1SN2A

Crystal structure of sea bream transthyretin at 1.90a resolution
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
118
structure length
118
Chain Sequence
CPLMVKILDAVKGTPAGSVALKVSQKTADGGWTQIATGVTDATGEIHNLITEQQFPAGVYRVEFDTKAYWTNQGSTPFHEVAEVVFDAHPEGHRHYTLALLLSPFSYTTTAVVSSVHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High resolution crystal structures of piscine transthyretin reveal different binding modes for triiodothyronine and thyroxine.
pubmed doi rcsb
source organism Sparus aurata
molecule tags Transport protein
molecule keywords transthyretin
total genus 25
structure length 118
sequence length 118
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 1sn2A00
4PMFA 4HJTA 2PABA 1TTCA 4WO0A 1DVUA 2G4GA 2G9KA 3DK2A 4FI6A 4IIZA 1OO2A 5CLZA 5DEJA 3CN3A 2B15A 3Q1EA 3TCTA 4QXVA 1THCA 4TLUA 3HJ0A 5DWPA 3SSGA 3D7PA 3IMVA 3M1OA 4QYAA 4TL5A 1SN5A 5AYTA 3U2IA 3W3BA 4Q14A 4N86A 3GRBA 3NESA 3DJTA 4N85A 1F86A 4KY2A 4Y9FA 1Z7JA 5JIQA 4TQIA 4TM9A 4TQHA 4Y9CA 4PMEA 2ROYA 5CNHA 3I9IA 5L4JA 3CFQA 3CN0A 2G3XA 4ABQA 4ANKA 3OZKA 1THAA 4ACTA 1IJNA 3DGDA 3ESPA 2B14A 3CBRA 3B56A 4IK7A 4L1TA 4TKWA 2H6UA 5K1JA 5E4OA 1ETA1 2B9AA 5BOJA 3TFBA 1TTBA 3QVAA 1TT6A 2H0JA 5FW7A 3D2TA 4TNGA 1BZ8A 2G2NA 2ROXA 1ICTA 4DERA 1TZ8A 4ABWA 5IHHA 4ABVA 3CN1A 1IIIA 3I9PA 5CM1A 1GKEA 4IKKA 5FW8A 4DETA 1Y1DA 1DVYA 3IMUA 4Y9EA 5EN3A 1KGIA 4YDMA 1QWHA 3FC8A 3U2JA 3ESNA 1SN2A 1SN0A 4PWJA 5CLXA 2H0FA 4TQPA 3CN4A 1DVZA 4Y9BA 1DVTA 1IE4A 3IPBA 3NEEA 1U21A 1SOKA 1DVQA 3NEOA 4DEUA 2G5UA 3ESOA 2NOYA 2G3ZA 1IIKA 3BT0A 3FCBA 4PVLA 5CN3A 5E4AA 2H4EA 4I87A 4TNEA 2IGLA 5AL0A 3GS0A 3GRGA 3CXFA 2B77A 3KGSA 2WQAA 1FHNA 3CFNA 4I89A 4PWIA 5CLYA 2GABA 4FI8A 3BSZA 3IWUA 5L4IA 3IMRA 1ZD6A 2FBRA 3DJSA 2QGCA 3DJZA 3GS7A 4TLTA 5AKVA 4TL4A 4HJUA 1X7TA 3A4FA 5AL8A 1E5AA 4PWEA 1TLMA 3A4EA 1FH2A 5TTRA 4IK6A 3DK0A 2F8IA 4MASA 5L4FA 4WNSA 1TFPA 3IWVA 2QGBA 4AC4A 1QABA 4L1SA 4PVNA 3DIDA 4IKLA 1E3FA 1X7SA 3NG5A 4TLSA 1G1OA 4D7BA 1F41A 3IPEA 1ETB1 4YDNA 5HJGA 2GPZA 2QPFA 4AC2A 4PM1A 3P3UA 5JIMA 3I9AA 1BZEA 1SOQA 3CFMA 3IMSA 4WNJA 5EZPA 5FO2A 5CR1A 4HIQA 5AKTA 1DVXA 3KGTA 5AKSA 4Y9GA 5K1NA 2F7IA 3OZLA 2TRYA 1BZDA 3IMTA 2H0EA 2H1XA 4QRFA 3P3RA 3GPSA 1RLBA 4PWGA 3CFTA 4PWKA 2G2PA 5FW6A 4ABUA 2QELA 4TLKA 1E4HA 5L4MA 3DO4A 3GS4A 1GKOA 1ZCRA 3DJRA 2G4EA 2FLMA 4HISA 1KGJA 3CN2A 4FI7A 3KGUA 4PVMA 2QGDA 4TQ8A 3GLZA 1TTAA 2TRHA 3NEXA 4TNFA 4DESA 4PWFA 4IKJA 4N87A 4IKIA 4MRCA 1BM7A 3IMWA 3P3TA 4MRBA 1TTRA 4I85A 1DVSA 5A6IA 5JIDA 4DEWA 3P3SA 2QGEA 1TSHA 5E23A 1BMZA 1TYRA 4PWHA 4HJSA 3A4DA 2B16A
chains in the Genus database with same CATH superfamily
3ARFD 1BIIB 2ICEC 4M5YH 2NTFA 3T1FA 1LJMA 3CX5J 3UC0H 4YSQA 1J9CT 1T89C 4JNXA 1A6AA 1O5PA 3I2CL 3CVHA 5EU6B 4K73A 4G7YL 4M1DL 1HXMA 2XU9A 3OWRA 3RPIB 3GUTB 1QSEE 3M1OA 5HPMA 4U1HB 3VFWA 5HGBA 4GQ9H 1OLLA 1BVNP 1ZTXE 2OR9H 1GGIL 4RBPK 2B0SH 2J1WA 2AJZA 1NFDA 2WNKA 2ZSWA 4NPKA 2E76C 5FK9A 4S0HA 1XEUA 5CJ5A 3MNVA 4JDZB 1BYNA 5E4OA 3P54A 4DKFH 1C08A 2CLVB 1T04A 2VNCA 3B7YA 3QB7C 3CG8A 3QR2A 1ZEAH 3QAZC 3QFJE 1JZ6A 2IWKA 2XQBL 2NY5H 5GIRA 1XR8A 4LOUD 3OF6D 4K8RD 1X5AA 1ZANH 1F4HA 1YEGL 4HT1H 4XT1C 1JXJA 4ABVA 2OLDA 2W80C 3NFNA 3VNZA 5KS9F 2AXJA 1IKNA 2AGJH 3NZHH 3ARDB 3JVGA 4XBEH 5F7FA 2YBRA 2R0LL 4M03A 2WAQA 3N85L 5E5MB 4BSWB 3BVNA 2VR3A 4XVTH 3RNQA 2A9CA 3UZEA 3WJJA 4EN2A 4W9EC 1U21A 4ZT1A 4RFEA 2BX5A 4HD9A 4HKJB 3V0WL 4XMWA 4NQSA 4TUKH 2Q6WB 1C8QA 2VDLH 4Y1AD 2H47C 3ATAA 2J6EL 3NP4A 2VLME 4G1EA 2QT6A 1I3RB 2JSFA 1MJ7H 5DMGD 3WDIA 2GT9B 1BLNB 1BQRA 1RJZB 3RVVD 3O6KH 2ZKXA 2LU3A 2NYKA 3IJEB 5JDSA 3O9WA 4IK6A 3LVEA 2CWRA 2F8IA 4JZNA 4UQDA 1TFPA 5SWSE 3UROR 3ARZA 5BRZB 3CSYB 3MJGX 3S97C 5BS0A 4WWKC 3BVXA 4AENA 2EDTA 4BQCA 4NWUH 3GO1L 4LRNL 2DJMA 3GM8A 5LXGL 3FQNB 4H1LH 4HCRA 4KMQA 4BWTA 5FYJL 1DL7H 2UXVA 1T20B 3MOQA 2GJ6B 3NCBB 3BLKA 4K5PA 1HJCA 3KPSD 5D7HA 3JUYA 1KV7A 2EIKB 2KZ1B 3CQFA 1PLAA 1NDMB 5T3ZL 1J5IA 2YAQA 32C2A 4K8RC 1NGQL 2VSCA 4LAQL 5DJXB 4J6RL 1NMBH 3CSTA 1YJDL 2BNRD 4MXVF 1FPTH 3ZE1F 1Z0MA 2NXZB 4K94H 3GIZH 4DW2H 3IEAA 3ZW3A 3T0XA 1HE8A 4JM4H 1GR7A 5EOTB 4AVJA 5TE7H 3MO1A 1CXEA 3KPTA 43CAA 2GC7C 5DA0B 3JT2A 5F9WC 4L3ED 1E8YA 4MCZA 4DEWA 2YUWA 5FHAH 3B7UX 3HNTL 1MCRA 4YBLC 2DWDA 4GQPH 1JTPA 2AANA 1L5GA 4W9GC 3OAZK 1XF1A 2DWEB 4MQTB 5H4YA 3O2WL 3JWOH 1NCWL 3FH7A 2CIIB 4TYUA 1EUTA 3GEFA 4U7SA 2V3FA 3NFPB 4TTDC 2PKDA 3IGAA 4P2RA 4NO5B 5C7XH 1YEGH 2IBBA 3HZVA 5I8KL 4P4KD 4Q14A 3T0VA 4KMTL 4XRCA 4XCNB 3HC3L 3K2KA 1PDKB 4OIIH 3BKYH 1G6RB 4A7GA 3PWVA 4ZTPL 2R8SL 4FG4A 1P5UA 4WI0B 4J3UA 3EJJX 4R2GD 2EDDA 2X87A 5DURD 2P80D 4QO1B 4JQIA 4JO2H 3Q6FA 3ARGB 4P2QD 3OVUB 3HFMH 3OTTA 1LEGB 1UM5H 2K78A 2R29H 1WZ1H 2ARJQ 2WSDA 2JFCA 3FKUS 4MYPA 3JWNG 2CHXA 3DDGA 3O41B 4P3CH 3U2JA 1T7XA 5T1DH 4ZX6A 4IS6A 1M05B 5FYLL 4A38A 3TO2A 5A43C 5DC2A 2YAEA 3QXWA 2GUOA 1AO7B 5LDSA 2FEJA 3B2PA 3VH8B 5IFHL 1OWWA 1W16A 1YC8A 2NZIA 4UANA 5ABZA 2VDQL 1AFVL 2WZ0A 3IE4A 1U95B 1F3DJ 1WCBB 3RIAK 1QZ1A 1E9OA 2GIYA 4J3SA 2WAHA 1FVDA 3PHQA 5SWSA 3FN3A 4GW1B 2K3HA 2RFXA 2ADJA 3ZRSA 1JK9A 3QIBC 5C0GB 1YPZB 4GKNA 1CL7I 4JO3H 1XF5A 3FT0A 4C58B 3NDYE 12E8L 4FXGC 1QFHA 1KT2A 1QMUA 2R4SH 3QJZA 4M7JL 1D5MA 3SZ6A 2WXKA 4XNYL 2FEDC 2VXTL 2VUYA 3GJEB 2XSKA 3LCYA 3LZLA 2VZUA 3M1CA 4R4FL 2E4FA 2A4ZA 3SDXF 4UV4H 4KKCD 2E3VA 2A74B 4YK4C 2R51A 3T0ED 5IV2A 2O93L 3Q06A 4IU2B 4OF8A 1KJ2B 4FLQA 4XX5A 4ENZA 2YPLA 3O3AB 3QQXA 4KUCF 4NB7A 1XL4A 4A2HA 5D1XD 2YXVA 2F9BT 4MCNA 4L4VD 3NJMA 5DRNB 1WTLA 1VHPA 4U3HA 1H0DB 5ACZA 3X1FA 1HH9B 3WIFA 4M3KB 3GLZA 4RWYH 5DQDH 1YMMD 2HLFD 5DZVA 5I1CL 4FTVB 4JFXA 3LRHA 3GSNA 1AJ7H 1NMAL 4PAZA 1J87A 1IM3D 5JXED 2HTLD 1CICA 3LQAH 3HI6H 3NZ8A 4G1MB 2RQ8A 4IU3B 4V33A 4Z3IA 3EXLA 1L9OA 2R69A 1SF5A 4E5XG 2CKBL 3WD5L 4AOFA 2ERJC 4H8HA 3SPVB 3C8KA 4JCWA 2WWOA 1MZYA 5DSCA 4GEIA 1DQDL 4PY7B 4RDBA 4OKVB 4P2OB 5EV7A 4LSPL 4WGVB 1T3FB 1RZ8B 1BG9A 3QEHB 4JFVA 1OZTG 1UUNA 4KTYA 4TM9A 2ROYA 3KPLB 3O6LH 1FGNH 3CFEA 5C3LD 1DBMH 5LGKA 5D1ZA 4AGQA 2KI6A 3E8UL 4UWQB 5HVFB 3FT9A 3D05A 1URZA 5CILH 5EOQL 4UM9A 1W72A 2WVUA 4DVRL 3GSRB 4PRIE 1AKPA 5AOIA 1ICTA 3PHQB 4IYKA 1AGBB 4ZUSB 1WGOA 4ZQTA 2EC9T 3ETBJ 2UX6A 1G7MB 2HFFB 4BA8A 1EHKB 2LFGA 2FIKA 1PIFA 2FQEA 4M7ZB 4CU7A 4QRBA 1TPXC 2HLFC 4PJHA 1MHCA 3IGLA 4OZ4B 3NEEA 2Z3FA 1MOEA 4L9LA 3LKPB 2JV6A 1NC2B 1WT5C 2QQNH 1E6OH 1QBML 4OGXH 4N0CD 5FYKD 3X14B 2AQ1A 1XZ0A 2GK2A 4LRIA 5K93A 4NKQB 4NNPH 4BH7B 2XXMB 4GYBA 4LESA 3GSWA 3GFUA 4XCCL 3MI6A 2AXGA 5CEXA 1WBYB 2RH0A 5CZVH 2EVIA 1U8PA 2QGCA 4LNRB 3CFBB 1LO0H 5KBMA 3V4UH 5I6KA 3A4EA 6FABL 4MQ7B 1ZT1A 1TQCC 2BFVH 4JQVA 5FM5M 4TXVB 1KN4H 1NAMA 1IUZA 3BVUA 4JN1L 4NZUL 2O1AA 5AVSB 3CFDA 4K3EH 4WI0A 1ILUA 4QWWD 1S9YA 3T6ZA 2EXTA 1BP3B 3MV8E 2VC2H 2D7OA 3PWPD 3M17A 1Y7VA 1AACA 4PJHE 1DVXA 1KIQB 1BVKA 4PLKC 2Y9RT 1KBPA 3QDME 1KJ2A 1SLWA 1UJ3C 4N2NA 3QCVH 1MFCL 1W6WA 2YEZB 4IOFC 2UZIH 4A2EA 4UNVA 1MNNA 1LNUB 2E4TA 1NM9A 1SDDB 2EIZA 4L5FH 1I7RB 3ZL2A 5MHSD 3RFZC 2QLYA 4I3RH 1J11A 3UC2A 5ADOH 3UYPB 3T09A 1HEHC 5EZOL 1PAMA 4HXBL 5KBPA 1FFOA 1KPUB 1KYAA 3E9TA 2IAMC 1BBJB 4QXUL 1DVSA 1KTLA 1OAQL 5ECJE 4ZFQA 5GS0C 4MAYA 1JMXA 1HOEA 1L9PA 1M6UA 3L5XL 4LLUB 1A6PA 4LLDA 2BCKB 5I6OA 4RX4A 2WANA 3TVMA 3GZPA 2OSYA 4FYSA 4YBQD 1G0XA 4GKZA 4GAJL 2DKSA 4I18B 4BFEA 5F88A 2HLAA 2W0PA 3QYNA 3BPOB 3KPQB 4J1UA 3G08B 3UP1A 5KVDL 1VFUA 4D9RD 2ZF8A 4WHYH 4AZ8B 2HG0A 3GSNH 4QWWC 1WICA 5EO1A 1YPZF 3RRQA 3OM3B 2XVBA 4PYHA 4DK6A 3UTPE 4HGMA 3TH4T 1PEWA 1CDHA 1R6VA 5CU5A 4HOWA 3UTSA 1D5ZA 1BEXA 1EERB 3DUSB 5ES4B 4DSYA 3WTVA 4AMKL 2WUCH 4W4NA 4XI5C 3A5VA 3BJ91 3DSNA 4CGTA 2NX5E 1OAYL 4KK9C 4L8CA 1MCKA 1MCNA 4AUJA 4BQ6A 1K2DB 3B1UA 2OJEB 2X2HA 3TJEL 5B7MA 2W91A 4K07A 4H4NA 3PJSB 2XQYK 3C8DA 1G6RA 3CDGA 3QJRB 3FQTA 3RL1B 2WINB 1AKJB 3AU1A 1KCBA 5A2JH 4X4XA 4KKLD 4M9PA 1A7NH 4NNYB 2OMXB 1D9KA 5HYJD 5L88H 3KPRA 3D1MC 2BOBB 4TVPH 4WHDA 3QA3A 3STLA 3UDWA 5DGQA 4PJAA 3IDMA 2J2ZA 3OAZH 1I8MB 2X9ZA 1EJOL 4LCWA 1YNLH 2C3XA 1CF8H 2CGZA 5AAMA 3TN0C 4YSRA 3FTZA 4JVWA 4PWEA 2YRZA 3VFPB 5AB1A 4ERSH 1F4AA 2VTFA 3OKLB 1AHMA 1RPQA 3DOHA 4HDIB 1QLRA 1NBQA 4JCMA 3KBHE 4P3WA 2H32A 4O2FA 2A83B 3AUVA 2IADB 5DJCB 5GRVL 1EANA 4WF7A 5AYUH 4W6XB 3PWLA 1ORQA 3NCXA 1JZJA 5D7KD 4KKRA 3SDXB 1EWHA 1E5BA 4Y19D 2QR0A 6FABH 3HE6A 1P4UA 5BMFL 2BIIA 3BQUC 4OZHE 5E5MA 3KPPA 1NBYA 4JFED 4MMYB 4WEUD 5I74B 5D7KE 1GY1A 4LLWA 4O2EA 3U46B 2XWCA 3T4YA 4TLKA 5I73C 3QPQC 1U0QA 5AQ0A 3RIKA 3THML 4Z1PA 2Y5EA 5LG1A 3N1GC 3WTYA 4FI7A 1QRNA 2XXGA 3Q1SH 2XN2A 5DTFB 2W9LA 3QR1A 2OCJA 1YEJL 3WUWB 4HJSA 4C47A 2QPSA 4HU2A 3DX6A 5ALCH 3BAXA 3A67H 1JV2B 4GW4B 2FQFA 5HGDB 1J0KA 2ZSWB 2V2TA 3QIWB 5EIVA 4IRZA 5DK2A 1DVUA 4I7ZC 3REVA 3T3PE 2N56A 4P07A 5GGVH 3HA0A 4P23B 4R83A 4XO3A 4ZUTB 4EZKA 3CCHB 2HKFL 4CSPA 3LXUX 1PLGL 4YSEA 1VEOA 3DDFA 4MX7B 3VD0A 1S9VA 3REWB 5DQ9A 3KJ4B 5A16B 2VDNH 3VVWA 4ADIA 4HMEA 4B9IA 3T9WA 1PKQA 2FX8L 4OTXH 3CHQA 4QXWA 3EFFB 4WFED 4YPJA 1QBLH 3QI9B 3FT3B 1SYSB 2RBLA 4RNRB 1BWWA 1KPVB 3QXDB 4H2CA 4WUUA 1T22A 2QV4A 2X44D 3BQUD 3IJHB 3Q01A 3B9DA 3FO0L 1CE1L 3ALPA 3MAWA 2FD6H 5EBWA 1EEUA 2EICA 3W39B 5DD3L 2ZOLB 3ZE1B 4OCMC 1JGVL 1W9XA 5SX5H 4QHUA 1A4AA 3FFCB 2YEQA 1Z66A 3BDYH 3O8XC 3WYRA 2DLGA 2IIJA 3TZVA 3RWDA 5IHWA 2NY7H 4KRLB 1W8EA 4AI7A 2K7PA 1KZYA 4F7TB 1DSYA 3JZ7A 4R8WL 2BIPA 1ZE3C 2V5SA 4GSQA 2HJFB 4XNXL 2ATPB 2EACA 3HG1A 4LNVA 1R34A 3QS3A 4BFIA 3W11D 5IFAH 1J9TA 2XZQH 3QARA 1LHZA 2BS8A 3WMSA 1Q72H 3DJSA 3OXSA 2WZ6A 4PJGF 3DX8B 1KBGL 1USQA 2P5PA 4LCCC 3OKNA 3MROB 5TTRA 2CHDA 4UV4L 2VCOA 4Y4HB 1FH5L 3TNMB 2WTPA 1J05A 4HX1B 2O30A 2VLRD 3NG5A 2WUBL 2ZIDA 2H2PC 3O3EB 4AC2A 1T5XA 2VABB 2ZJSH 5D6CA 3CFIC 4PJAE 1RUQL 4ELMF 3GSWB 1L9TA 1RJLB 3QNXB 4FTVD 4IW4C 2XKSA 5IQNA 3DI2B 4ZAKD 2LW3A 2UVFA 4GOSA 1HAUA 1U8OA 1H6TA 3QSKB 1JPTL 3PP3H 3Q8FA 3MV9D 1OOAA 1PKOA 2AJSL 5JOPD 2YN5A 4EI0A 2WGXA 1PZSA 1YSOA 4JX0A 4XXDA 5I15L 1V05A 4MB4A 2G4EA 4K3JH 3VRIA 2F74A 3L95A 2RJMA 2C3GA 5ETUB 2QSTA 2X7LA 1BM7A 3P3TA 1AGBA 4L29B 2A38A 3MRFA 4LSVL 3VI4A 1H3PL 2B3RA 5AZ2L 5KTEL 3VW3L 5TQ2H 4MD5B 2DEYX 4XPAH 2Q87A 4JG0H 2VDPH 1DJYA 2P24A 3I6GB 1G9ML 1CFQA 1CYWA 4A6YA 1BEYH 1QFUH 2IGTA 1UWEH 2AKRA 4Z7WA 1KCVH 1THCA 4NPYA 1NC2A 4FNQA 2BY2A 3O4OB 4ZI8A 4KGJA 4BQ9A 4OFIA 3ROLB 3C9NB 3GYRA 4B5EA 4XTRD 3NQKA 2D4DA 4MS8C 1BXVA 5D5MB 2VM3A 4ODVL 5J6GB 4Y2OB 5T5NF 4BELD 4OIIL 2WLKA 2EKSB 4PGBA 4OZIA 3QORC 5I76A 2CJTA 5LBSA 1IC5L 5CD3A 1B0IA 5BUAA 3EJRA 2DQUH 2WLIA 3MJ7B 1MH5A 5C7XL 1OSPL 4JDVB 1QFWM 4LFHG 2IQ9H 2J2ZB 1HIML 5AD0B 2GHWB 4TVUA 1EV2E 3PL6C 4F9PA 5C08E 3JWOL 2XN9A 3REWA 1BG1A 1F45A 3RILA 3RWHA 3H53A 4PY8I 4AYEC 3JVFC 1NLBL 1K8IA 1PAZA 2YOCA 3MLRL 4I9XA 4NO2A 4QXGL 2Q8AL 4YHLH 4LVOC 2VN3A 2WUBH 1YY8B 4C54A 5TE7L 4A67A 1KYDA 1IE4A 2PP9A 3T77A 3NEOA 3QDMA 4J3OF 4HF5L 1T1YB 1T1XB 1B4JH 3IF1B 2NDGA 1IQDB 5D70L 3VDBA 3LKQA 4NRZA 5TE6L 1ZVHA 5BVJB 1MAMH 5JPMC 1QRNB 5EF1A 4Y16A 3FQWA 1PZBA 4C83B 5IB2A 4PV9B 4MAYD 4U3CA 2ZAGA 1D5MB 1E5UI 2WB7A 3ECQA 4PJCE 5IW1B 4MS8D 5C8JB 3BD5A 1G7QB 4HC1L 5HYJA 1DLHB 3L45A 1PL3A 5EO9B 4GG8A 4DUWA 2SODB 2X6VA 1FZJB 4JRYD 4LLVA 4H0GA 4E5XB 3ZHLA 3WTTA 4GQZA 5KG9B 3FS9A 5A40E 2X4RA 3ZY7A 5TE4L 3ZTNH 1AKJA 3AU1B 1JIBA 3T0WA 4NQDB 3BWAB 3K8KA 2VM4A 1NWPA 3BSHA 4ZW7A 2AJXL 5DMKA 5C0IB 4E42B 5CEZH 4XN4A 3G6AA 2F54D 4DP4X 3B4NA 3FMGH 3HZKB 1LWRA 5IESH 5SWZB 1NCDH 1VIWA 4AXWB 5KS9E 2CIKB 4WUUD 3MLRH 1PZ5A 2GTZB 1X5GA 4OCYH 3F84A 5BZDB 3CZJA 3BKJL 4DVBA 2FX8H 4OF3A 4ESKA 3MGTA 4RGNC 1BLIA 3EYSH 4YUEL 4Z76A 4P06A 3LAFA 2IV8A 4QRTB 1MNUH 5C0CA 4LASH 3QNYA 3UBXB 1BFOA 3MUHL 3VQLA 5IOKA 3F7QA 2C3VB 2G9HA 3BEVA 4JRYB 2QLVB 3KAAA 5GS1A 1RUMH 3B8YA 3F12B 1UFGA 5DZAA 3FB5B 3HE7B 5ANME 1JGUL 5KSVA 1JNLL 3V4VL 2DWSA 1XGRA 4Y8AA 3OLEA 1DBJH 1GSKA 2OJEA 4JZJC 4WEBH 3U0TA 5C3IA 1HK6A 3NSXA 3V55A 3CU1A 4YDIH 2ZXGA 3UO8B 3DETD 1KCVL 2B0SL 5E8DH 2Z8SA 4JRXE 2VLLB 1E27A 2O6FA 4JFPA 3VQMA 5MI0B 1FLRL 5KSBB 5EUKA 2I5YH 4KHXH 1OTTC 5F7DA 1INDH 4X9IA 5HVGB 5IROC 2V9TA 5KW9L 3GTVA 1QASA 4ABWA 4U6YA 4OJYA 3UTZB 2DYPD 1OGAE 3FUHA 3D85A 2E86A 5BZZA 4WVRA 2PP8A 2Z4TA 1HL4A 3DSFH 4PRPB 1M56B 5JXEC 2UZYA 4RGND 2VW4A 4ETQB 1JPTH 5AW5B 4I48A 3UBXI 1F4YL 3V0GA 5EULV 4R7NB 1ORSB 3T2QA 5F9OL 3WNLA 4X4ZA 4HOMA 2BVPA 4A55A 3B7RL 3CDFA 4AQ1C 1IAOB 5A3ID 1II4E 3GRGA 1TEFA 1UM4H 3KLKA 4QCIB 4Z8FH 2VDMH 4PWIA 1EVTC 3VQ1C 3BSZA 2HT4D 2N7BA 4XB3A 3II1A 4ANWA 1CICD 5C09E 3CSGA 4EIZC 4Y7MA 3WHXB 4H20L 1VGKA 5L88L 1BIHA 3V79C 2MEJB 1VGEL 1KBBA 4XXCA 1T80A 2MIZA 1E7UA 5GJTL 2XIDA 3L3OB 2HKHH 2NY5C 2BNRE 3IDGA 4NKMA 3QNZA 1K9TA 3PG2A 3IMSA 3ILQD 2LV4A 2WTOA 5G2NA 4HHGA 2YKKA 3C9NA 1I1AB 3QEQA 1FAIL 1MCPH 1YDPA 4ZMZA 5JYMA 1K85A 1OAYH 1CGSH 4K5NA 2QSCH 5TD4A 1A25A 4R0LB 3IDNA 2MCG1 3CXHK 4LSSL 3QUZD 1ZIAA 1U4EA 5AD0A 2BERA 5EO0B 1WAAE 5I8OL 5C0NC 4Y5YA 1PU0A 1KENH 1QQDB 3HC0A 3T3PB 3K5RA 3L5IA 1A4JB 3FQWB 3CK0H 5GGTL 3QZMA 4W9HC 1QA9B 4WO0A 3L3GB 3QHFL 1HYSC 1AO7E 4MMZA 4BXSV 1BWMA 5CLZA 3DA0A 3KYKH 4PJ8C 4QRUB 4E41A 3RWFA 4XH2B 1QI4A 1EZVX 3WFDH 1S7XA 4N85A 1OLZA 1DQQB 2W9DH 1CQYA 1L9SA 4WK4B 1YPZA 4HXBH 3HRZC 2Z91A 3SZKC 1UD4A 4KAQL 2YD5A 2MPAL 3ATEA 1JGEA 4M3JA 5C09D 3LZFH 1NDTA 5FYLE 3TYGL 2ARWA 2Z31B 4JFDA 4HG4K 1E4WH 4HFWA 2EDEA 4RQQB 4M1GH 4ADGA 2W8CA 3OGCA 2FUQA 1ACYL 3EJTA 5T1JA 4QRSA 3VXMD 3BJLA 3N43B 3S3BB 1AQHA 2EYRB 3P9MB 2OK0L 3IVKB 3OR7B 2PWEA 1NGZB 4UOQA 3X1BA 2XG4A 2P45B 1PPIA 3CHOA 1S7VA 5HYSB 5I30L 1NH6A 1SN2A 2XG5A 3OAUL 1T2JA 4AH2B 5F0JB 2V2XB 3QDJB 3NIGF 4HH9B 2APTA 4N2DA 3U30C 1I1FB 3V4UL 4XX1E 1LO0L 1Q9OA 4D3CL 3E1F1 4NKIH 5EU6A 2AVFA 4LL9A 4M1CC 5FHBL 1OB1A 4S10A 4ZUUB 4B0MB 4QCIA 1FFQA 3S8GB 4JQIH 4IIQB 3APFA 1A8JH 4UQCA 1UEYA 5HGHA 3QYCA 3HKFA 4PJ7E 1J0HA 1HHIB 2X09A 4HIHB 3MREA 5FF6B 4AL8L 2BVOB 3LKRA 4YHIA 5KUKA 1SEBB 3CX2A 1RY7B 3MLYH 4QGYA 2NY4D 4YE0A 5C0FB 3FB5A 5F6IC 5BS0E 3QDHA 2A77L 1ZKAA 4JJ5A 1N8OE 2ZOKA 4JB9H 4KV5E 1RLWA 4YHPA 5IMLB 1LGVA 1BXXA 2W65B 4ANXA 3H7LA 3ZUNC 4N2CA 4FYRA 4PP1D 5HHOA 2F58H 2X12A 1QW8A 4JRXB 4RLDA 1RZ7L 4ISVA 4XBPA 5SWZA 4ZSOA 1SYVB 1GGYA 5FYJE 1TTRA 1S9WB 4JHAL 3ZO0A 1FCGA 4Z7VF 3HRZA 1WC7A 4X8JB 5JOFA 3OKOA 4AMKH 2ZKHL 4P57A 3DXAA 1DQIA 1YCSA 1JZDC 2HAZA 2YWZA 4IS6B 3D50A 1G9EA 5KG9A 1JGLH 4LLWB 1FO0L 3FOLA 3RJOA 4NNXB 1HL5A 3BP7B 3PWNA 1NMAH 1TO4A 3NESA 3ARQA 4I0KA 4JKNA 4ZFZB 2VXQH 3HVNA 4M7LL 3F7KA 4HFUL 5DQDL 5CEZD 5DUBA 4IEFB 4FGMA 3CLEH 4OLUL 2BHYA 2CJSA 3BP5A 1NCBH 2OZ4H 2GFBA 3KLAB 2X4NB 3V0AC 4GMTL 2WWKO 3TXAA 3OKDA 5MEQA 3S4SG 1IAKB 2WLLA 3IXAB 2ZCLH 3Q6GL 1YNTB 4QUOA 2VXSH 2J25A 2PCYA 5HHVH 4J3OD 2G5RA 3FBQA 1AMXA 1CPUA 1TLKA 4HD5A 1DQLH 1F1DA 2XRAL 1JF5A 1U8IA 4LL4A 1Z2KA 4XRCB 4ZD3H 2HH0H 2GHZA 3QDAA 3LD8B 1VGEH 4GI8A 4PU2A 2GB2A 5IEHB 4NZTL 4BIKA 3ZTEA 3QRFM 3ELAT 4XNYH 1TQVA 1Y0LA 4LO9A 1MFCH 4B95C 4HUVA 2QTEA 3U6XA 3CCHA 3SCMB 3UOAB 2KLRA 3LXAA 3GBLA 3FTGB 3MRPA 4I3SH 4GRWE 1IBZA 3PHSA 3VACA 5JDSB 2C1PB 4QTFA 4PGBB 4BQ8A 3QBTB 5EZIH 5JHDB 1BYPA 4RIRB 4RSVA 4KKAC 3L3JB 1EXUA 4FQLH 2VLRB 1TQBC 3WXWH 1AY1L 4WFFD 3KJ6L 4JL1A 4P2RD 3K2UH 5GGSA 3V5DA 5KW9H 4YDKL 1D9KB 5TPWH 5H94B 2I5YL 2WC7A 2ZNWA 4XC3H 4BUHA 1A65A 3OPUA 2YBRB 1N4XH 1W8NA 5JHLH 1OGAA 2CR6A 4KH2A 1RFDH 1QOKA 2XVKA 3DYMA 1REIA 4PLOB 4NI3A 4Z3GA 3QFJA 3POHA 1J1OL 3HZYB 3U4KA 5ETUA 5IHZA 1SLXA 2ADFH 3RVUC 4GQQA 5HYSG 1LO5B 3QQ9C 1TIUA 4F9PC 3ECBA 4U6VH 4HJ0C 4JRXA 5IQ7L 2FHCA 4A7SA 1JBJA 1PSKL 2PO6C 3ROLA 2XOTA 2O5XH 4FMFA 4LCIL 4APQC 2D4FA 3FJTA 4XODA 4AYSA 5I8KH 4ZO7A 2CALA 3U1SL 4YOKA 3TIDB 4POYA 2VIRB 5CILL 5EOQH 1MNUL 1I8MA 3ZMRA 1SVBA 5EN2A 4JHZA 3F6JA 3GJFA 2AXFA 5ITBH 1D9KD 1FGNL 4I1NB 5DHYA 2ZCZA 3O6LL 4MHHG 3D2UD 4Z7WF 3FOLB 3MBXL 3RWJA 1VCAA 5I9QB 1XH3A 4O9HH 3CDZA 3CVCA 1QR4A 3MLZL 4KQ3L 3HCVB 2G5BB 5DI8B 3L95B 2MQ0A 4JM4L 4MYWB 3TOPA 2UYLA 2VO8A 3D08A 1G84A 1DJGA 4ACTA 3RTQB 1TZHA 1I3UA 2I9LB 4IBYA 1I9IL 1N2RA 4RGNB 2GI0A 1NCHA 1R3KB 3HI6L 4KXCA 4KTEH 5FK9B 1OB1B 1QSFB 3X3GH 1UQSB 3MRLB 2SEBA 4WV1A 2QPDB 3X3FH 2I9TB 2ATPA 2AEPL 1CF1A 4HHWA 4ZFZA 5MEOB 4MZRA 4MAUL 2ZUXA 5K9KA 1BZOA 4F3FB 3DO7B 1DL7L 1YEKH 3WE1A 4AH2A 1GS6X 1FV1A 1RQ5A 2APSA 3OJ2C 4PRBA 3RWDB 4GUCA 4BFFA 4YDMA 4OI9A 3FC8A 2RIKA 3DHMA 5LAXA 2DQTL 4M4RB 4U4IA 2ALWA 3ARBC 3P9MA 4LOVA 4APQD 3U30B 4JFQA 4UQ2A 2Y7LA 3O6KL 4EN3B 3RDTB 5E8NA 3S37H 3U7AA 4Z5RA 4PD4J 2QHRL 4S1DC 3L1OH 4ISVB 5KVDE 3VGFA 2IF7A 4CGUB 3HMWL 3DPDA 2CCVA 1Z9PA 3DJZA 4AYGA 3IU3A 3GMLA 1FIGL 4FZEL 4NSKA 4PJIF 3TFKC 3S2AA 2D3LA 4DEUA 1Z5LA 4JM2B 5DJ0A 5F9JA 4HHAA 4XVTL 2F7RA 1PG7X 4PJIB 2ZYRA 5CEYB 2E7LC 5IM7A 3RWFB 1NCJA 4LPUA 4FFWC 4IRZH 1P4BH 4Z78B 3HG3A 1S7VB 3IKKA 5HYSA 4CVZA 5DYOA 2XQBH 1A4JA 4UQIM 2BP3A 3GTTA 4LARH 3GJFK 3T04D 2EILB 5D2NE 5AW8B 4WTZA 4Z95H 4F24A 5C9JA 4MA8L 1AXSA 3O4OC 5EU3A 3SQBA 4F8QA 1DCLA 3AFLA 3ZRFC 4DESA 5J13C 3EYUL 4RRPG 2DB8A 5PAZA 3DARA 4S1QL 1IL1A 1RVFH 2DL9A 2X2UA 3UH8A 3ZHNA 4JO2L 5CEXB 4PRDB 2QMJA 5E1QA 3UGUA 5DMJB 3REVB 3RGVC 5DRNA 5GS0L 2ZP0T 4AJWA 1RZ8A 1G43A 2OMVA 2VZ1A 4HEME 5BOPA 4OLXH 5ILTL 3QNZB 4L9LB 5L7XH 4QHNA 1K6QL 1V7ML 5DRZB 4G7VL 3B2VL 3EYVB 5E99L 1WAEA 1HWHB 5BZXA 5IVXA 5E1HB 5JXAL 1P6AB 2VR6A 2WP3T 4AMWA 1J5OH 4GO6B 3H2WA 1LMKA 4PB0L 1G9NL 3E6HB 4U33A 1YQVL 2B08A 4KKBD 2F1EA 2J6EA 2BC4A 3N40F 4WLCA 1OVZA 1JPSL 4G3YH 2AK4E 3OWEA 3SGJA 1P7KB 1SJEB 2FDBP 4OUUB 4X7SH 4XVSL 3WO3B 1B9KA 2X6CA 1O0VA 2BVPB 4M48H 4BV1A 3BHBB 2DQCL 4MGXA 3OAYH 1U95A 1UXWA 2YXMA 2H9GA 3V0EA 3V7MA 4DN3L 2CNYA 4NAMA 3O3BB 2CRYA 4K15A 4P57B 3RL1A 5JHBA 4FFYL 1VFOA 3LV3B 1Q72L 3RWGB 3EFDL 5K9QI 1RU9L 1UD5A 3U4BH 2GYSA 5JLZB 1I3VA 1KOAA 3T4AB 1T89A 1XFPA 2PXYA 3C5ZB 5GGRB 4YXHL 2P26A 3KGSA 2IPTH 3R19A 3LRKA 2CJUL 1KGCE 4NKOB 2OSXA 3H2QA 2E9IA 4HZLA 3S7GA 5GRYA 1MKFA 4KDTA 4JMXA 3ARWA 1QSZA 5J1AB 2XY1A 1JK8B 5I28A 1T03L 2JELL 5CJ8A 3FFDB 3K8LA 4OCWL 2AS5M 3C75A 4ZMNA 2AVGA 2BOLA 1EIBA 2GI7A 3TVMD 4PM1A 4AQAA 4HUKB 3V0VB 5FDYA 3NPZB 5GISL 3TPUA 1U3JA 4HPOL 2AQSA 4NBZB 4WTZG 2W1NA 3F7PC 1CLVA 2H1PH 2BCKA 1NSNL 3Q9PA 1E0OB 2OX5B 4EIUA 5KYYA 5HDBB 5JIKA 1EXGA 3UADA 1W0VB 1ZA3A 4RMWA 5B7EA 4EMZA 2APXA 5JMRA 3V2AR 2NY3B 4C56D 1MPAH 2BMKA 2YD2A 1PLGH 1B0WA 4FFYA 4FEIA 2DD8L 4FNSA 1J12A 1OP5H 1OSZA 4DKAA 3NT0A 1CK0L 2ZX8A 5BXFB 2J73A 3PAZA 1J86A 1O6VA 4Q8BA 1FFPB 2QDVA 4LKXA 1O9ZA 4WFGD 2P5WA 1KIRA 1XMEB 1KFAH 1KJ2H 2B1OA 2DQGL 3O81A 1O7DC 1XMWA 3GLDA 1GS7A 4KOBA 5E03A 4DCQA 4F33B 4YAQA 3KXFD 3GMNA 1KGWA 2YGVA 4NUGH 4F37K 1I82A 1XIWA 2HTKC 1VZIA 1D6VL 2OMZA 3FQRA 1JAEA 3N42B 1IBHA 4P48A 3EGSA 4ZMWA 4XMPH 5ENWB 3PWPE 4F7EA 4GUPA 4AQEB 1NL0L 3FZUD 4GQ9L 1KBWA 4ZXBD 4PCYA 3UTSE 3T71A 4Y4KD 4YE4H 4KH9A 3PAVA 3CZUB 4N6RA 4ELME 2DYSB 5IW1A 3Q8CA 4CUCA 1BOGA 2DZEA 4FFVC 4FQCH 4LHUA 4UUJB 5E6ZA 1YEIL 2WD0A 3KBFA 1P7QD 4WJKB 3WXWL 1WFOA 1UASA 4HKXA 2CPCA 4DJMA 4ZMXA 3IB4A 1NGZA 1VAHA 2E5EA 1GA2A 3E6FB 4QKXB 1A0QL 3MJ8B 5SWQA 1SM3L 5GRUL 3Q3GA 4D7PA 4NCC1 4PBWD 1TQUA 4BINA 2OJ1A 1JFQL 2IMNA 4K23L 3MODH 4OLZH 2DV6A 1LP9F 2VLJB 3SKUD 5J6HB 2JCCE 1JL8A 4HWEL 3P9WB 2DOCA 1EJOH 4KQ0A 1EHNA 2WZ5A 2DMBA 4P2RB 2A9ML 2MOQA 1KCUL 5EO0A 3JV6A 3D51A 3ZE2B 4B60A 4DKTA 1MFNA 3QZWB 4NKDB 4PJ8D 5DUPL 2Y6SC 1HHGB 1QBAA 1ZLDA 4FQXB 2PXYB 1KZQA 4OSUH 2NYYC 1XR8B 2XRAH 3TJHC 1BLNA 3HZ3A 4Y4KC 2VWEE 3DK0A 5IW3A 2L3BA 3HW7A 4E0RA 4GXFA 1KACB 5LCVL 1JPGB 3R06B 3T8VA 5M95B 3NJJA 1ADQL 4EVNA 3D2UA 2D7QA 4YHNB 2OMVB 4I9WD 4NPYB 3C60A 5I5RA 2K4AA 2IWEA 4JPWH 2A0LC 3TNNA 5HI5D 1O6SA 4CVWA 2J88L 1SVZA 2FHFA 2X53A 4X80L 5B1KA 3FHQA 4N0YL 2ZP9A 4Q6IC 5KOMC 4K55A 2NX5A 4ABUA 3IDNB 2FRGP 5I6NA 4PJ8B 2ENPA 5ERWA 3UBGA 2WXOA 2E59A 4A04A 3CJJA 3OKEA 4HISA 4YX2H 1BQLH 4PGEB 1QHPA 3RZCB 3SE9H 4HOZA 2YPKA 3EO0B 1GZPA 5IB3A 5IIEB 2PYEE 3HG4A 2PUQT 1P2CB 2UUDK 4A7QA 3L5XH 2B16A 4G1EB 2NRDA 4G8GA 1IBDA 5C0EA 2Q86B 1LM8V 3U79A 1MREH 1MRDL 3U7WH 1NBZA 5I0YA 1C7SA 3DV4B 4R7VA 3MHZA 3KL5A 2CK0H 4DAGL 2FIRT 4ZO9A 1OB0A 1J48A 3GMMB 1EEZA 2UZXA 5EU6D 2NXZC 3TBWA 3WKPA 5FECA 1L0QA 1IKFH 3L2NA 4JB9L 4YDLB 1NTDA 3UBXG 1KXVA 4HLEA 1CDUA 1BIIA 1NUDA 5C9JB 3CFCL 3OXSB 4XPFH 4F2FA 4LVHC 2PO6B 2VDLB 3BCDA 5CD3B 4G5ZL 2FECI 3CPLB 2JCWA 5DJ6B 4TNWK 4AQ1A 4EN3A 1XBDA 2QZQA 3LNEA 4RGNE 2AC0A 4ZSOE 5FA4B 5IV2B 5BO1H 1FP5A 3GWJA 3NP3A 3P0GB 1HEZB 3O2VH 4ILDA 3L08A 1XV8A 1E9QB 5B1JC 1QKZH 4NQVB 1V55B 1GGBH 3TV3H 3VXOA 5CIPA 4N9GA 4QYOA 3GXMA 1MWOA 4NKIL 5DHVB 3BDXA 3MBED 3NJNA 2X6AA 4HJ1A 3KBPA 4AGLA 4GKNB 1HH6A 1NIBA 4HS6A 2CO6B 2YA2A 2ITCA 2GBAA 3ARGC 4OGXL 5KYYB 4P2QE 5AW3B 3UZVB 4XGZA 5T1MA 4NUMA 1ACYH 5I5JA 3AT8A 4M1GL 5HVHC 4RNRA 1TG8A 3TIEB 2JMRA 4LIQL 3VDCA 4XN5A 5DVNA 3D07A 4M4RA 3SYOA 2RA1A 5ICXA 3EGDA 3HG1D 3R8BB 1I7TA 3NCWA 3B3IB 5HJGA 2AXWA 1SGKA 4D0CB 2EDBA 1OCCB 3K6OA 1A7RL 1J10A 4L3CA 2ZG2A 4LXFA 5AKSA 3B9KC 5D6CB 2CAKA 5F7LB 4C56E 3BVTA 1FN4B 3KPSB 3N2JA 1ZRUA 5ID1A 1TETL 3GXNA 5HGDA 3B83A 4N2IA 3LPWA 1F56A 4QO1A 4UQ3A 5E08H 1RZFH 3EGXB 3P73A 3LH2L 4WNQB 2JNZA 1MUJB 5DUML 5CFHA 4HLJA 1GMIA 3ZDXB 4W1TA 4XPTH 3LQZB 4EAEA 5K39A 2A6KB 1YNTF 3GSOB 4AQAB 1EZLA 1RIHL 2Y7QA 1HESA 1T1XA 4N0UB 2BSSB 2DPKA 4MRBA 5IBUG 3DHUA 2QEJA 4MNHA 4OKDA 4X42A 3APNA 2A74C 3L4TA 4YK4B 4JQXA 3FN0H 3NA9L 4I2XE 4ODBD 1JD9A 1K8IB 1VDGA 1MI5A 4X5WA 2J88H 5D2LB 3DNKA 3VXRA 5B39A 3J27A 2ZWYA 4NJAH 4XN2A 5GGUB 2YUZA 3Q44A 4FFZH 2XN9B 4P59L 2QSCL 1P84J 3S3CB 2NUPA 5ALBH 4IRJA 2O5YL 5CWSB 1AR1C 1MY7A 3N9GH 4HWBA 2F53A 4D8PB 2ZAIA 5L9DH 4P2RE 4NRZB 3MJ7A 2A7BA 5E8OB 5C86A 3UJIL 1XCTA 2WN2A 1EEQA 3B9KD 4Y16C 4Z7QB 2DQEH 4XNMB 3EH5B 1HTYA 1UC6A 1R17A 2R59A 4A39A 4N8UA 5I75C 2VN6A 2OP4L 4KKPA 4PJCB 5T1KB 3QQ9D 2ROXA 3TBTB 2CG9X 5AW0B 1MI5E 3ZTJG 4N1HB 4PJFF 1FYTB 2X4PA 1KJ3H 3WKMH 3L4UA 5HHMD 3WKNA 3ZKXB 4DPCX 2KPNA 2KHAA 4JW3A 5JA8B 3VX0A 3MODL 4OLZL 1AHWA 2Y07L 5D1XA 2DJSA 1A9BB 1FNEB 5CGBA 5E2TL 3WE6A 4B9PA 4X2UA 1SEQL 1UD2A 1F4YH 1BZ7B 1G1CA 2UY6A 1QI3A 1JZ5A 2EO1A 1TVHA 3HI5H 3IDYB 3HN3A 2Z0UA 4YHKL 5IFHH 1QHOA 4K2UH 4ZOEA 5CLWA 3IXAA 4H26B 4DGVH 4FL4C 2NT1A 2X5PA 4RSYA 3VXPB 3I6KB 2EDNA 1NPUA 3QIBA 4MJIE 2NNAB 5FYLH 3RURA 3VFNB 4Y1SA 1IJ9A 1WFUA 2ATKA 4V1DE 3BKCL 5EORH 2JIXB 4PJIA 3RQ3A 1CVRA 3GSVA 4NAQA 1HQRA 4MA1B 4PB9H 3IWVA 4Q6YA 1C12A 1JRHL 4YE4L 3LRLA 4XO9A 2M2DA 3G08A 3NN8B 5IJVA 4JFSA 1TU2B 3PL6B 1IT9L 3ZPDA 4YSOA 3PIQB 5E6IB 4MCMA 3IGKA 3RBGA 3CXHJ 3AG4B 4WEBL 1ZMYA 3L17A 2FWOA 5JZ7D 4P49A 1YY9D 1SQ2N 2H6OA 4PJ5A 1IAKA 2WLLB 1JGUH 3M07A 4XNZB 4XZUB 1NCIA 1KFAL 1F58H 2VR5A 2WKOF 4Z77A 3DX9A 5TF0A 5H37H 1ADWA 2C34A 2G0KA 2J1KA 5E2VL 4Z7VE 1JNHA 4HIJA 1U8HB 2VERN 3H9HA 5F1NA 1FV1B 5HJBA 4HIIA 5E8EB 2EH7L 1JSYA 4EI5C 3O6MH 5I1HL 1ZVNA 2GG1A 1M6OB 5LNEA 1RPUA 4NNYA 1NCCH 1CUOA 1OP9A 4JHBA 5B3JF 3BYYA 1MJJB 4P2AA 1AS7A 1DN2A 1I85C 2F5AL 3FMGL 4HPOH 1CDCA 2H45A 5KAQF 3DO3A 4K94L 4CN4A 2GJZB 3MCG1 3UACA 5GS2D 1OAXH 1LE5B 5JHDE 1T03H 2BHFA 3SGEI 2O5ZL 3LNDA 4FQIL 5FAAA 4LCCA 4V2CB 4HS6B 1FNFA 5CCKH 1BBJA 1KYOK 1FFTB 3BUYA 4WSJA 5HVWA 4KUZL 1FG9C 3GB7B 2EEBA 1LILA 3HC4L 4NLHA 4Y5XA 3G3LA 1H3XA 2V6HA 4HC1H 4KGLA 2H3XC 3HC2A 5L6YL 3VXOB 1MIMH 3GRWL 2WXQA 4A66A 5CCKL 1RU9H 4FQ1L 2DMKA 1AC6A 1MWAH 2BNQB 2J6WA 3DJ9A 3MACH 4GRMA 4PYGA 3SQOL 1MAKA 4G8GB 2V2TB 1OAXL 2YHGA 4G6FB 1A6UL 1EDYA 2IG2L 4MMXA 2HMID 4PJDE 4LLUA 3DX1A 4JKWA 4BM7A 2BIMA 1I9RL 4W9FC 2VZSA 1N3NA 1CXKA 2DTMH 3GXDA 4QRPB 5L2JB 2B4CH 5DJYA 3OKEB 5LN4A 2JKTM 3PQYB 3BWSA 1MCWW 1HCFX 1MFMA 1W2KT 4QYOB 3VFUB 5DO2C 4IHBA 4YR6A 3HN8A 4ZTOL 1V7NL 3KPPB 3A6OA 4XHJC 2W60B 3NZHL 1X7QB 2YGPA 2APVA 2EYSA 5C0EB 3QG6B 5E2VH 4H0LC 3JV5A 4XOBA 1NOFA 3BGMA 3NMEA 3S8WA 5D96B 4BH8B 4WWKD 4H1LG 3ULUC 2WXPA 3PY9A 1G7JA 4X6DF 4Y1AA 1YEEL 2WN3A 3FO9B 4PY7A 4UMSA 5LJYH 1I7ZB 3EO0A 4GRLB 2DM2A 1ZSHA 3QIUB 5AZUA 4ZX5A 3IFLH 5IB3B 5IIEA 4Y9GA 1QA9A 3MV8A 3N0AA 4JFZL 2MRYA 2VAAB 4KZEL 1KXQA 4ODSH 1IKNC 1VB9A 4BCYA 4MNGB 3F7RA 3P3RA 4X7TA 1W91A 4JFFE 5JUEH 4M43L 4M8QB 5D1QC 5F1KC 2JJWA 1L3WA 1U3NA 3BH8B 3TA4D 4UNUA 3VSUA 4PVMA 2HMIC 2Z4QB 3L9EA 2ZUVA 3KWXA 4G9FB 1UKTA 2VN4A 3PQYE 5MENA 1ORQB 1RMFH 1TYRA 1XL6A 3DX0A 3L4YA 1HNYA 4FDWA 1KB5B 1NKOA 1MW2A 2PYEB 3O9WD 2DMHA 5I15H 4E0RB 4HGWB 4L4VB 4QOKA 5DO2D 3MLPA 1CDJA 3UIZA 1HSBB 3H3KA 3MUY1 3QRLA 1SEQH 3EG9B 4YDJB 4X4KA 4YSCA 1X9LA 4MNQD 4LSTL 1BQSA 4OBSA 1YECH 5F7EH 2K9FB 3U0PA 1R9FA 4IBSA 1A1NA 4ANKA 5FA3B 3QK0A 1L7TL 4M61B 1L9RA 4H25B 4R0LA 1K4CB 3VXRD 1VKXB 4R3SA 3HTLX 4G6JH 1NDGA 2OTUA 1I3GL 1WWAX 3LNFA 2YRPA 4XNUH 4BD4A 4K7FA 4FC3E 2HLAB 4N2MA 5FW7A 4G43A 2G2NA 4J28A 1DR9A 2E9BA 3EGSB 1XGPB 3M1BA 4IBZA 2VDPB 3DUUA 5AB9A 4XAWL 3WXVL 4BDVA 5F71A 4D2NA 3ZZ1A 4D8OA 3S96B 4Y9EA 5K9JL 4G8IB 2HKAA 4IU2A 4S2SB 2H6PA 1LP9A 4IGBA 3VI4E 3EJYC 3W57A 3D85B 3H4FA 1SJMA 1HWWA 4UZSA 1G7PA 2VISA 4S0TD 2ZICA 1C16A 2VH5H 4P59H 4MAUH 3RYMA 2HWZH 5C08B 4OT1L 4POUB 4P46B 5CAYB 1T0OA 2BWDA 1NGXA 2ZX9A 4ZDHB 3X3FL 3BAEL 5AEAA 5C0GA 4Z7OE 2KDYA 4R7DB 3AUWB 4TLTA 4FHKA 2NW2A 5LGHH 2XA3A 3ML8A 1E5AA 3Q3GB 2YD6A 1INEL 1FH2A 1KYOJ 1P6WA 1WCBA 4FG6D 4MJJA 2O72A 4MMXB 5J11C 4RRPA 1LO2H 4KQ3H 3ARFB 3OMIB 1PD1A 3N06B 3VG0H 4XP9L 1NC2D 2B5IB 1WH0A 4B7LA 4AK1A 4BUGA 5FGCB 2V17L 1RZFL 1U42A 3IGAB 1CGXA 3UTZA 5DC9B 1EK3A 5CKAA 4YWGH 2WCGA 1IGJA 4AYFA 4UV7L 2CCWA 4MZ2A 6TAAA 3O41A 5FOBB 4AE1A 3M7OA 3T0EC 3OZLA 1L9NA 3V4PL 2J56A 1BOYA 1BZDA 3ZKMC 1EZUA 2Z7ZA 1XF5B 4F37F 3LZNA 1VLXA 3EOAA 5LBVA 4LCIH 3ZE0E 3LIZH 1M71B 3GHBL 3ULUF 4L8SB 3JTTB 3UAJC 3SE3A 4LQ1A 4IOFD 2DYPB 4EXKA 4Y5XC 2BZ7A 1KEGL 2Y6TE 4QHMA 5GZNC 3V0VA 2VE6B 3S36L 3O45B 4MKMA 1DQTA 4OFPA 1LEIA 2J57A 4K7FB 2WJ7A 2JCCF 3QIWD 4U49A 4PP2B 1OO2A 1JNNH 4F80A 3BGAA 5KVFH 4YDKH 1RZGA 1SFDA 2YOAA 5E8EA 4XCEB 2QVIA 3B2MA 1LEGA 5IHUL 2O6DA 3CIAA 4BH7A 4CA4A 2L7QA 3V6ZB 1NAKH 5SWSD 2IANE 2R2EA 5AYUL 1UOWA 2MNUA 2B20A 3LKPA 4H5SA 3LHPH 4LCUA 3A6CL 2YIHA 2WOBA 5JW4Q 5CN2A 3N42F 1H8SA 2XIIA 2GW5A 4L4VA 5I5MA 1BJ1H 2V9UA 4OFDA 2OTWB 4ANVA 4GBXA 4U7KA 3QO0B 1B6DA 1YEFH 1GHFL 5IHHA 1AXTL 2HRGA 4LHUG 5FM8A 5K5YA 2OMYB 2AP2A 3SYAA 3WIIH 2OYLA 5FYLD 1FZKB 2D2CC 2EVFA 2C7FA 2RHEA 2VKXA 3VJ6B 4KZCA 4JLRA 3VXRE 3GSVB 5KSBF 1Z9LA 5C8JA 4X7TB 4PCSA 2VQ4A 5I1EL 5L0QB 2B4CC 3QWOB 4X6CB 1NEUA 3FB6A 4AZUA 4OF5A 2HRPL 2BNRB 3W1ZA 3Q5TA 5IK3B 1C1EL 1TMQA 2B77A 3QIWC 2NXZD 4MQXC 4FQJL 5HHVL 1WAAA 3FPXA 4JFFB 3WELA 3IAGC 2EE0A 5DDHB 4OAWB 1LQBC 1CLCA 4JDZA 5KJRL 1RZIA 2YPLB 3S4SB 4UOZA 4LZKA 4B9ZA 1Z6JT 4BH8A 5JPNA 1M1XB 5EUOF 3ZDWA 5AVZB 2P8MB 1F6FB 4PS3A 1KTJA 2WIMA 2Z4QA 5HI4C 1XCQA 2A6JB 3QZPA 2PPFA 5I1KH 4A2LA 1D7FA 1Q0YL 4FNRA 5CEYA 4G8FB 4KTDH 5BPPA 3OLIA 1J1XL 5E56A 5IJBC 4AGNA 1UH3A 3GSNL 2P24B 1OL0A 1TCRB 3I6GA 3P1VA 2OYPA 1IBFA 1N19A 3TZVD 3D69A 4HWBL 1YYCA 2XXFA 3O11B 4HMDA 1ORSA 2KYIA 2OSLB 3NZSA 3PWJA 4ODXB 5F21B 3WJLA 1G7JB 3DO4A 4Y1AB 3BH4A 2EEXA 3U0WL 4NX0A 1MLCA 1HHJB 4AK2A 3DC0A 3CX5K 2YR3A 2IBZY 1RPKA 3H6AA 4RMBA 3IMWA 3WNJA 4Z78A 2I24N 4WQOA 2E8ZA 5JOPE 1C7TA 3UYRL 1P69B 1TJHH 1QG3A 3F65A 4NPJA 2P8LA 2R15A 5MP6H 5D4IA 1ZA6A 1CFQB 3GB7A 4JZJA 1Y6KR 2V5MA 1E43A 1N6UA 3IFOA 3QFDB 4NSKB 4XMLH 4XWOC 5F1IA 5F7BA 1FL3B 4OD2B 2UZIL 4XMXA 3CHPA 5EU3B 4OF0A 1J0IA 3UMNA 1HXMB 2ENYA 4U1NB 4YBQC 2CR0A 2E7LA 2ADIB 1AXTH 3AMKA 5DZLA 2X70B 4ZNEE 1B88A 4ZMVA 5IT2H 3ARBA 1N70A 4L29A 2XKUA 3JZYA 4Q89A 2AITA 4NQXA 2MKLC 5JIQA 1K5NB 1J8SA 2CHNA 2NY2D 2VT0A 3VFTB 4TQHA 5CCGE 2Y5TA 4LDCA 2VRAA 1G7LA 1MJUL 1KJVA 2VC2L 5SX4I 4IK7A 1MUJA 1UKQA 3HPJA 4UQ2B 3APMA 3O3UN 2G5BA 5DI8A 3RA7L 3TASA 1JN6B 3CQQA 3QRGL 4DQOH 2ITDB 4BFJA 5DJZA 5DJ8A 1P4IL 4WV1C 1UA6L 1S7TB 1HC1A 2XV3A 3L3KB 4HHAB 2FHBA 4TNVK 4L3CB 2ITEA 5C9KA 4KK9D 4NQED 3S36X 1AIFB 2K45A 3RGBA 5KSUB 3NJXA 4X9GA 3SKMA 4PJFA 3QJHB 3I3EA 3QWRD 2R2CA 5I30H 2Y5QA 3ESNA 3KCPA 3L54A 1DN0A 2ED8A 1TF4A 4EQ2A 4KHTH 2CIKA 3H9SB 3MFFB 3O8XD 2LOEA 4TUJA 3UFIA 1EQWA 3HS0C 4G8GE 4TVPD 3U4EB 5JO5A 4XMPL 4G42B 3VG9C 5CBAA 4NXKA 3QCUH 3VX1A 3CLWA 1Q9KB 5E2UH 3TP4A 4FP8H 4AL8C 3ECBB 1WZKA 1UENA 1UGKA 3HCVA 2Z34A 3MV7A 4BFIB 5FLVA 5CINL 2BVQB 2OMWB 2CPUA 4DP2X 1N26A 3UTTD 3FT4A 1F0LA 4HWUA 4W6WB 5CUSL 1QACA 5KYXA 3BMVA 2BNUB 4OI8A 2EDHA 1OD9A 1UACL 3MOAH 5D2LF 2VC2B 3U36B 3WJLC 3WFZA 5I23A 2GPZA 5HSFA 4PJ6A 4G5AA 3KDPB 2Q8BL 5D7IB 1DSFL 1P9MC 4I1PA 2L7UA 2H3NB 5C0AE 5F3FA 5EC2B 3QHFH 4H26A 1NOLA 4PJGE 1IZJA 4OV5B 4MLSA 3PJLA 1S7QA 4OU3A 1BZ7A 2IDSA 1KENL 5D7SL 3TYFA 2CGRH 2WHVA 1PZUB 1ILSA 1V3LA 2PN5A 4PRHD 4KDVA 2VDOL 2EDYA 3O2DH 1U2CA 1PZ2A 2JELH 3QPQD 3SDDB 4AWJC 1U6AL 3AT0A 3BAEH 4AGMA 5CZKA 2Z1KA 3SDCD 2IC2A 3NK3A 1XGYH 3F5WB 5TQ0L 1RZKL 5I1AA 1AAJA 2WCPA 1CI5A 4ZUTA 3AMLA 4YBHA 2VLRA 3GSQA 3VWJC 4LEOB 4Q9QL 1KCSH 1A7PH 4WO4A 3CN3A 3CHXA 4HUCA 4L1BA 4QXVA 5I17A 2XNAA 3PHOB 5B8CB 4N3TA 2HG5B 5EBLA 5DK3A 2AW2A 2ZX5A 5AYTA 3W3BA 5E95B 3WEAA 3PJNA 3MA9H 3DOSB 2D03L 5IK3A 3V4VB 3FQUA 4YXLH 2GCYA 4P5MB 3DGDA 4JDEB 3SBQA 5K1JA 3HUJF 1E2WA 5HYJE 3TEUA 1M3JA 4X7SL 3GSUA 2A4EA 2ZPKL 2ZE0A 1SHWA 1V54B 3ABZA 3I50L 4ZG1A 5FO8A 3T2OA 5DZ9A 5KYNA 3RL2B 3VD5A 2DM3A 3K2IA 1E50A 1A21A 1YQVH 4L3FA 1E4XH 3PWLB 4WTQA 2FQGA 5HHNB 5F7YC 4M93C 2AZUA 3QO0A 2EDKA 4X98B 5FPIA 3B9KA 4WHCA 5J5EA 4QDGA 1NMCC 3N43F 4XC1H 5TGBA 3VFPA 2ALAA 2IAND 4FABL 1NUFA 4OLXL 4B7IA 5ILTH 4YSPA 4PVLA 1FVCB 1E2VA 1RMFL 1GS8A 2PR4H 4PRIB 2IOIA 2X4UA 3SPGA 3FFOA 3KH3A 4FQXA 5EEYA 3RI5F 2ZQKA 2UWEE 3ASNB 4H88L 4Z7UA 3NCEB 3F8UB 2BOBA 2FLBT 1A5FH 3HFML 1RV6X 4S1QH 1DQJA 4C4KO 1MWAB 5CLTA 3NCJL 2GBVA 1ACXA 3BVDB 1WIOA 5ICXB 2HVJB 5I26A 4F15B 4B9GA 2CO7B 5F9AC 4JRWA 1OOWA 3KDMB 3H42L 3U82B 1XIWD 1ES0B 3AM8C 1X4YA 3KXFE 4PG2A 3P11H 1CDGA 1Q9WA 1YEHL 4ZUWA 4IMLA 5MI0C 2JQZA 3BUBA 2WW8A 5IG7A 1E8ZA 5EC2A 3WSQL 4MAYB 3X13A 1H6EA 2EDRA 3CH1A 3DMMA 2XWBA 3QJHA 4TRPL 5F3HA 5HGHB 4YDVA 4ODWA 3BOVA 2W65A 2J20A 2YZ8A 3FQYA 5AOLA 3QS2A 1IGTB 1UZGA 3KNBA 4EI6A 2JKIS 4AT6B 3LYRA 5IOPB 4APXB 4NQEA 3BKJH 4TUOA 4E68A 1S7TA 2D7TH 3VMNA 4Y2DB 4TNFA 1M4KA 1JHLL 2V5TA 5D71H 3J07A 4I85A 3DKHA 2W59A 3TT1H 5C0FA 5A6IA 4Q9BA 3HJEA 4NQDD 5E4IA 3NVQA 5C07D 1L6ZA 2WIIB 3I3DA 4XXWA 1EA9C 4DW2L 2P7TB 1JPFB 1ZT4A 2AZAA 2CBMA 2YD8A 4YAQB 4F33A 5FF6A 4LCYA 2Q7NA 4HQQL 5JO5B 2NR6A 1UWYA 1KCRL 3BZFB 4O58L 4N5UA 2VLKE 1G7IB 3QFDA 1TCRA 5LBSH 3MBWB 4IGBC 1GMEA 1QFWI 2EE2A 4KXZI 1LK3L 1QPKA 2UY7A 5CP7A 4KJWC 2F5BL 2QSVA 4TQEH 1FL6A 5LXGH 3QUXC 4AV5A 4KUZH 4OGAD 5TK2A 4JY6B 3JWDL 1OCZB 2N01B 4LOUC 2VW7A 2NY3C 4M3HA 1MAML 1BDYA 1RZJC 4KTEL 5TE6H 2IPKA 3MLSL 5D1QD 2HX7A 3ZGIA 4FQ2H 1JN6A 1KWGA 1XF2A 3ZDYB 1OSEA 1B4JL 2V3EA 3DX6B 2BVTA 3MREB 3VGBA 5IVZA 1JI2A 2KLTA 1Y1DA 2IH1A 1DVYA 5C07A 3MLZH 2FIKB 2XVGA 2YPLD 4YHLL 2GIMA 3LPFA 4Y9BA 4KTGA 1N5YL 3LIZA 2B2XL 3KLHC 1J5DA 2GKIA 2IO5A 2FEEL 4U1NA 2NX5B 4EZJA 4MA3A 1KSRA 3VMPA 3OXRA 4IMKA 5I0WA 1ZHNA 3EO9L 3MUUA 1A6TA 2XG4B 3PABA 1G7HA 3MLXL 2O5XL 3AXIA 1P2CA 5AKRA 1KFGA 4Y5YC 4O02L 2ZCHL 4ODVH 3MLTB 1OE2A 4L1SA 4LBAA 4JPIB 1X4XA 1J8KA 1CLYH 3WFCL 2XHNA 3BHBA 5J8OA 1O9WA 2J4WH 4ZOAA 2X38A 3GSRA 1F3RB 1UFUA 3SD5A 3L9BA 3MRIA 2D2OA 3VXUB 1DP0A 1G9MH 3BPLC 1JRHH 5HPOA 3CZLA 3IT8D 4M1DH 3AQXA 1H3PH 5KTEH 2QELA 3MRGA 3GMRB 4X7FC 3FSWA 1AY1H 1DVFC 3DJRA 3ZIYA 4Y19E 4EUPA 2YPVL 4YIQA 2V2WA 5DS1A 2NY1D 4KJQC 2P5EB 1MCOL 1PLCA 1KTCA 5GRZA 3AS2A 4P9HC 2ARJB 2F8VA 1YO4A 4N4YB 5HHXH 1DCEA 1B4TA 5C0ND 5T1LD 3DGCR 5T5NG 1SXZA 3FTVA 4OZGE 1VFAA 3UTSB 4LAJH 4XAKE 2CK2A 2VUOA 4F91B 1OGTB 3D7PA 5ABAA 1WHOA 2LT9A 3VXUD 4PGCB 1XGTA 1YUHA 4CC0A 1YRKA 5DA4A 4YL9A 4DGYH 2DS4A 2HH0L 4GW1A 4ZD3L 3CVBA 1R5WA 1HT6A 1A7OL 4PUBL 2ZXWB 2GSGA 4WWPA 3IDIB 2E9GA 3FO9A 3GJFH 2VXSL 1LO3L 1QUNA 1F1AA 4UIMA 2JQAA 5CMAB 1X5FA 1R47A 1Z3GH 1T66D 3GZOA 2P5ED 1A7PL 4CDGC 4D9LH 1E8XA 1I8KB 3P2TA 1O7VA 3JWNE 2NW3B 3UPRB 3WHXA 5CGYC 3D39E 4FXTA 4NM4H 1SF3A 4I0PB 2WMPB 3AGWA 2VXQL 2NY7L 3AREB 4Z0XA 3KPRE 1ZLUK 5KSBA 2QDWA 1G7PB 4NGHL 3WIHA 4LPTA 2MCAA 3G5XA 3D87B 3VWKA 1Z5HA 3W9EB 3GPEA 2BZDA 3CV5A 3SCMD 5E8PA 5IG7B 1PZ5B 1Z9OA 3WMQA 3KG5A 4XPHL 2F18A 4IOSA 2FD6L 1WAAF 3PP4H 35C8L 1U8QA 3NH7L 1QLEH 3PWUA 3MOBL 8PAZA 5DHVH 1UGNA 2HT4C 3ISWA 3WHE0 4PTTB 3PNWB 4QPEA 4E42A 3KPNB 5DUMH 4ETYA 4M02A 2FSEA 4K4KA 4JPKL 4HUUB 1WISA 4ZNCD 4KO7A 3QXUA 2G9HB 3BEVB 4Y2DA 5DC4B 3VXSD 5E2WL 1HX0A 3HOGA 2WLMA 3D48R 1MDAA 3T2NL 2KH2B 3D9AL 2X88A 1A7RH 2O6CA 1VACB 1C16B 2A5UA 1QLFB 3HS0B 4NT6A 4GG8B 5FO2A 3V0HA 2AXGB 1KB5H 5IB5A 4AKQA 5F3HB 5GS1C 2DLFL 3MSPA 2LR4A 4YLQT 4F5CA 1FO0B 4ODHH 4NIYE 2QMKA 1BD2A 2ICWB 2UV3A 3CUPA 3HNSL 5F70A 4B0MM 5I1IH 2YKLH 3BAIA 3IDUA 5F97E 4FP8L 4NC2B 1ZHLA 2Y1AA 5E2UL 5KBLA 3FT2B 1ES0A 3F05A 2ZYIA 3N1MC 3QUZC 4RAVB 3Q1SL 2F54E 1F4WH 3AY2A 3P4NB 3GK8L 4KHTL 3FCSB 3DVIA 1FNLA 3GT6A 1DBAH 1TTGA 4FLSA 3QHZH 1R5WB 1OM3L 1JWSB 1DQJB 5I18H 3BLPX 1XQ4A 2EJ1A 3P02A 2YMOA 2DEXX 3MA7A 5EO9A 1A47A 4NHUA 4BKLA 2FJGB 2JIXA 3FQ4A 3V0DA 1ZK9A 2IH3A 5A2BA 2OSWA 3D18B 3D0LA 1GCFA 1BD2E 2A6DA 2YD1A 2XY2A 3MO1B 1OAZL 1DJIA 3PWPA 5IVXB 5DVOA 2EO7A 3GK8H 2R9HC 4GSXA 1ED3A 5I8CB 3AG3B 3QJFA 2GBTA 4Y1AE 2FJHA 3ESPA 4R2GB 1Y6NR 3UG5A 4Q9RL 1JPST 2FB4H 4LEOA 5IT2L 1JF6A 1MRCL 5FFLA 1XAKA 5EUOE 4PJ9D 2ZUYA 1HKLL 1XCXA 1AOHA 6PCYA 2CUIA 1Y18B 2J8UB 5LAPA 5CGMA 2ADYA 2YMTA 3QW9A 4ELMB 4AIOA 1KY6A 4UAOC 4ANUA 2K7QA 2X3CA 4PV9A 4XP1L 4NFCA 4DUXA 2QV2A 2MHAB 3MRIB 3TEZA 1I4FA 3FB7A 1YJDC 1T21A 1R0AL 5E2WH 2B8OT 4HUXB 3IJEA 3MRBB 1VZHA 1XH0A 2ENQA 2N1TE 3EO1A 3O9WB 4XMKH 1FHGA 3PAYA 1T4KB 1UWXK 3TJEH 4APQB 5D9SB 2HG5A 5EBLB 5D93B 5AUMA 1OALA 2QVMA 3ZXAC 1R3JB 5ITFB 2XBTA 1CGWA 1HOCB 3H85A 1T04B 4NEHB 4R4BA 5LWYL 2V7HA 4WY7L 5D5MA 3TN0D 4FI8A 2M26A 2Y3AA 4JQXC 4RISH 4TNVF 1DQMH 2HPTA 4KFZC 4YR6B 1GYAA 4S0SD 3BGFC 3FU9A 1U8LB 4KVPA 4MXWH 1QYGH 1HCYA 1MXGA 4B9JA 1E3FA 1DZ0A 1SNRA 4LKCA 4UT7L 3LSOB 2HN7A 4E9TA 1DQML 4F7CA 4RISL 1DUYB 9PCYA 2YC1A 1WDAA 3FU8A 3L4CA 3QJTB 2CO1A 4PJ9C 3BZ5A 1QUPA 3Q2CA 1UKSA 2FX7H 3UZQB 3SPIA 3ZKXC 5J1SC 3ILPB 1QPXA 1Z3GL 2CLVA 1TJGH 5IHLB 4UTAL 3OJMB 4AMXA 5E0FA 5JNYB 2HRPH 4WKXA 1WE5A 1HZLA 2B1AH 1IKOP 1BFTA 4WJ5B 4KKZA 1TYEB 1PX3A 4MD4B 4PP1C 4XMVA 4DPAX 1ZHNB 5KSAA 2ZXCA 4J7RA 3IFNH 1H8NA 4UILH 1IM3B 4DF9A 4MD5A 1ZLEA 3WIIL 4DFHA 3QZOA 3KD4A 3CH1B 1S3KL 3DMMB 3W9DB 3G5YB 4U1KA 3QJUB 4DEPC 4ZNEA 4F20A 4HXAH 5DEFA 4F58H 1MW0A 5HHQB 3MROA 5KYUB 4TLUA 3HS8A 3KVQA 4FZ8H 3ZYJA 5DWPA 3R18A 5KEZA 4PJBE 1RK1A 3L9YA 1JE6A 4WTXA 4ZSOB 5ISZE 3AAZA 3FU7A 4NZUH 1U9KA 5DC0A 1A2YB 4Y89A 2CA3A 2ED7A 3RWIA 4Q52A 3RY6A 3ZRCC 1SOSA 2DF3A 4OJAA 4F7MA 2BPBA 4WI4A 3VYPA 3EH2A 4JGNA 2GEEA 3QCTH 4R90H 5I66A 2QQQA 1JNHB 4KHXL 5HHPB 1UQSA 3MRLA 2I9TA 2OI9C 4FQQB 3PGCB 1A02N 1RUPL 4QHUB 4CJ1A 3FFCA 5J7CC 3SE8H 4WU7B 5HDBE 1QX1A 3SO5A 4GPVA 1FG2A 4NQCE 4J12A 3VFMB 3KWWA 1D6VH 3EOBB 4PJ5D 5D2NA 1U8KB 2EKJA 3VFTA 1JPFA 2FX9L 2R29A 1BMGA 3L7FB 4NLAA 4OGYH 2YKLL 3CVDA 2DICA 1M2VA 3B5HA 3V4VH 4ZX4A 4P04A 3QFJB 1ZGLA 1KJ2L 4O02H 2EC9U 1AHWB 1CC3A 4Z7NB 3KDMA 4UDTB 1GPOH 3AQDA 2XUWA 3K4DA 3L3OC 4NN7C 4DOHE 4WFEE 3ULVE 2GJ6A 1BGXL 1Q9OB 2P8LB 2K0RA 2FJFA 3T8MA 1WS7A 3RBSA 1SQMA 4NERA 4UV7H 1P0SE 4N8CH 2EIJB 1QPPA 3LKOA 5LLIC 1OWRM 2P8MA 3Q9QA 5BRZA 1ZJBA 3AXLA 3IJSB 4YDNA 2FZ3B 3HHSA 4XP9H 2X2YA 4QRSB 5E00B 1PQZA 5GISH 3FB8A 2J72A 1JDDA 4X6DE 5IWLA 5J57B 2WVTA 2P5WD 5CGTA 2WY3B 1UOVA 4ZFOB 3OMNB 1GZQB 4NO0D 4AYID 1KN2H 4JUTA 4BE6A 4X5XB 2EDLA 3FW6A 3FUJA 1P7QA 4NUPA 2GY5A 3TPKA 1CTNA 3TT3L 2BP8B 3LSOA 5FCUH 3QXAB 1NA8A 1CURA 4Z7UB 4HJ0D 5IQ9B 1LK3H 3MRDB 4KROB 4PQXA 2C7UB 2DLHA 4HUWB 1MJ8H 1WUNT 1AP2B 4MD0A 1U8IB 4QMEA 4V1DD 3V52H 2VDQB 4OF6A 3JQOB 3U4BL 4EEEA 4NRYA 1LO3H 2MJWA 4PJDF 1VFBB 2NCEA 5A7BA 2FATH 4H1LB 3KXFB 4Y8DC 4PJBA 4YN3A 3MMEA 3BQUB 2FL5A 2FO4A 1IU1A 4GXUN 1WA2X 2B1HL 4Q4EA 2VLMD 3HJ0A 4IBUA 1J9SA 3SCMA 2DQCH 4PJ8A 3VD2A 3ISRA 4N86A 2Q2EB 1AZVA 1TZIB 2LGNA 3FB7B 3RWEA 1JHLH 4XVSH 1N0XL 1T7ZA 3PWNB 3ZKQD 3QORD 2NUTA 1NMCB 1WBZB 1I7TB 1F11A 3DX4A 2HZHA 2YFOA 4HUUA 4UMGA 2OXHA 5HHXL 4ECNA 2IQ9L 4V11A 3SBRA 5JXAH 1S7WB 5C2BH 1BBDH 1J88A 1MCOH 5G5DA 2X4OB 3OKDB 5KBNC 1GY2A 4MXQC 1MXDA 3MRRB 4UBDD 1R3HA 3DBXA 3MYZA 3NSDA 3C2AH 3QJFB 4ZQKA 3W5MA 1OGAD 4FXKB 3SPJA 4L3EB 3VFMA 5KVGH 1MVUB 1UD3A 3JWNC 1OKEA 4OB5L 3MLWL 1JZ7A 4E9LA 1VGKB 2NX5D 4GLRH 1NKGA 4RZKA 2IFFL 4FF9A 3W11C 2NUPB 4RGOH 4X99B 1R75A 1UM5L 4WI9A 4A2FA 2EEAA 3UAEA 1YN7A 4PJCF 5JUEL 5D7LD 4D9RE 3WEBA 1PCXA 5FM5O 3VGEA 4PJAF 2R0KL 5EO1B 4XXCC 2DEWX 5K1VA 1F90H 3M46A 2E46A 3NIDF 4MAYC 2AF2A 3INUH 4IGBD 4YFLI 4X83A 1A66A 3M8OL 1NUNB 3IRPX 2D31A 4KVNH 4FD0A 4LLDB 1JNJA 4QLWA 4N3UA 4XC1L 2Z8WC 5FO7A 3FT2A 3P3UA 4HJJH 1MFEH 3LRGA 2GTWB 3C5ZD 3CSPA 3DVNA 1KPUA 2FTAA 3TVMC 1LD9B 1I1YA 2PCPA 4LT7A 3DTXA 4XMZA 4BGLA 5EUKB 1GC1C 1HQ4B 1UT9A 1WBYA 3FAWA 4I4WB 3QDJA 3EUUA 1H15B 5D7LB 3TTYA 2B4CL 2IGFH 5T5FL 4GBXD 3RVWC 1CDBA 2DWTA 4H7VA 2TAAA 4OCXL 4YBLB 4BFGA 3GXTA 3MV7E 1BAWA 2Y7OA 1ACZA 3B2XA 3BW9B 4IKJA 5AALA 4A63A 3TV8A 5ICZB 1YJDH 4W9DC 5FM4A 4BA0A 5BV7B 3PYCA 4MWFB 4RMSA 3DMMC 5AW9B 5KYUA 1KIPB 3G5VA 5FXCH 5T3ZH 3RVXD 2EDFA 3V52L 5H37G 4XTRC 1WT5A 2F5BH 3C5SA 3EJCA 2AJ3A 3QUYB 4LVNB 4TQEL 2AMGA 3Q43A 5ACLA 1K8DB 2D3NA 5FYKE 3R0MA 5HYIA 1DQQA 4HUNB 1EEYB 3EG9A 4YDJA 1QP1A 3VB8A 3S96A 1QI5A 3B56A 1EGJA 2CGRL 3WY1A 2APBA 1VPOL 4H0HB 4OZ4A 1CBVL 1OAUL 5AOKA 1KEML 5DJ6A 5HD8D 2VR4A 9CGTA 2EDQA 4JKPH 1MSPA 3PWJB 4ODXA 4WKZB 2OTUB 2FQDA 1TQTA 2QVFB 3RVWD 2YUXA 1YMMB 3MBXH 2NXYB 4CU8A 3ULUE 4WZ9A 1FVEA 4N8CL 3NZ8B 4H8WH 4RZCA 4F9LA 1DJSA 4QF1B 2R0LH 1T83C 4ONHB 1R3IL 2C9UA 1QLEB 2MQCA 2MSPA 1MY5A 1OGTA 3FRUA 2PWFA 2DKUA 1ZANL 2JXMA 4HT1L 2UXGA 5FGSA 1HAWA 3NJIA 5F44A 1W0YT 4TNEA 5B21A 3OQ3B 4MA7L 3QEQB 4DO5A 1E4KC 4X4MA 2Y06L 3J8F7 2V8LA 4J3OG 4XHQA 2FJHB 1PY9A 3OZ9H 2ZUUA 3DVGB 3OR6B 4ONGL 4UAOB 1XB6A 5JPMA 3L3OA 5ANHA 3DIVA 2JTYA 1A1MB 1O7SA 2WB1A 3GJEA 5ELIA 1AR2A 2HJKB 3HB3C 2Q9OA 4UYQA 4FE9A 2UY7B 5DS2A 4ELMA 4EOWL 3QCTL 3D39A 4IHOA 1I1RA 1A7QH 3WAJA 4N28A 1O6SB 3UC0L 4M00A 3LZOA 3AU0A 3FU0A 3BUPA 3K46A 5FYJU 1U33A 3I85A 4PWGA 3L1EA 4XZ4A 2EZ0C 1PG7W 2E8YA 2DQMA 1EZVY 3LNIA 5EZIL 1M57B 5I1JH 3IDGB 4NKMB 3LMJH 4BK8A 1JRHI 3MLTA 1UZ6E 2F0CA 2FLRT 2WNGA 3DPBA 3BAJA 1FJ1B 4LSRH 5DMIH 1EHLH 5IM7B 1NEZG 2QFPA 3HVDA 3A47A 4P4RA 4JPVH 1BAGA 5JTWA 1KLFA 1IGYB 3D0VB 5G4NA 2KDGA 1GVIA 1HXYA 1JPEA 3NIFF 3C5SB 1YAIA 1YMMA 3NBNA 2G2RA 2EYTB 1GCYA 1XHHA 2Z8RA 2F1AA 3DJTA 4DGUA 3RDTD 3TH3T 5EWIH 3PNRB 1EFXB 5DYOB 3UTTA 3TBSA 4RAHA 1SXBA 1WFIA 4LPWA 5J0BA 4OZIF 4L1TA 3VD3A 4F2ME 2JJUA 3BC9A 4GAGL 3EW3B 3N9GL 3SJVE 1ZVYA 2IEPA 3ZDZF 4C4UA 1CDIA 3COOA 2IDUA 3B9AA 4JE0A 4TVSa 3TBCA 2WUCL 3ZZQA 3PXLA 4HFUH 4TNGA 3QUHA 2FAUA 4NJAL 1KLUB 1TZ8A 3H3PH 2H32H 3HE7C 2KZKA 1U8HA 3FN0L 3LPPA 3NA9H 4TS6A 4QI3A 2LFEA 1R24A 5I82A 1QATA 1URLA 2PCPB 4NOBA 1YHPA 4PJ7A 4EDXB 4LSUL 1DJWA 4ZQKB 2IPUG 2RAMA 4F7EB 5TJWK 1IIKA 3S3SA 3E3QE 5G5DB 3F7YB 2VKWA 1IAIM 3K1KC 3HN5A 2RTTA 3HRPA 2N4IA 2OW6A 3MUGB 3HZVB 3RX7A 1XGQA 1BQHG 2CUMA 2OPCA 1P53A 4NCC2 1X5JA 4QXUH 2NYYD 2P5WB 2Y2WA 3ETSA 1FZJA 4PS8A 4PLNC 5AAPA 4XP1H 3MCKB 3OB8A 4KX8A 3TL5A 2JIXD 1M7DB 3BAWA 3K4ZA 2XWJB 3TF7C 4HIJB 4WUUE 1IX2A 3KL3A 1ETB1 1DQVA 1E6JL 4ZO6A 4L37B 4NZDA 3EOYG 2A77H 3VXPA 4HIQA 3S3DB 4LIQH 1G5AA 4Y16B 1MRCH 1MVUA 3WS6A 3ABGA 1T6VN 3EAKA 3NCCB 3MLYL 4G8IA 5ESVB 4E9SA 1CMOA 1PDKA 1FZMA 2NNFA 3P0YH 5HI5C 3VD7A 4FQHA 1T6WA 5I17B 4KI5D 4PJXB 1N0LB 2I25N 4Y1TA 3DUHA 5F7KC 2JJSA 3PL6A 3LDBC 4E5XA 5DHYB 4WW1A 3VFGL 1IGFH 3F85A 5I1AB 4C8XA 1T20A 2IDFA 4EPSA 4NAJA 1YPZE 2X89D 2AK4A 4JE4B 4HZLB 5E2JA 1HYSD 5BVPH 1MRFH 1I9JH 1H3TA 4E36A 4QIRA 1GGUA 3STBA 3VFGH 2VISB 1KXVC 4N6QA 4NNPL 2C4FU 5DK2B 5L8LB 2X6UA 3TYFB 4A7TA 1CXFA 2WYIA 1WHPA 5DFVC 1MCJA 3ZDZB 5EBGA 1NANI 2B15A 4U1SA 2OK0H 1T1YA 3LN9A 4Q0XH 2J1XA 4WO4B 2H3NA 4DFIA 3AJ7A 1QFOA 1OPGH 1RP8A 5HHME 1D5IH 1TO5A 2IBGA 2ED6A 5C0CD 4OGZA 3TCLB 3HNSH 4PJEE 5KBKA 2WKGA 3GHBH 3VXQA 1NWOA 1IKFL 3I6SA 4LMQE 1BZ9A 3AT9A 1SHMA 4L1LA 1CQKA 4OZFA 1V3KA 3SDAD 4HJEA 2CM6A 4NQUA 3SDDC 1MFBL 4DP0X 4M8QA 2VJ8A 4UINL 2M83A 4OCSL 5ISZB 1TZIA 1PY0A 3KMDA 1GL4B 5CHNB 1U2YA 4QJ4B 2AV1A 2DIAA 2ZONA 1BYOA 4MNGE 3VI3B 1BVLB 2EECA 2A3TA 5TDPA 4NWTH 3SQRA 1RJCA 5J3HC 4PJBB 2WYHA 1RUKL 2V9RA 3MOBH 1NEZB 2PR9A 3QFJD 4U1MB 1OTUD 4X5QA 4HWBH 1EAPA 4PV8B 3ULVF 1DQDH 1L0PA 3ZR5A 4QR7A 2P44B 1LP9E 2HSIA 5LGHL 1UYWH 2NY4B 5T1KD 5LUMA 1MDTA 1FNGB 3N55A 4JHWH 4PJAB 1IEBA 1RSFA 3X11B 3UMTA 1E7VA 4MJ5B 1NGPH 3CWGA 4KKQA 2PYFA 5HHMB 1DDTA 5AVYB 5J12C 4DKEH 2X4QA 4U6XA 1GJUA 3U7YH 4JPWL 1PGRB 2BVQA 5ACMA 5TDNB 4WNSA 2DWYA 2K6ZA 2WK2A 2Y7QB 4N0UA 1L9MA 2Q2LA 4TLSA 5L2JA 2H1LM 4OM0H 5ISZD 5ADPH 3MV9E 4PIBA 4BYHA 1I7ZA 4XGZB 3CVIH 4PN6A 3ZHKA 1XF2B 5I73B 3GD1C 4RA0C 4F57H 4M7ZC 1ML0A 2Q3ZA 3OC5A 3H6JA 4MHHI 4ZUVB 3DUSA 4AIZA 1TVBB 5F8QC 5D7IA 4DH2A 3WG7B 2EYSB 2N1KA 2HX9A 4OZHB 4OJCA 5JZ7C 2KT6A 2ISDA 3RVTC 3VFVA 3MJ9A 4WEEA 4X5RA 3W82A 3CSBA 2FLMA 3ZHFA 3IMBA 4PD4K 4B9CA 3SHSA 1GC1L 4FNTA 1YECL 2ATAA 1GHFH 2CLZB 4LPVA 5FS5A 5IREA 1UH2A 3L3HB 3VB9A 5AVXB 2YD3A 2WO3B 4HU8A 2VDQH 1R3LB 3LB6C 1DFXA 4PJDA 2I07A 4KOCA 3CC5B 3QXDA 4OUOA 1IC4L 1T22B 3DYPA 3KZ8A 1E4XI 4X6DB 3AC0A 3RWJB 1R5VB 3GNML 4CNIA 2EP6A 5CJOL 5E1AA 4Y9FA 5A16A 4OGQC 2XTJC 2GC4C 3EYQD 4QY8B 3CQPA 4CMHB 1S8DA 4HSQA 2CUAA 5FECB 5CIPB 2Y1VA 4JFEA 4C56B 3MUZ1 5SX4H 1IGTA 3CFJB 1CU4L 1XCQB