL 2GAZB 4HWZB 2ID5A 4XXCC 3LH2H 2FBJL 4YAQB 1D9KC 5FPIA 2CIKB 4M7LH 1Z66A 3KMDA 3W57A 4ZSOB 2MCG1 4J8RB 2O61B 4CL7A 1T2QH 3ARVA 4EIGB 1JDDA 1Q0XH 4GMTL 3HI6L 3GXMA 5FOJA 2G3XA 2VXQA 4NOBA 3WFDH 1NCBH 2Q8AH 3RNQB 3QGVA 4UT6H 3VRJB 5DK2B 3L3KA 5D7JB 1SUJA 3MKKA 4L0YA 2RAMA 2VW7A 4W93A 2DQGL 2IALA 2VERA 5DMGD 2OULB 1MCCA 2CDEB 3NJGA 2GBVA 3NTCH 5HHPA 4B50A 2FD6H 2Z93B 3KXFA 4XNQB 4Y4KC 3UACA 4YSUA 4X80H 1RZPA 5E6UB 2JB6A 4LHUD 3SY0A 3UIYA 4X6CF 1ZHKB 5KTEH 5B1JA 4MHHG 1G7JB 5C0JA 2C7UB 1NFIA 4JPWH 2BNQD 4BFRA 2PPDA 2F0CA 3T1WA 2Y3AA 5C0NC 4P5KA 1YEDB 2OP4H 2ZPKL 3I74A 4N2OA 2CM5A 4K9EC 3FT2A 3K5RA 4OJYA 1M6OA 5I17A 3WKYA 3B43A 4BFIB 2V5RA 1QR1A 5FX3A 2X4SA 2FJUB 3INOA 2QGBA 4ZS6D 1G5GA 1AO7D 3AABA 5C0BD 1WZLA 2OYMA 4FXGB 3B37A 4NUJA 3QJHA 3LQAH 4OZ4B 5A6IA 4B9ZA 3US1A 3QORC 2ROXA 3IDYB 4NKIH 3DOSB 1X7TA 3ERXA 3L3IA 4JBSA 4PWIA 4JRWA 2R7EB 1BVNP 4DVRL 1KUMA 5AALA 3MQIA 2O6PA 4XP4H 4KY2A 3WS3A 5L8LB 1GOFA 1MNUH 4Y2LA 3TCTA 1NGPH 3LAFA 2VDNL 3W9EA 4PBVC 2ZWZA 1P7KA 4UAOB 3JWOL 4YBHA 3A6OA 3OKLA 3VWKD 3QIWD 1CXLA 3AY4A 1A7RH 4NZTH 3WFZA 4NQVB 4ES8A 2VL5A 3OAWA 4ANKA 3ULVF 5GGSB 1EX0A 1HNYA 1SF3A 3FU3A 4TN9A 1DQJB 4JRXE 1TPXC 4GRWE 3V9FA 3ARUA 4N5ED 1P1VA 1TJHH 3PDOB 2B1HH 4JS7A 2XPGA 3NFPB 3OKDB 4FI8A 1XTLA 4OGYL 4Q2ZB 2Y5TB 3U83A 5IUSA 3O6KH 4OCYH 4HMCA 1IGML 1P5VA 3CMOL 4AK1A 5KVDH 1T7ZA 3LXAA 1YQVH 3CUPB 4X6FA 3IM1A 2WGNB 1UB6B 4TF4A 1WF5A 2RH0A 2FLBT 3B3IB 2EDYA 4N25A 4WUUD 3CH1B 3GZPA 5EPMB 4LIQE 1A4AA 4KKNA 5SWSE 3EYFA 2H41A 4RZKA 5EEUA 5H4ZA 3CXDL 1LEGA 2HG0A 5AVTB 1EHLL 1PX4A 1EPFA 1R17A 1ZLUH 3EFDL 1BIIA 3THMH 8PAZA 4KK5D 3SKMB 3OR6B 5DQJB 5C6TL 1B4JL 4PJHF 3VGHA 2QQLL 2WYHA 2ISDA 1UADC 4BH8B 4UINL 4Y2DD 4WFHD 1CXIA 5T1LB 4Y1AA 2W81C 2X0WA 1JGUL 1A64A 1TVBB 2CLVB 3CHRA 3MRIB 3PGDA 3QDJB 1A7OL 4RGMB 3SE3C 3M1CA 2R1YA 4LGPB 1UH2A 3IJYA 4TULH 4X6BB 4EZLA 1B90A 5E94A 4IBWA 1JHTA 3BUDA 2B39A 4K8RC 2AV1B 1TSHA 5CN1A 4Z3JA 1DQTA 3EO0B 3H2QA 1JE6A 3O6LL 4FD0A 3ZHFA 3OB0K 4AGLA 1MN4A 5D1ZI 1I9JH 4NZFA 5EBLA 5AD0A 5SWQA 4L3EA 1ZSDB 2IDFA 3WNMA 3E6FB 2NQCA 3CFUA 1HWGB 4FYQA 3ZTEA 4NI3A 2CALA 1DVFC 1S7QB 2Z4QB 3CSPA 4ZPVB 1X5LA 5EULV 2WZ6A 3GHBH 3WLBB 1PG7W 5HHOB 2YD3A 4MFHA 1OAYL 3N42B 3QWNA 5EU6A 1OQOA 2I5YL 4Y9FA 1OF2A 4G7VL 5CXPA 3GSQA 5FWQA 3IMBA 4IW4C 4UQAA 3FB5B 3QDGD 4IJTA 1OY3B 4MB4A 1NA8A 4FQXA 2AJUH 3IFPA 1T5XB 1KZYA 2EYTB 4ELKB 1KCSL 3I02B 1IC7L 2YD8A 2IAMC 5DK0A 4F7EA 4R26L 5I15L 1IJ9A 2DICA 3SDAA 3HBQA 3OBAA 5AOZA 4BH7A 5FYJL 1EXUA 2YN5A 4YSPA 4KUZH 4YXLH 5JIPA 3L4YA 5CMAB 1OLZA 3FQUA 2YPVH 3UTPD 5CLTA 4U05A 5F3HB 3TNMB 3LCYA 4HIEB 3E1F1 4R4BA 3QXWA 5CSZB 3HB3B 2ESVB 4FC3E 1GYCA 1BQSA 1JHKL 1QWUA 2B1AL 3MV9E 4H1LB 3SDYL 3FB8A 4YGVA 4HXAL 5B1KA 3K6IA 5IHUH 3S3JA 4FADA 2NX5D 1Z3RA 5ALBL 3QP3A 3LH8A 2DLTA 1FVDB 1U8JA 3SPJA 3S88L 1CGWA 3H9SA 2VZVA 5J11C 1BXAA 3L9EA 4KQ3H 7CGTA 1I3GL 1SM3L 4HJ1A 4I0PA 3IGAA 3D18B 2CBTA 1XHHA 3KDMA 4C56A 4GI6A 4IGBA 3PAYA 1DJWA 4UV7L 1T89C 2VTFA 3H55A 3L13A 4LASL 3FU0A 3MLRH 3A47A 2VR6A 5D2NA 4ZK8A 5F6HI 1GY2A 2YSSA 4JFDE 3L3KB 2ZWNA 1XIWA 4G71B 3FFCA 4X42A 2VRAA 4LFHD 1UT2A 2WBJD 3MA9H 5IEKB 4NO0A 1LVEA 2QLVB 3QI9D 1JGIA 1FO0A 3KXFB 5HHPB 3FQXA 4PB0L 4ZOEA 4PP1D 4WFED 2JB6B 4DGYH 1ZTMA 2RD0A 5E6IA 3SY0B 2DQTH 4U2ZA 2OTWA 5E9DA 3EJCA 2DQDL 2HT3C 3DLQR 5L4MA 5C0JB 3HFFA 1IRAY 3FHQA 2DLEA 4UOQA 2B3RA 1NGWA 2UXFA 4C55A 1NFIB 6CGTA 2F6AA 2YEZB 4J6IA 2OL3A 1JGDA 4P5KB 3B7YA 3F5WA 1ICTA 3QRGL 5I17B 1NCNA 1I7ZA 4PS4L 1Y18A 2X4SB 3LEVH 4QTHA 4Q8BA 1PZSA 4Q6YA 1ZLVH 3NIGE 5L0QC 4BGDA 4NUJB 2DMHA 5DO2D 1A4JB 3QJHB 3KVQA 5TE6H 5F21B 4PB9H 3RIFK 1SXNA 3CHSA 4Q9QH 5E2TH 3HG1A 1LE9A 4KHTL 3WIIL 3R8BB 3MUHL 3FYEB 2XZQL 2QV2A 5IB2A 1M9WA 2QSQA 1Z0MA 3B1UA 2P5WD 3QIBA 3WS3B 4HVBA 4R7NA 4ZS7H 1MIEH 4R2GC 3WSQL 4HWUA 3FFOA 3O6FC 5C08E 1FVEB 2JSFA 2F7PA 4S2SB 1WIPA 3GXPA 3OKLB 3D09A 5HDBB 2JCWA 1OAJA 2VL5B 1IZJA 2A9NL 2YPKA 1MFAL 4OGAC 3C6SA 3LIUA 1ZEAH 1FSKC 1RI8A 4ADGA 1M7DB 1ZMYA 4FYSA 1HL9A 4JFYA 1Q9LB 2D2CC 3TC9A 4TXVB 3LKPA 1Q72L 2W0KA 2GT9B 3I75A 2XPGB 3V2AR 1FNGA 2F8XC 3DX8A 2B7DT 5I73C 4J1UA 2XXCB 3WN5B 2CG9X 1NAMA 1L9PA 3JZYA 4BKLA 3N3EA 1CURA 2BVUA 1IM9A 3A5VA 4AZ8B 1SNRA 1S7RA 1W9XA 4X6FB 1HXKA 4K3JH 2A9DA 2ZNWA 5CCGE 3DX7A 4LAQH 1RUQL 1ANUA 4CVWA 1GYVA 3RVVD 3KBEA 2HT2D 4XTRD 2WLYA 4AQ1C 1LEGB 1T4WA 2WZ0A 5LBGA 2MQCA 2YQBA 4ONHA 4JK0D 1BIIB 1AP2A 2ZSWA 2J8UF 4N2MA 2ZWYA 4H5SB 2GUYA 1Z7JA 2HVKA 4NRZB 3QRFM 5D6DC 4E42A 1KLUB 2VQ4A 2HMID 2FLRT 2EDOA 2DIAA 4Y1AB 2BS9A 4TSCL 1M53A 3H3KA 3PGDB 2WXLA 2IGFL 5DURB 1S78D 1S5HA 3KWVA 3IJYB 5AZEL 1FNEA 2XN1A 2VCOA 3U7WH 3VDCA 1EVUA 1F6FB 1UM4L 2VXQL 4WI7A 5JOFB 5KAQG 2BX5A 3UC0H 4YSRA 1PZCA 5LGHL 1VF5C 3FNKA 4F80A 4TSBL 3MBEC 5CD5C 2CO7A 1PY9A 1CFNA 3VRIA 2BS71 4AKQA 3T1FB 5AD0B 5SWQB 1OTTD 3TBVB 4L3EB 3BPOC 1H5BC 2YBRA 4Q0XL 1R3KB 1BEYL 1EV2E 2K8QA 1DEDA 3KYNA 5KS9F 4IRSC 4P2RE 3D3VD 1BM7A 1KBKA 3BGMA 1O6SA 3EFOA 3MODL 2ZUTA 5SWSA 5B21A 5EU6B 5TPWH 4PMFA 1PJWA 1E9QB 1OF2B 3C75A 4UQ9A 1BQLL 1HZLA 3GSQB 3VXUE 5GRUL 5EUOF 4APXA 4DKFL 3N0PB 1QBMH 3IFPB 4U3XA 1G9HA 4XNXL 1TF4A 4WHTB 2X4RA 5T1LD 2BP0A 4WI9A 5D4IA 2ZYHA 4A67A 2JKSA 1K3IA 2XU9A 2EAEA 3CLEL 4PRIE 3TZVC 5DK0B 4F7EB 1ZV9A 5KSBE 3KPRB 1NCIA 2E6PA 1F56A 3TESA 3SDAB 4UM8A 2WCSA 1FNLA 5ADPH 1EXUB 2B2XL 1L9QA 1GJWA 1U8NA 3BAIA 4KY1H 3I6GA 3FQUB 3IETA 2D7TL 3S5YA 2G9KA 3KG5A 1B88A 4AV5A 4IK7A 3QJOA 1HJBC 4HUKB 1I1AA 3OMAB 4W9IC 4L3CA 4G8FA 4XVTH 1RPKA 3IEAA 4R4BB 1ZIAA 3C08L 3RFZB 1M6UA 2COVD 3O4OC 3QJTB 5HVHC 3WI9A 2NZ9D 1PG7X 2F5AH 4BK5C 4L4VD 1Q0EA 5IK3A 4JJ5A 2VN5A 1WAAF 3FUEA 5HHOD 4N2DA 4P04A 2FEEL 3FQTB 3FB8B 4YGVB 4NKMA 2H6UA 4Y19E 3ZZLA 3NVQA 1ED3A 3C5JB 2X6BA 2ZONA 4J3BA 4E41E 1U8JB 5BZWA 1KYDA 3H9SB 2IQAB 4HMDA 4UM9B 4AKOA 4M7JL 4X7DC 2UY7B 3QR0A 2X9YA 3IGAB 4I0PB 1MFUA 3EAKA 3MO1B 3EGXA 1DEEA 2DLFL 4C56B 3UADA 3F64A 4BWUA 4K5PA 2ZCKL 4IGBB 4KKLC 3QUGA 1J1PL 4JCMA 1ZPUA 5D2NB 5EZIH 3KGTA 3GK8L 3WUWA 4IMLB 1XIWB 3HE6A 3JWNE 2EZ0D 1HHGB 3FFCB 1HESA 2WZAA 4GG6F 1AGCB 5DD0L 2CKBH 2C1OB 5AW9B 2NY3C 4NO0B 2JCCF 4JKKA 2C1PA 4JHUA 3QS3A 4F57H 2AHIA 4XPTH 2WQXA 3HB3D 3EOBA 1XCQA 1ET5A 4RBPK 5BRZA 2ESVD 1UUSA 3KLAA 4XNUH 2RFXA 1NGWB 1GAFL 2XN9E 3S5ZA 3ZN6A 3TF4A 3KJ6H 1YJDH 2ADJA 4HPYL 4M1CC 1JGDB 3F5WB 4RAUA 3TBWA 2WLJA 1ZAGA 1SEBA 5EORH 4QTHB 3V95A 1Y18B 3ZE2F 5HPOA 3QIUB 4M3JA 4YZWA 5KSAA 3WU1A 2IIJA 3D33A 4EN3C 4QHLA 1GC1H 4OCNC 1ODAA 2DQMA 2F53A 5D70L 2HAZA 1Z9SA 4LO9A 3HG1B 1JGLL 1KNOA 1CPUA 4G3YL 5EOQH 1LE9B 3K6DA 2NT0A 3CHQA 1KELL 4AMKH 1WTGT 4CGTA 5JHMA 1K6QH 3N2JA 4X5XA 3TONA 3T2PA 1T20A 3QIBB 3EBAA 1IVLA 4JFDA 1N64L 1Q9WA 3EH5B 4V1DE 5GZND 1JYWA 5BS0A 4GO6B 4TVPE 4WEEA 3L3HB 2HFEA 2Q2EB 4IU2A 4K94H 1TZOA 4JPKH 3UPCA 3IVKA 3JV5A 1T6BX 2YPKB 4HWBH 2X2HA 5K39B 3C6SB 2MCMA 2D8KA 1BQHA 1QHPA 4R7LA 3OV6A 1DQDL 3Q3GA 2J6EA 3BKYL 2WQWA 3TJPA 4JFYB 1IILE 4AVIA 1OGPA 1NM4A 3LKPB 1EERB 2ZKWA 2IOOA 3V4VA 2JE8A 1FNGB 4DP5X 3DX8B 4ATTA 2XJLA 3I2CL 3OLGA 3VSQA 4J1UB 1BFTA 1YYMH 3CU7A 2FWLB 2EIZA 1D6VH 2PWDA 3GDBA 1J5OL 4MMXB 4BKLB 5I0WA 4LSPL 4WIQA 1IM9B 2A4ZA 3HNTL 4NBZB 5GPRA 4AGNA 1BAFL 1A6WH 2EECA 4XGZA 3DPDA 4EI5A 1B6DA 1DANT 3C5ZC 3WKML 5FGRA 3CLFH 2JQAA 1YECH 4HH8A 1NFDF 4P2YA 1QLFA 1UM6H 3P9LB 4B9GA 3NJJA 4BCZA 3WDHA 5F3BA 2YFOA 3EGSA 4D9RE 4ONHB 4JKPH 3G6JF 4QHPA 4Z7WE 1AP2B 4P5MB 2ZSWB 1L6ZA 4WGWB 3SZ6A 1CR9L 4N0UE 2GEEA 3NP3A 4WW2C 4TLTA 5B3SB 4PCKA 1V7NL 1WK0A 2HVKB 1J0ZA 4KK9D 3WBDA 1NH6A 1TYEB 5IBTL 4TQEL 5L6YL 4MKMA 4E42B 4UIMA 1YRKA 1XF3A 2HX9A 3PWPE 1KIQA 3HNVH 1YNLH 1EBPA 5JIQA 1MEXH 1S5HB 3T77A 2BERA 1PZUB 1FNEB 2JKIS 2JB5L 4PR5B 2HCZX 3DPBA 1FIEA 1TZGH 5AW4B 1DTUA 2PETA 1QWNA 1G7QA 1SEQH 3FMGH 4RNRB 1YEWA 3MJ7B 5EA0L 2E9IA 3FTGA 2IADB 1C1EH 2E47A 2CO7B 1CFNB 1WLHA 3VRIB 1FO0L 2Q9OA 1L0XA 2RHEA 4ESKA 2IOMA 3JQOB 4Z6AT 2YBRB 3JV4A 4MJ6A 1CJYA 3KYNB 3U7YL 12E8L 4I0KA 4DKTA 3BGMB 3EFOB 4XO8A 3CSBA 2OXHA 3BI9X 4H8PA 1EFXA 2NNCA 4JG5A 5SWSB 3N1GC 1ZJAA 2OL3L 3VI4A 2VDLH 2ZCLL 4CDGC 2AJYH 1E3FA 3UCRA 3TBCA 4XB7A 3PV6B 4P2AA 4APXB 4QXTA 1V3KA 1MRFL 5D7KE 4YSSA 2EEXA 5IQLA 2BP0B 3KD4A 1YNKL 3RBSA 1WTLA 2K9FB 4A6YH 4KXDA 2QHRL 4E9QA 5B4MD 3O6ML 1TEGA 1E7VA 4BGLA 4FS0A 2LFGA 1OW0C 1WP6A 1E8YA 4GS7B 3RWFB 3RWGA 5I18L 3VW3H 2Y7LA 3I6GB 3IETB 1RIVL 5DFVC 4XBGA 2ZOKA 3MCYA 2VM4A 1WFUA 1I1AB 5F89A 3HRZC 1JPFA 1WPCA 1E4WH 4G8FB 3BT2H 1I53A 3LX9A 5CS7A 2KDYA 5IJCC 2XQYG 1JP5A 2QSTA 1HIML 3KPPA 2E7DA 4P2RA 1E6OH 1NBCA 2JJTA 1SUHA 4KUCF 3F01A 4NKMB 5CLYA 2MEJB 5IEHB 1ED3B 1MCOH 1JAEA 2ITCA 2QVKA 1AQHA 4R7XA 1YY9C 5BZWB 3X3FL 4OSUH 3E6HB 5IB3A 1R24A 1NAML 3QG7H 4N8VA 4L5FH 2G4GA 4M8VA 3WFEL 3VU2A 3ARSA 4OVUA 3R7RA 1P7QA 1YNTB 4M1DL 5AYTA 3EGXB 3CX5K 2WXGA 1JOIA 4I9XA 1MI5D 2CRIA 1T83A 2QGEA 3KPRD 4NFCA 3K1KC 5FYLD 2VDML 5KSBA 4F58H 3HJ0A 1CF8H 4N90D 2AJXL 2RQEA 1CLCA 1U30A 5CGYC 4AJYV 5F70A 2GIMA 1NMAH 2JMRA 4KVNH 3MUZ1 2WUCH 3VH8A 4TSAH 5DYFA 1J0IA 5CJOL 4TTGA 2JH2A 1BVLA 2C1PB 1JFQH 5DZNA 4F7MA 4ENZA 2OW6A 1XCQB 5F93C 4K23L 5BRZB 3NCYP 3KLAB 5J7CC 2XTJC 5K1VA 3L7EA 5H37A 1NIEA 4C58B 1G4RA 2AEPL 2V8LA 1T03H 2ADJB 2B59B 3ARRA 4IOIB 1FNSH 2VDRB 3K4ZA 2E76C 4RAUB 3TBWB 4UQBA 4H1LG 4PG2A 2HX7A 3JYCA 2XPYA 2ZT9C 4NZRH 5ID1A 4QWWD 3DK2A 1S4IA 5A43C 4QHLB 4UM9D 1I7RB 1P6WA 1NOFA 4DCQB 5TDNA 3ILEA 2F53B 5HI5C 3QQDB 5LWYL 3SDDA 4GUQA 1KNOB 1LQBC 3FQNA 5ETUB 4KJQD 4PWJA 3V4PL 3VA6A 2A3TA 3Q06A 1FZJA 4AVHA 5I6MA 5IW3A 3APDA 5JA8B 1QFPA 2HLEB 5I24A 2Y06L 2Q3XA 4LIQL 4MNGA 5EF3A 1DO6A 4PRDA 4WI6A 1F41A 3L9RA 1IGFL 4Z76A 5FO8A 5BS0B 5D7SH 4KKQA 5KZCB 4NQCE 3IVKB 2J8OA 4KXBA 3WTWA 3FPYA 2GJRA 4A7VA 3UDWA 4OZIE 5F88A 4JFQA 3HZ3A 2JJSA 2XA8L 4Y5VA 5DUJA 4BFJA 3CXHK 1HEHC 3Q3GB 4JRYA 4KQ4L 4KZEH 5IB4B 1OM3L 5CU9A 3LB6C 2XN9A 2WZPA 3ZHNA 3IE9A 4AE1A 1KXHA 4LDCA 2P45B 3D12B 3QIUD 4XVSL 1RUML 5GGVL 2R83A 4X2UA 2OBGA 4QYAA 3NZHL 4BQ6A 4ZDHA 3UBFA 3GXFA 4XGZB 2J1KA 2W0FB 5IR1A 4XMXA 3RJQB 2BZCA 4NBYB 3VFRB 5H4YA 2OFQA 1QLFB 2XCMC 3ECBA 4FQJH 2VKXA 1D2OA 5F3BB 3EGSB 4Z0BH 3QUKB 4EMZA 2R0LL 1KGCD 1I85C 1ZVYA 3VMPA 4XC1L 3S36H 1C9SA 3RJOA 1K4CA 3T0EC 4DZBA 4UDUA 4I48B 5CP3H 2O5XH 2BOCA 3RUGE 1E5CA 4HC1H 3QUXA 3WHE0 2Z1PA 4BFBD 4MJ2A 1JZ7A 4FTVB 2OMVA 4XP9H 5E6YA 4AL8H 1HSAA 1XF3B 1KIQB 1ZT1A 4NC2B 3QNYA 5HSFA 2DWYA 3U36A 2ILLA 3HEIB 3EADA 1B0IA 3IXAA 3X17A 2AQTA 1G7QB 5DHXB 5DR5H 3IWUA 4NN6C 3H53A 4FQ1L 2B0SL 2EXYC 4TQ8A 3FTGB 2NY2B 5F8QC 5J3HC 4ZW8A 3FOMA 3GHEH 5DD1H 2ZYRA 4M1GL 1HCFX 2DYSB 5GS0L 3T4AC 3MLTA 1A7QH 5JIHA 3JV4B 4MJ6B 3BRDA 1R19A 2IC2A 2AK4E 2ZOLA 3CN0A 2L04A 4Q89A 3ELAT 4RMVA 4KKBC 4NQTA 2WLNA 4OH2A 4BFFA 1CT8A 1H15B 1DJIA 2BVQB 4ANXA 3COOA 5C3IA 2OXHB 1QRND 3PJSA 3QEQA 5I1CL 4NHCH 1UEYA 2KYIA 3MTRA 4JHZA 4R5XA 3VI4B 1PZBA 4Q4EA 4S1SH 2RR3A 3ESVF 2H4EA 3VXOA 4IOFC 1GTNA 3SQOL 5I6OA 4Z7WA 5AVVB 3TWYA 1CGTA 3M17B 4FL4C 4NQED 1IO4C 4QXTB 2AV7A 4DP8X 2EDKA 2DWEA 2UVEA 5JHLA 1Z5HA 5CEZL 5AYUL 1SF5A 1KGUA 1ZE3H 1CFBA 1U3HB 4PBDA 1N5AA 3PWPA 3DC0A 1DN0A 2C8NA 2BVEA 2OMYA 2XWEA 1IGTA 1SJVA 2PTTB 3PP3H 1JGVL 4YK4B 4UT6A 2O6EA 4O51A 2B9AA 4JPVL 5IHLB 2GHZA 1D5RA 2PW1A 3UTTA 4OGXH 3WXVL 4HK3N 5BUAA 2X70A 4R4ND 2ARJA 3DUHA 5CCHE 4ZX6A 3GMMB 2ZOKB 4MYPA 5FV2A 5HTSA 1VGKB 1PLCA 1XH0A 5EU4A 2GIYA 1FG9C 1KYOK 1JPFB 5I1IH 3SO3B 1F3DH 3OHXA 1LK2A 1IAIM 1UJ3A 3L1EA 5JPNA 1W80A 2AABL 4ZAKD 1XZ0A 5DD3L 3L5JA 2JKRM 2OM5A 3NSYA 5FYKD 2HN7A 3MHZA 1W6WA 2J6EL 2WC7A 4PTUA 1LMKA 3BN9D 1FZMA 1KN2L 2J73A 2V17H 1HL4A 1U6AL 2DQEL 2WNKA 4I2XE 5TK4A 3KLKA 3V4VL 3TO4A 2E74C 1U36A 3B2UD 5T1KD 3WHE1 3PAZA 5IB3B 4PJIA 1VIWA 2Z92B 3O45A 1R24B 4NPYA 1MCQA 1QBBA 4N8VB 1EAOA 4H0GA 1OPOA 4KFMA 4NJ9H 4R0LA 3S3SA 1Z9PA 5C0AD 5DQDL 4IRJA 1KFAH 3ZKXB 3ZT6A 5CUSH 2PWEA 4L1LA 1SYSA 1QLEH 1NUNB 4FQXC 5DMIL 5DFTA 2BOLA 2JKWA 4BBWA 5LXGL 2OR7A 4RZCA 1I1CA 1TEYA 3H3BC 4MA8L 5CZRA 3VH8B 3GJEA 4YBQD 1HJCA 3T0BA 1BVLB 4WSKA 1HINL 1K8IA 5FC9A 2AK1L 2MMXA 4UU9A 5FECA 5JNYB 1T3FB 4F7MB 3U6RA 3U46A 4FJZA 4RQQB 4AX3A 5EO0A 4LBEA 3SPVA 3ARFC 3ESUF 3L7EB 6FABH 4ZUWA 3DVGB 1AIZA 1Y7VA 3PREA 4G9DB 5D6CA 2FQEA 1L9MA 4FTDA 5TF1H 2OK0H 5DJCA 3IYLW 1JVLA 3N40P 2YAFA 3CNKA 3MGTA 5ID1B 1TITA 2NNXA 3H9ZA 3C6LC 3KLHC 5TDNB 4U1KA 1BGXL 3R1GL 4WKZA 5ECGA 3GO1H 3SDDB 3L4XA 3DIDA 4QHNB 5IMKA 3FQNB 2ARJQ 1KBWA 1E9PB 2DH2A 3MOQA 4N9GA 4YX2L 3FN3A 1FZJB 1Q9KA 1NCAH 1SRDA 1T5WA 4AYEC 2MTPA 1CGYA 4JM0A 4MNGB 4TTDC 1DQMH 3OMIB 1ZLSH 3TVMC 4OKVB 4Z76B 4AEHH 1GW6A 3MLYH 5T5FH 1EH9A 1T1WA 1UD3A 1YMMD 4PLJC 4JQIH 1QSEB 1FSKB 1TQVA 2J5LC 5GHWH 4GNKB 4JFQB 1HDMA 2X3BA 3LKNB 1DVZA 2Q2LA 3QPQD 4Y5VB 3TOPA 1CK0H 1NSNH 4JRYB 1ET8A 2BIQA 5E6IC 3GSWB 2DM7A 1PL3A 5C07A 5FIEA 4HWEH 1CTMA 3IAGC 4PGCB 1MJUL 1BYNA 1TR7A 1FF5A 2AJSH 3BZDA 4TUKL 3QORD 1JK8A 3MZGB 1I1FB 1DSFL 3B7TA 4J3OG 1GGBH 3KPMA 4J3OC 4LSTL 4PRPD 1MHEB 4UOZA 2DN7A 1MUJB 3IDGB 1AR2A 1OSPL 2NXYB 3RY6C 3D0AA 15C8L 4DUWA 4KHXL 3H3PL 4AXWA 4MAYA 3TBTA 4LCYA 1U8MA 1R47A 3S5LA 3BAXA 5J0BA 3EZJB 2FIKB 2PXYC 1A9EA 1OP5H 4Z7UA 5BS0D 1K4CB 3H0TA 4Q9BA 4UDUB 4JE4B 5I8EB 4UOW0 3TTYA 5HDQL 3OM3B 4ANWA 3QUXB 4FRWA 1I1RA 2OMVB 4NRYB 2X6VA 1NCDL 1HSAB 2XZAH 4NLAA 5MENB 2YR3A 4OZIA 4N86A 3QCUH 5FW8A 2FYVA 2X4PA 3U36B 5I0XA 3HE7C 1BEXA 1PNDA 2X6CA 3K8LA 3W5NA 2R8SL 3RVTC 4NNPH 4MZRA 2X9ZA 2NDGA 2X89A 4RFOL 3FOMB 3UTSE 1NKGA 3RVUC 2XZCH 4JFPA 4XZ4A 3MLTB 4GAJL 5K9OA 2HWZH 4JY4A 1CDJA 2ZKMX 4XE0A 2W07A 3L4ZA 6PAZA 1CT8B 4PRNA 4WSJA 2YXFA 3QEQB 2D0HA 1HS6A 4TKWA 2ZSVA 4WK4B 4YSDA 4Y16A 5D8JH 3HI1A 4AMWA 1TCMA 1OGSA 4I13B 2H9GB 2G75A 2NY5C 1DZ0A 3B3BA 1TMCB 4Y9GA 4YFLI 4K3EH 2BJML 3B56A 1VADA 1CCZA 2D3JA 4FTVD 2DWEB 1UVQB 4B9KC 4L2LA 2FX8H 2DL9A 2XHNA 3ZIYA 1N5AB 2R39A 1IGTB 3ATEA 1AKPA 3FCSA 4O51B 1HYRC 3MRKA 3OGCA 1QNZL 1AOHA 4E36A 3BPCA 2PW1B 5ICXA 3UTTB 2LHAA 3HI5L 5DJZA 1RZ7H 3W39A 2X70B 3KPLA 1LM8V 4GW4A 2ARJB 5JOEA 3AROA 3O4OB 4JDVA 5HVHB 2F5BH 2RALA 3MYJA 3POHA 2VO8A 4FXTA 5EU4B 3ZKMC 4CMMA 2VR3A 3DX9B 3PPEA 5D72L 4I89A 1LK2B 1UJ3B 4RMQA 4O9HL 4WTWA 3HLAA 4U2YA 5JPNB 5JW5A 1XZ0B 1CU4L 3FRPB 2HN7B 3IFOA 4PTUB 2FSEA 4KDTC 4JNXA 4F91B 2PABA 1ZS2A 3QUZB 1SN5A 2JK5A 4LOEA 1WICA 2XN0A 1CFTB 5BZDA 4LLAA 4QXUH 3V7MA 2K6YA 3GC3A 4UOW1 3TO4B 3IN0A 1AG0A 3RI5K 4PJIB 3O45B 4NPYB 5DCCA 3SE4C 3RVXC 3B6SA 2DIBA 2IAMD 5IQ7H 4FXKB 2JIXA 1HH6A 2CBMA 3C2AL 1ILUA 1T66C 2CUHA 3QUYC 3VG0L 1U3HD 3HUJF 3KPOA 1SYSB 2X4UA 4JKLA 3T04D 2HLFC 1E6JL 1ZK9A 2GK0A 3ECUA 3V5DA 5E1GA 5F0PB 2QDWA 3P40A 5HVFB 1CO1A 3F6LA 3JV0A 5DWUL 4GRLC 2IPTH 4LEBA 3MMEA 4JJHA 1CS6A 3UYRH 3RZCA 1IKNA 1T0MB 4KROC 3ZE1B 3GJEB 1GIGH 1U93B 1MLBA 4UT9A 3UCQA 1K8IB 4NZDA 4UU9B 4ENEC 5FECB 1ZHBA 3FYIB 3HKZA 5I71C 1KPVA 4AGMA 3U46B 3GRWL 1ADQH 2FDBP 3G6AA 2WLMA 3HC3L 5EO0B 4LBEB 1EJOH 5DRXA 2XLLA 1D7CA 3AMLA 2HFTA 3FBQA 5D6CB 4AJ0A 1Q9OA 2VXTL 4JFXA 3NCJL 5DJCB 1EHKB 4YHPB 1G6RA 1RD6A 2R29A 2NXZC 3EXJA 5D7EA 4CC4A 4E9VA 5I6XB 1AKJA 1PIFA 2V2WA 3O0RL 3CDCA 3V9EA 2FJFA 1H0DA 5TQ0L 4QRBA 1G9EA 2PNDA 1MQKL 3CQPA 3WDJA 1HILB 3GB7A 4P46A 2IOIA 2CLRA 3AUWB 3HKFA 4R4FL 5JW4R 3GHPA 5H35B 4TS6A 2ICES 4KGLA 3Q2CA 4ONOA 5IOPA 2AEOA 4WDIB 4WLCA 1KTLA 4N9GB 3KVPA 2UZIH 1AI1L 1BVOA 1TYJA 4J6RL 1T5WB 4PTTA 3VD9A 2FB4L 1UACL 3BDYH 3RIFF 4HULB 1M3IA 4HGWA 4WTQA 3WUWG 2VMFA 1A1OA 1N8OE 3EZ8A 3FUKA 4M7LL 3T2NL 3CIAA 1G9NC 3HE6C 4BE6A 1DJYA 2VDOH 3FQRA 4ODUA 2ZUVA 4JKMA 5JHLL 2XXMB 2ETWA 3HZVB 1T2QL 4P99A 3RVWC 5BCAA 5GS0C 1Q0XL 3RWHA 1F3JB 5HGDA 4V2CB 1IC5L 1NCBL 5C07B 5GGTH 5DWPA 3BAEL 5EIQA 4UT6L 2A6KA 1KV7A 1AHMA 3IJHA 3RWCA 1CFSA 3VQMA 2DBLH 4JHVA 1KG0A 4GW5B 4X98B 5IB1A 3DRQA 1JPTH 2QJDA 1JK8B 1I8LC 3AREC 5E2VL 3MRFA 2V9TA 1WBZB 2X1PA 1HK6A 4XH2B 1BF2A 2AQRA 3NUKA 3OC5A 3KPMB 3KPTA 3SDDD 3U2JA 5KTEL 4ZRGA 5IHZB 5KSAC 1IX2A 3IXTB 4X6DB 3D2UA 5I19H 3MUGB 1KCUH 4MAYB 1BECA 3S5LB 2ADFL 2EIEA 3EBIA 3EBHA 4POZD 1AD0A 3RX5A 1A9EB 5J12C 5CINH 1ZTXH 3LKRB 4Z7UB 4L5FE 3ZGHA 4KGJA 3H0TB 4W9LC 4RMRA 4X5LA 2MQ0A 1LMIA 3KCWA 3GXUB 5FO2A 2Y7SA 3D0VA 5CZKA 1QSED 3BH8B 3LQAL 5IIEA 5JHAA 5AB2A 4NKIL 4IYKA 4FKEA 4OZIB 1KGJA 1X5JA 4KXCA 1OP3K 1VESA 4B9CA 2CK0L 4H8WL 1WV7T 3F04A 1BQHG 3LS4L 2VAJA 4XP4L 1PLGL 1NGPL 4ZZFA 2IMMA 5JHDA 1SYVA 4ZFQA 3LY6A 3ZRCC 4ZMTA 4JFPB 4TV3A 5K9OB 1A6AA 4JY4B 4PJ7B 1QUNA 2BS8A 2AANA 3DA0A 1VZGA 2WTPA 5E4EC 3WGVB 4M61B 1Y6NR 4PRNB 2EYSB 2FBRA 1FHNA 3KAAA 4ZTPL 4EI5C 1HHIA 1TJHL 3NA9L 2J7LA 4GQQA 3QJXA 3HI1B 5I75C 1CYXA 5IY5B 3EXLA 3KL5A 2OCCB 2G60H 1QFUH 4MDIA 1O6TA 2DDQL 1HEJC 2FQGA 1IBYA 2G75B 1S5IL 3CZLA 3O6KL 4AENA 1KJ2B 4OV5A 3HC0A 1VADB 1MW2A 2HRGA 2VSMB 5MEND 1YQVL 3VFOA 4G8GE 3SGDI 4M7KL 3HFMH 4E2OA 3OAZK 3SKOB 1YYLL 5HYIA 4LLMA 3FCSB 1IMHC 1QSZA 3EUDA 5F7MC 4F9LA 4GUOA 3WEOA 1ASQA 2E9WA 4MQ7B 4KNTA 4AV0A 1IZKA 3MRKB 4QOKB 5CD5D 5C7ZA 5HJBA 5BPPA 1MREL 3BPCB 2L0DA 3DV6B 3O0LA 4MA7L 2CKBA 5ICXB 5K59F 4OCSL 5DJZB 2CIIA 3HRZB 4F37K 3KPLB 2GITA 2LV4A 3UBHA 5DC4B 4Y4FC 4ZUVA 3B2VH 4IRSD 4TRPH 5IESH 1JZ5A 3UTSA 2KERA 4JDVB 3E2HC 4N6RB 1F02I 3BGFB 3MYJB 4ATWA 4CMMB 1ND0B 4BD4A 4LB8A 2WSPA 2P24A 1YC7A 4R8WH 3HLAB 4N0FA 3BPNB 4NZ8A 4TULL 1M9SA 4BWWA 1HXYA 3ARDA 3QEQD 3IFOB 3ATDA 3SOBH 1TJIH 1O9WA 1NWPA 4KX7A 5JPMC 2ZAGA 3IBOA 3ZVVA 2DI7A 1XR9A 1OWRM 2EVIA 1IIKA 5GRVK 1HHKB 2UZXA 4FX5A 1I9JL 1S7UA 4E5XA 1A7NH 2JIXB 5JQIB 1MJ8H 3ZX1A 1HH6B 1SY6A 2VGLM 4CILA 4BYHA 1KJMB 4L29A 3Q0HA 3K2MC 2EDBA 2X4UB 2ZWSA 4X4KA 1USZA 4KWUA 1S46A 1D5ZA 2GK0B 1Q1PA 2NZ1A 3HHRB 4J3UA 3V5DB 4C4BA 4LEEA 1FRGH 5TQ2H 4MWFA 3G7TA 1EXHA 2WXJA 2XYBA 4RFEA 4AYSA 4R97B 5TH2A 2VAAA 4OCXL 4P2QD 4HUWB 2D31A 1T2XA 1MLBB 1U3ZA 2GFBA 3MLVH 2PF6A 4W4OC 3G5ZA 4K3DH 2AJUL 5D71H 2QPEB 3N85H 1KPVB 4ZXBC 1QA9A 35C8H 4HWBA 1T7YA 3FL7A 4N8PA 3G6AB 2E7LA 3RE0A 1MHHA 2I9TA 3CXFA 2PWHA 1HCVA 4HIXH 1Q9OB 1Z9NA 4NKDA 4KV5E 3IS1X 3QUZD 1G6RB 5AVYB 3SD5A 4Q9CA 3VGGA 1AKJB 3NSFA 2YPVL 2V9RA 2JJTC 5DZ9A 1H0DB 1JHLH 3U30C 1MOEA 3EOAB 2QKIA 2EIMB 4OCRH 3VFNA 4XN8A 4P46B 4JFZL 3UPRA 2G2RA 3MLXL 1F4HA 1IIIA 3P3RA 2I24N 3L45A 3MRMA 5EOTA 3V0WL 1KTLB 3QFJB 3L48A 4ICWA 4F8TA 2FEDC 1NDGB 1U8OA 2NY3D 4PGJA 3DNKA 1AIFA 2E59A 4PTTB 5TE7H 3EH3B 3CFKA 3FCTA 5E0FA 1I4FA 2EE9A 1GHFH 1T83C 1NAKL 1F86A 3P2BA 3IAPA 4FFTA 1KGXA 4BIKA 3DO4A 4P48A 5DHYA 3VH8G 3FQRB 1JZGA 1O0VA 4NT6A 1FDLH 4ODUB 5JDSA 4RGNE 3NCYS 5D7IF 1KCWA 4DFIA 1M1XA 3RWHB 5HGDB 4OJFL 4F93B 5M7QA 3D87B 4RDQG 1AVAA 5CHNA 2WCGA 4XPFL 2WD0A 5F7WC 3UEZA 5CJ8A 1L3WA 5AAWC 2A6KB 3DK0A 5K1JA 4EN3D 3CTTA 1YPZB 3CSYA 1CFSB 4CNIA 2DEYX 3UJTH 1KG0B 1KV3A 2FHBA 3VG9B 3MA9L 1UZ8B 3ZMNA 5IB1B 4Z7IA 4BQ9A 3MRFB 4FNTA 4WFGD 4DGYL 1HSBB 2DQTL 4HD9A 1XGPA 4PRHD 4EIZC 4F9PC 5KVEH 4DP1X 4AKPA 1MQ8A 3D2UB 4HS3A 4WFFD 4PY8I 5DVKA 1BXVA 1MVUA 5IBLC 2BNUB 4W9EC 1BD2E 2X4QA 4HCRH 4OFYD 4B7IA 1BP3B 1AD0B 1VFBA 2VXVL 5KOVC 1MCKA 3LEVL 3W82A 4P3CL 4WHYG 5F72S 4JZJA 3LZLA 4E9LA 3MA7B 3BKCL 3N9GH 4Y9EA 3CMGA 3JWNG 3D0VB 3EHBB 3GBNH 3P3SA 4Y1TA 4KOCA 4F7PA 5GSRA 2X53A 3GIVA 3JWNC 5TE6L 4FFWC 3GIZH 5H94B 3ZZ1A 2NY4C 2X6UA 3OPUA 5BRPA 3ETBF 2AC0A 4WY7L 4X6CA 1VEOA 3UDWC 4NX0A 4PJ9C 2JJSC 2VJ0A 5CCKL 1JWMA 2QVIA 3T4AB 5JHDB 4XB3A 3IB4A 4PJBF 1SYVB 4JQXA 1FAIH 4WRLA 1BX2B 5E2UH 3C5ZD 1WS7A 4UT9L 3U2SA 2FX9L 2EIBA 5DMKA 2EDHA 1QTYT 1IEHA 3NIFF 1BV8A 4OM0L 4OJAA 1QUNB 5C0RL 1RUAH 5IVXB 4HALA 3T3PB 5E9AA 1NIBA 4UYPA 1JDCA 1G0YR 2ITDA 3P9WB 5EOCJ 4PLNC 1HKLL 3WJLA 1U3NA 3DOIA 3CX2A 5LHDA 5FUCE 2WOBA 1HHIB 5TDOB 4ZMWA 3DVFA 3SDCA 4OB5H 3TA3A 3OMNB 4UUJA 4PV1C 4MDIB 4P8QA 2R29L 5E5UB 2K70A 2VT0A 5F7DA 1HXMB 2FE0A 4UWQB 5IT2H 4OV5B 3IU3A 1ZD6A 3RWJA 2EDFA 2NY0B 2HVJA 1NCGA 5I1EL 1T7VA 4LOUC 2VJ8A 4ANUA 3MJ9A 1R33A 5D93B 4NDMA 3LIZH 2EIJB 4G1MA 1XXDC 4NHUB 1IC0A 4LLMB 5FHBL 2IG2H 1F1AA 4PWEA 3T5WA 2ARWA 3LZNA 1LNUB 4BXVA 3EUUA 3MRPA 2CIIB 4YDIH 5CD3B 1R1CA 2X89D 2H3NA 1J8SA 2GITB 3PWLA 3Q1EA 2G5RA 5I2IA 4YDLB 2H32B 4F24A 2M83A 3BCDA 3SHSA 5ANMB 1BREA 4PMEA 1LGVA 4R84A 4B6ZA 1WUZA 1WQVT 3H2PA 3ULUH 1HU8A 4BFNA 2OMNA 2P24B 2Y22A 4N0FB 5ICZA 1BWWA 1RIHH 1FIGH 1ZDSA 3ARDB 3U7WL 1SDDB 5KS9E 2WZ5A 5K1NA 2PYEA 2JI2A 3QZWB 4L8SA 4IJ3B 2LW3A 1Z2KA 3IMVA 2Y0SA 2WXIA 1XR9B 1CLOH 2O5ZH 3FU6A 4U6XB 4XBPA 4WGKA 1EGJH 5B39A 2X40A 1BZ9A 4E5XB 1AD9A 4U1IA 2WO4A 3F7RA 4OT1H 5B1AB 5IBUG 4P9HH 1MAMH 3MN8A 1QBLH 4PJHA 1QFHA 4HLJA 5C2UB 3FULA 2Y7OA 2IPKA 2V8MA 2BY3A 1D5ZB 2FJSA 1M4KA 1G7MB 4QOKD 4MWFB 5DFVD 3CFBA 4YPGB 4D94A 4WCYL 1QI3A 1HZHH 4QO1A 3NAAL 5TH2B 2VAAB 4WJ5A 3S34L 2D31B 2GFBB 3Q5YA 4XNZC 3GBEA 3TS8A 4GB9A 1QBML 1ZA3A 3G5ZB 1JZ3A 4ZW7A 3DI3B 3IK2A 2C9VA 1JVKA 2ZUUA 1QA9B 1IQWH 1BF5A 3SPHA 1OP3H 3RURA 1N0LA 4B9IA 4XT1C 4AC4A 2XACC 5CILL 1M7XA 5D1ZC 2XWTA 5IJBC 4YXHH 2Q5BA 3WE6A 2I9TB 4WU5B 3WJMB 2LVEA 4NC0B 5ADPL 2B15A 5DDHB 3WMQA 5ILTH 1N6QL 3N44B 2GTWB 3VFVA 1UKQA 1L6XA 4Z7OE 1I3RA 1AGEA 4KY1L 1CFQA 2EXWD 1PG7H 3LZQA 1RL1A 5TTRA 1KB9J 4ODVL 3NRQA 2QKIB 1X4YA 4YVNA 5DS8A 4XVTL 2YD2A 5EF2A 5BVPL 3UPRB 3DXAD 2G2RB 3BZ5A 2HG5A 3SCMB 4PJAF 3MRMB 3VFPA 5EOTB 4D8OA 2F5AL 3LQAC 5E8PA 1DQQA 3QG6A 3QZNA 4R0LC 3D1MC 4OFKA 4O5LH 1AIFB 3U6XS 3CFKB 3FCTB 3FQ4A 2F2HA 4LL4A 4D7BA 4Z7VE 2H1PH 4QRPD 3OKMA 2EDQA 1FZKB 5L4FA 4HC1A 2IWGA 3LSOB 3O3EB 5DHYB 2CO6A 2CNYA 1KENL 2XTJD 4HPOH 4X8JB 2AMUA 2QEJA 1S9KC 1KYUA 3G04A 5E4IA 2YA2A 3TNNA 5DUBA 1JPST 2MQ3A 3PPSA 3VFSB 3BGAA 4X5RA 4CSPA 2ODIA 3EG9A 5EZIL 1HOCA 3QC5X 4B0MM 3CSYB 4NJAH 1NL0H 4CNIB 2CPCA 1CDIA 1I8IA 2CKBL 2CUAA 5EG6C 1RXLA 3BESR 5C0FB 3PUUA 5J13C 3A4FA 4PJDF 4OM1H 2K0RA 3ZE2E 4F57L 1HQ4A 3KWWA 4XPTL 3F65A 3WL9A 2RBLA 1DO5A 2NW3A 1U9KA 4N0YL 1OGAE 4HS3B 3QFJD 2V3DA 3EH2A 1MVUB 4CADA 4KX8A 1EDYA 3ZOAA 3KJ6L 4K7PX 2X4QB 3RP1A 3KE0A 3IMTA 3CFNA 1F0LA 1VFBB 4HJGA 1VLXA 2AP2A 1SJEA 5IV2A 3V6OA 4JZJB 1RUPH 3RWDA 3VU1A 3AXHA 3MU3A 2Q6WA 1GC1L 4F7PB 3P4LA 3CFCL 3GIVB 3P77B 4A2GA 3C5SA 4UQ2B 5EOQL 4MNQE 4L37A 3ZE0E 1K2DA 1NCWH 3RDTA 1S7XB 1BVKA 1ASPA 1V5JA 3AT0A 4X6CB 5HYSB 5MHSE 3UTZA 3I6SA 4PJGE 5CN2A 3EYSL 5GJTH 5EEXA 3MDJA 5L9DH 4KTDL 1J5HA 2F54A 3M1OA 5ELIA 4KTEL 2XQYK 3BP4A 2BSEA 3FXIC 3DSNA 2EABA 1B9KA 4NN5C 4ODWA 3U2SB 2YMXH 4K94L 4I8DA 1PF3A 2X88A 4JPKL 1DBAH 5DMKB 2DLHA 3BP6A 3HCVA 4OF8A 4ODTL 2G0LA 4XZUA 4RISH 4HWBL 1CXFA 1MFEL 3P4OA 3BO8A 3VWJA 4IKLA 1BYPA 2Y2TA 1BZ8A 3CLWA 3B9EA 3B8YA 5IP4A 4W9DC 3T0ED 4MRBA 1NFDE 3SDCB 4OI7A 3TA3B 1BD2A 5AB1A 2DM2A 1MZYA 4UUJB 4NWUH 4F7CA 4LSUH 3QZOA 3P11H 4GSDL 1JS4A 3IU3B 3RWJB 1UGKA 3D48R 3EHBD 1IT9H 4NAQA 4JFFA 4O58H 5HHQA 1A6WL 1OPGH 3O8XA 5DJXA 1YEGH 4DEPC 5C0CE 4NDMB 4NXKA 3QFGA 2WXKA 1OANA 3CLFL 4BINA 1YECL 2QPFA 5KSVB 2DF3A 3FT4A 1UWEH 5B1CA 1ITCA 1LO4H 4HOXA 3S2AA 2W0LA 4XVJL 2IH3B 5JW4Q 2A9CA 4YSQA 4JKPL 2YOAA 1U8HB 3MRPB 1SLXA 3E9UA 1OIOA 4CMHB 2YAOA 2ZKHH 4W6XB 2VM9A 4KKBD 3L1OL 1E2ZA 3JWDL 3QE5A 1T1ZA 4ZMXA 4XOCA 2R59A 3OAUH 4OLWH 3CVHA 3NQIA 3AAZA 4E9XA 5ICZB 1ZWIA 3GSOA 2DRUA 1BPVA 1TZGL 1NBYB 3DKHA 4G9FA 4LCCA 2PYEB 1DBJL 2IDUA 3WO4B 1L9OA 2VLJD 4L8SB 3SBPA 1PTZA 3CSTA 3OF6A 1C1EL 2VDPB 3NYKA 2O5NA 3KPNA 3HI6H 2NY0D 4AYFB 4JCLA 4Y16C 1BZ9B 3QXDA 1AD9B 1U42A 2R9HC 4G5AA 4U1IB 1QD0A 3Q7JA 1DBBL 4GLRH 2WAQA 5DD6B 1TT6A 2J8UA 3OD3A 4PJHB 3KR3L 2ADIA 5D1QE 3SBWA 3S4SG 2DQGH 4QRAA 1HAWA 5CSBA 2GEQA 1EUTA 1HTYA 3O9WA 1NOLA 2H26B 3BH9A 3H56A 1ZTXE 3CFBB 2DTSA 1IM3A 2VDLL 4M5SA 4HU8A 2XWBB 4MRCA 3PQYB 2VDQB 4MCZA 2G5UA 4BQCA 2Y6SC 4NP4L 1ZA3B 4KMQA 4ZUTB 1THCA 1N5YL 1E2VA 3VXSA 3ZHLA 3SKJL 2ZPKH 3HBGA 1MHPL 4L2YA 1N0LB 1JZJA 3MBXH 3FSWA 2A73A 2G30A 1UWXH 2XWTB 3ARDD 4P23C 1PD1A 3A21A 3WE6B 3S35L 2Q7AA 2NY7H 4N2FA 5KS9A 3DROA 1YN6B 4NCC2 3C60A 4RRPA 3AU1A 3VW3L 4GW1A 2Y6TE 1I3RB 3HG4A 1AGEB 1CFQB 1WBXA 3SSGA 4X5WA 3MRHA 5C2BL 1FYTA 2WW8A 3A67L 4I77L 5DS8B 5CR8A 4DVRH 1E4WL 3LPFA 1ZXQA 4GUPB 3GXNA 3HG3A 4POUB 3QNZB 3VFPB 2VDNH 3WMSA 4TUOA 1F6AA 1DQQB 3QG6B 5E8PB 1BFOA 3CC1A 4DW2H 1C5BL 5ACZB 3W5MA 3JWOH 1UKSA 2AF2A 1E90A 2AI0H 1IQDA 1MCOL 2QSCH 3BVVA 1E3XA 2YJQA 2YLKA 5LG6A 4JO2L 2DQ6A 3KNBB 4ODHH 4MAUL 4XCNA 3Q6FA 2CO6B 3KPSE 4PJ5B 1JMXA 2QQKL 4L5FL 3BDXA 3W2DH 3RZCC 5IJKA 1MLCB 4AQZA 1FWXA 3RHWK 3MJ9L 5K69A 4BZYA 3FUHA 1CD1A 3DHJA 3ULSA 1AXSB 1U8KA 3SPCA 3TNNB 4AZUA 3QYMA 3SKNA 5DO8A 1NFKA 1SJHB 4F58L 4G70B 2P5EE 1DFXA 3CMOH 5IGXL 4EJ1C 1H3XA 2KPNA 1WAAA 3FB6A 1MCEA 3CCHA 3DSFH 3BVXA 3K3QA 3RX8A 4Y89A 1HQ4B 1WA2X 3ZDXE 3AUVA 1VB9A 1R3IH 5T5NF 3WL9B 3WNNA 3CXDH 2NW3B 4MA3A 3QZLA 1ZLWK 3SCMD 1JZIA 1XCWA 1YUHB 2E7BA 3NPZB 4CADB 1JXGA 5C6TH 1CQYA 2C3VB 3MFFB 2QQLH 4M62H 4PSPA 1T03L 1WSST 1FNSL 3K74B 4UINH 2FBOJ 2WTRA 1MRCL 2BP8A 2FQDA 1FFOA 4HJGB 4PLJD 4Q7DA 1SJEB 5IV2B 4NZRL 2DQCH 1A7OH 4GP8B 2WP3T 3CC5A 3EDEA 2VDPL 3VFTA 1N8ZA 3PGFH 3CFTA 3JUYA 4YO0A 2MQGA 2Q6WB 5A6LA 5IUCA 3U0PA 1EEQA 2OI9C 4GG6A 1P2CA 2VLME 3EDFA 4G2AA 5DVPA 4FG6C 5MEPA 1JZ2A 4L37B 4PCTA 1SGKA 3RDTB 1BVKB 3O6LH 3NQKA 2RQ8A 2WQVA 3GSVA 3JVGA 1VCAA 1A65A 1MJJB 4LLVA 4N3UA 3TF7C 5FO9B 5T3ZD 4RAVB 2F54B 2NQDA 4H0IA 3BPLC 3NMEA 3BP4B 3NACL 3DECA 3SGEH 4YS4A 5C1MB 2W88A 3ZTNH 1XO8A 1O7DE 4ODWB 3Q1SL 4YH6A 5JTWA 2VDQL 3NGBC 1GGUA 1QR4A 1BDYA 3HCVB 1KT2B 4PP2A 1DL7H 1T22A 3PP4H 4XZUB 3VCLB 4OF6A 4U6VL 4EDXA 5F7FA 5I0ZA 4G7VH 2VMEA 1AE6L 3VWJB 2PXYD 4XNMA 3RNKA 1CD8A 2XWCA 1DR9A 2ZUWA 4KTYA 4G8EA 2V7NA 3U79A 3LKSA 4JM4H 4F7CB 1BXXA 3ZKNC 5IVNA 2KBGA 3O4LE 1SLVA 4OUUB 2LT9A 5JOPE 5J6GB 4KPHH 4U3CA 4R26H 2RJMA 3HE7D 1B6UA 2OMUA 4JFFB 5HHQB 4YLQT 5DJXB 5FYJH 1SDAB 1II4E 5F44A 4PUBH 1XH1A 4ONGH 2XBDA 4WWNA 3ROLB 4XCCH 2XWRA 1J48A 3FT4B 4MNQA 4WI5A 2C3XA 4FQJL 5FM4A 3LZFL 3IFNH 3AXLA 1MCDA 3QR1A 2AQSA 1B4TA 5D1XE 5LNDA 4F2MB 3B9KC 4FEIA 3F7PC 1KYAA 2FATL 2O5XL 3AGWA 4HC1L 1W16A 3JXAA 2GSGB 3LXUX 2J88H 3VUAA 3TCLB 5CNHA 1R3LB 3CVHB 1G7HA 1ZWIB 4GQ9L 1S7TA 2EE0A 4OZGE 5ALBH 4UB0H 2WTOA 4G9FB 2VR8A 3QDMA 3S88H 2HKHL 4MQXC 5HPMA 5DR5L 4ZMYA 4MA1C 1CWVA 2A74A 4JVPA 3WJJC 1NFDA 1I3GH 4UZSA 1VA9A 4F8NA 1SM3H 4G1EA 4DEUA 3GHEL 3FF7A 3KPNB 4YQXH 4NYLA 3C9NA 2HRHA 3AWGA 3IJSB 3G6JA 1FG2A 4KU1A 4LASH 4OZHF 1N18A 5KVEE 1HCYA 1UZ6E 4HJIA 4X99A 2J8UB 2L7EA 4JG1L 4XMKH 4L0ZA 3JVFC 3AB0C 2ADIB 1JV5A 1XTMA 4EKJA 3GLEA 3O9WB 3ZDYE 1YEFL 1Q38A 4GKNA 1G4MA 3BH9B 4JRXD 4PB0H 3U4EB 3ULVD 1F18A 4EZKA 4FQ2H 4S1SL 3ZKMD 5EC2A 3C8HA 2DQDH 3SY6A 3LPOA 4LP5A 1LJMA 1ZDQA 3DOHA 3ECWA 4MJ4A 1NUGA 4LF3B 4OLEA 1EUUA 3VXSB 3OX8A 4YJZL 4G5ZL 5E7FA 4PS4H 5GGTA 2A73B 3LYRA 1ZV2A 3TX4A 2ZUYA 3FSZA 3DROB 2LU5A 3BJ91 1YMHB 2A6DA 3RTQB 3RVXD 4C57C 5IM7A 2YN3A 3SGEI 1YJDC 4OQ1A 1T66D 4FDWA 2ORBL 3QUYD 4ZX3A 1EHAA 4X5WB 3MRHB 3BUYA 3FN0L 5EBWB 1FYTB 3ZK0A 2XZQH 4S10A 4FLSA 3DMMB 5I1IL 1QW8A 5EUOB 4E5XG 1TQBC 2V5YA 1X9UA 2G3ZA 2JTDA 1XF4B 4GRLD 1GC1C 2O6FA 3BRGC 1F6AB 4YSAA 1JZDC 1ZS8A 1ROWA 1R5IA 5GGUA 4ODXA 4QRFA 1XF2A 4P5TC 5FOBA 3RA7H 1IQDB 4PIBA 3PQYD 3QA3A 1MFAH 4R7DA 1X5HA 1OB0A 5EWIL 1J5CA 4NJ9L 1KB5A 5CUSL 4WEUD 2R56H 1JBJA 1CD1B 1QLEL 4K94C 5EUKA 1LWHA 1U8KB 2NXZD 4ACPA 3SKNB 2ENPA 5BUPA 3VRLE 3PFUA 2WIIB 5AVWB 1TTFA 4P57A 2N4IA 3D4ZA 5FGBA 3G9VA 5G4MA 4M7ZB 3FB6B