1SN2A

Crystal structure of sea bream transthyretin at 1.90a resolution
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
118
structure length
118
Chain Sequence
b'CPLMVKILDAVKGTPAGSVALKVSQKTADGGWTQIATGVTDATGEIHNLITEQQFPAGVYRVEFDTKAYWTNQGSTPFHEVAEVVFDAHPEGHRHYTLALLLSPFSYTTTAVVSSVHE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords transthyretin
publication title High resolution crystal structures of piscine transthyretin reveal different binding modes for triiodothyronine and thyroxine.
pubmed doi rcsb
source organism Sparus aurata
molecule tags Transport protein
total genus 25
structure length 118
sequence length 118
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 1sn2A00
3A4FA 4TKWA 3P3TA 4N87A 3U2JA 2B9AA 4PMFA 1QABA 4PVMA 3I9PA 3KGSA 4N86A 1SOQA 3IMTA 3U2IA 3GS4A 1ICTA 4TQ8A 2QPFA 1BMZA 4HJTA 2F8IA 1E5AA 3BT0A 3D7PA 5AL0A 5FW6A 3HJ0A 5CLZA 5JIMA 2B77A 3GLZA 1OO2A 3DJTA 5JIQA 1QWHA 3FCBA 4TNEA 1F41A 3CN0A 4PWGA 5E23A 1DVXA 3A4DA 3I9IA 3DJZA 2G4GA 4HJUA 1BZ8A 1E4HA 1DVSA 4MRCA 1TLMA 2QGDA 4IIZA 2QGBA 2GPZA 4WNJA 1G1OA 3P3UA 5JIDA 3Q1EA 3IPEA 1TSHA 2TRHA 2TRYA 3IMUA 4TM9A 4PM1A 3GPSA 4WNSA 4PWKA 4YDMA 3CN2A 4AC4A 4DERA 4I85A 4DEWA 3OZKA 5FW7A 3IWUA 4TL5A 3IMRA 4TLUA 3IMWA 5DEJA 3OZLA 4ANKA 1BM7A 5L4MA 1IIIA 4IKLA 4HIQA 1BZEA 1GKOA 1FHNA 3CN3A 4TQIA 4TLTA 3DJRA 2G2NA 2H0FA 3CBRA 3ESNA 4TNGA 1Y1DA 4TL4A 4Y9FA 5BOJA 5E4OA 3IWVA 1SN2A 1SN0A 2FLMA 5K1NA 4PWHA 3P3RA 3GRBA 4IKKA 5AKVA 1THCA 5AKTA 1KGJA 3CFMA 1THAA 2B16A 3TFBA 1RLBA 3DGDA 4MASA 2G9KA 4N85A 3M1OA 3NEXA 5TTRA 3BSZA 1TZ8A 5A6IA 1IE4A 1IIKA 4KY2A 4PWIA 1ETB1 4FI6A 1BZDA 4ABWA 5CN3A 3CXFA 4PWEA 3SSGA 4QXVA 4ABUA 4ABQA 1TTBA 2QGEA 1TYRA 2G3ZA 3NESA 1TTAA 1IJNA 4Y9EA 3IMSA 5CNHA 4I89A 1DVYA 1ETA1 1U21A 2G2PA 3CFQA 3I9AA 1DVTA 2H1XA 3IPBA 3KGUA 5FO2A 4DEUA 3DK2A 4TNFA 4DETA 4HISA 5E4AA 5L4JA 1TT6A 4TQHA 3GS7A 1X7SA 2ROXA 1FH2A 5CLXA 1ZCRA 3FC8A 3P3SA 5AYTA 3GS0A 4AC2A 2WQAA 4ACTA 2B15A 5K1JA 3D2TA 5HJGA 4PWFA 2PABA 1Z7JA 2IGLA 3DJSA 2G5UA 3GRGA 3A4EA 4YDNA 3TCTA 1SN5A 1TTCA 1DVUA 1F86A 1X7TA 2ROYA 1GKEA 4FI7A 3CN1A 4IK6A 3CFTA 4PVNA 1DVZA 5AKSA 1KGIA 5FW8A 4TQPA 5CLYA 1DVQA 4L1TA 1ZD6A 4HJSA 3DK0A 4DESA 3ESPA 5L4IA 2G4EA 2QGCA 1E3FA 2QELA 2B14A 5CR1A 5IHHA 3B56A 3NEEA 4IKJA 3DIDA 2FBRA 5EN3A 4L1SA 3QVAA 4QYAA 4Q14A 5AL8A 2GABA 2G3XA 4PVLA 3DO4A 3KGTA 4TLKA 2H0JA 2NOYA 2H4EA 4FI8A 4PWJA 1SOKA 4D7BA 4I87A 4Y9BA 3CN4A 4IKIA 4PMEA 5DWPA 4QRFA 4WO0A 4Y9CA 4Y9GA 5EZPA 5CM1A 2F7IA 3IMVA 3NEOA 1TFPA 1TTRA 4IK7A 2H6UA 3NG5A 4MRBA 4ABVA 5L4FA 3W3BA 3CFNA 3ESOA 2H0EA 4TLSA
chains in the Genus database with same CATH superfamily
3QCTH 4NFCA 1XQ4A 5D1ZI 3FTZA 3VDBA 1JPEA 4AQ1A 4WI4A 5I1AB 1FVCA 2VMCA 3TBYA 1K2DA 5H94A 2R4RH 1JPTH 4S11A 2X4RA 5A2KH 1AGDB 3LKSA 4XI5C 1UASA 3TYGL 2Y36H 4QY8B 1BJ1H 5TPWH 3HI1A 1MNNA 5LGJA 5CILH 2GCYB 5FPIA 1DBAL 3FU5A 2F7QA 3MRCB 5DVOA 4AIZA 1PTZA 5CHNB 3RGVD 4EUPH 1XGPA 1A7NH 5E6ZA 4GW1B 4IMKC 3MRJB 2V8MA 1ZT4B 4FQXA 1KPUA 1IAKA 4K71C 5FW7A 3TJHD 1T3FA 1EEZA 4HX1A 5EH1A 4W9IC 4XB7A 4UAOC 2R51A 3GSQB 2UX6A 2OMYB 4GQPH 1ZA3A 1U8CB 3EJYD 3KAAA 3T9WA 5GGRB 4GQQA 5IHBA 4G6AD 3IPFA 2F74A 4WUKH 2AP2A 4NKDB 4OCWL 5KVDH 2X6BA 3OKOA 3V0EA 4N2GA 4MSWA 4JO8A 3LZRA 3NPZB 1JXFA 4DEPC 3PP4H 1OCWL 5ADPH 1NCUA 2J8OA 4Y2DA 5BJTB 1XR9B 5HYJD 3SKNB 4K3EL 1PYWA 3HZMA 5L9DL 4MAYB 1Z3GH 2NY4B 4Z7UE 1HJCA 4OM0L 4L4VA 3APDA 1VDGA 5CLXA 5AYTA 1YNKH 3VFOB 5IFHH 1CFSB 2BNRB 5GRXG 1SF5A 5HI4C 4FX5A 1LXMA 1LK3H 3U30B 1NIEA 3ZLQC 3SKJH 2ATPA 3BP6B 2K6YA 3FRUB 2H6PA 2EUVA 3MREA 1O7DC 4ZTPH 1D3CA 3NFPB 1YEHH 2H2SD 3KYMB 3PIQA 4N26A 5JOEA 1XMEB 1J5OH 4NQCB 1KWKA 2W91A 4MZIA 1OZTG 1JWMA 3IDGA 3TN0B 3RFRA 2N0MA 5BS0B 3MV9D 4QYAA 3KL3A 3I6LD 3RDTB 1O7VA 2MTAA 1EAJA 4U1JA 4ZUWA 1UD3A 2WWNA 1ZS8A 3S3DB 4KO6A 4Y2NA 4PJAE 4UOJA 3B3IB 1KCBA 2AXJA 1T7WA 2DD8L 3C5SB 4CVWA 4OLZH 3FO9A 4GQ9L 2VSMB 4MRBA 4AIOA 3JT2A 5B8CB 1AQDB 3BH8A 3UYRL 4FHBD 3LHPH 3BE1H 4JFDD 4F80A 3BZFA 3KPRA 1DBML 3QIWD 3K6SA 5IB3A 3BXNB 5GGQH 2VXQH 5TE4L 4L8CB 3Q8AA 4H8HA 4ZFGL 1U93B 4G2AA 1BBJB 2R9HD 2PTTB 1A65A 1KXVA 1DSFL 5IGXH 2ZD0A 1PD0A 3NGBB 4NUGL 1NL0H 3C6LC 5DFAA 2CDFA 3S2AA 1MF2H 4XCNB 3ARZA 1AHWA 1I8MB 4AEIH 3MRNA 2J5LC 2XWZA 4N2LA 5F6IC 1VGKB 4I0PC 5ESVB 4FQIL 1IEAA 4L37A 4Q7DA 4GAFB 3LZOA 7CGTA 1KTDB 1WWBX 3ESNA 5JNYB 3BYTA 3IWVA 2PXYD 3F7PC 3NFNB 4LP4A 3U0PB 4NYLB 4F7CA 5FHAH 1JYWA 3K0YA 1T2JA 4ZUTB 1OGSA 1B2YA 3HIZA 1MN4A 1WWWX 3IDNA 5AOKA 2WVVA 4HJIA 4J6RH 4UT7L 3U6RB 2DQCL 2IJ0C 2XV6B 4TTDC 4KVNL 2F53D 1Z1WA 4U4BA 1GPOH 3L1GA 5B3NA 3GMMA 2DQMA 1LEGA 2YBRA 2WQSA 4NDMA 1ZDSA 4OCMC 3GMOB 2CGYA 5C0BB 5EEZA 5J7CC 2FD6L 3FCTB 2E9IA 3GJFB 3QUHA 2EEBA 2KLSA 3DDGA 1TR7A 4NQXB 3QO0A 3BAYA 1U91A 3V4VB 2KUTA 3SQRA 4ZPVB 1X7TA 4ODUB 4Z3IA 2XXMB 1PZBA 1PX4A 1NIAA 2OMUB 1WFMA 3TV3L 4ZXBD 3T1WA 4ATWA 3K74B 3QUYD 2YPVH 3EOBA 1NPUA 3ROLB 2Z7WA 2VE6B 1YEFL 2J57A 3VI3A 3W2DH 4NUQA 3RWCB 4N2DA 5KTEL 4A2FA 4OD1L 3LZQA 5EUKB 5HGDA 5TE7L 3LXUX 3QORB 3UMTA 5ICXA 5FKPA 2G0KA 4AM0Q 4BQ8A 5FHBL 1AD0A 5SX4I 1DDTA 4B53A 3PV6A 2ITCB 2B2XL 3N43B 4V2CB 4YOKA 3KPPA 1HEJC 2O1AA 3UBXB 5IBUB 3BD4A 2VXTL 3FQTA 1ETZB 1JTTA 2P48B 3AU1A 3HE7B 2YFOA 1S7UB 3PPSA 4Q9BA 3CHPA 1QA9B 1HQ4B 2O5YL 5AB9A 2MTPA 3CGTA 3X11B 1F3JA 2ZKMX 2GJPA 5EOQH 1T7VA 3K2MC 4LVEA 3MNZA 1S7VA 3JWDL 3VSUA 3QDHA 2OMVB 2B1OA 5I0YA 5F9DC 3IPEA 1UACL 4YSTA 1KN4L 1XF4A 1FNSL 3DA0A 4PJGF 3ARDA 3VW3L 3ARBC 2J21A 3H85A 2BSED 4ZO8A 4UM8B 5BMFH 4HCRL 5ID1B 1CDYA 2BHYA 3U46A 2R15A 4F93B 4X4YB 1SXSA 2F2HA 1PAMA 3QPKA 4GKLA 4GS7B 4QTFA 3A6CL 5FGCE 2XIBA 4K8RC 4LVNB 4NQSA 5DYOB 3V4LA 1TJMA 1KGJA 3K6FA 4FA7B 5J12B 1QEWA 1T1XA 3UPAA 3EHBB 3ILQC 4OF6A 5CJOH 4EN3C 2WIMA 1Z3RA 2IWEA 4PS7A 2CPUA 2HX9A 2XY1A 3ZE0E 1GC1L 2ZUWA 3PHOA 4PRPE 1VCAA 1A4AA 2NY2D 1JE6A 3HHRB 1I9JL 4H0IA 3FUKA 5I19H 5D71H 3G6JB 5E8PA 4CA4A 1UXSB 4OZIB 3QH3B 3NSFA 4PI2A 1IGMH 3DHPA 5EU4A 5JA9A 2X4QA 1MQKL 2HT2D 2X4OA 3Q6FA 3FOLB 1YEEH 3TNNB 4PGBA 5EOTA 1EDQA 3GSXA 2AI0L 5K1VA 3WXVH 4PTUA 4NGHH 2EE0A 5DLLA 2CHXA 1B6UA 5I74C 1ZA6B 1WIUA 2Z1KA 4EI0A 1FVEB 4LRIA 4E9RA 2J8UE 2EDQA 3M1BA 3BVXA 3MCKA 3N91A 5H37H 5C0AA 4APXB 4HF5L 4Z0BH 5B1AB 1R5IA 3F7VB 1FGNH 3NA4A 1T03L 1I4FB 3PG2A 5DGRA 5DVKA 3THMH 4DP0X 3MUUA 1MVYA 4TVPL 1RJYA 3DO4A 3WXWH 3SGDH 3EJCA 3PGDA 3CQFA 3FH8A 3S37X 3SBRA 5IY5B 4FXKA 1NZRA 3OAZK 4Z7WB 2CLRB 4XMPL 4WUUD 1DHKA 2FX9L 2VZTA 3LRSA 3RWIB 1AKPA 1JMZA 2VKXA 4MCNA 1GYVA 3RVWD 3KGRA 1IKNA 3GTTA 4PQXA 4RFNB 3Q5OA 1TZGH 1Y7VA 1HNGA 1CF8L 2AERT 4WGKA 4TS6A 3UDWC 3ZX1A 1DQQB 3ZSTA 3MA9L 5AYUL 3GRWL 5G4MA 5GHWH 1ZVSA 2MHAA 3U4EA 4NN7B 2QTVA 4U0QB 1WFTA 5SWSD 3K4ZA 2EE9A 1TG8A 4G6ML 1IGCL 5BVPL 1KENL 1OARL 3ZKXB 4NKIH 1LNUB 2AK4D 2H1LM 3KJ4C 4D9QE 2VLRE 1CU4L 4HZAA 3VGDA 2A9CA 4XTRD 1X6NA 3B9VA 4BH7B 5EDSA 5HBBA 4XVTL 4PWKA 1L9PA 1PD6A 3H56A 4DN4H 2EDNA 5C6TL 1WK0A 2BZDA 4MYPA 2QSVA 4XPTL 3QB7C 1OF2A 1XGTA 1RJZB 2AXWA 3DXAA 4DGIL 3TVMB 4HU2A 1G7QA 1NGWA 1E6OH 3WGUB 3HNVL 3QZBA 3CBRA 2VLME 2FR4B 2YHGA 4WWKC 3NZSA 3AQYA 4Q6YA 1M9SA 2JKLA 1INQA 4NCC1 4X99B 3P3RA 4X6BB 3GZKA 4PRBB 1PBYA 3F6JA 2IOOA 2O5XH 4LSRL 1FZMA 2EYRB 2HJLB 1BWMA 4P46C 4ZPTA 3APMA 3WN6A 1GS7A 4UQ2A 1WTGT 3HBGA 3MRKA 2Z0UA 2E4TA 1DJZA 3C60B 1BZ7A 4KKLC 2Y07H 4HEPA 2EH7L 1R3HA 1FBIH 3EAKA 5EG6C 4LSVL 4P4KA 5C9JB 4HISA 1TT6A 2GW5A 4GO8A 3UTSD 3GTNA 3GGWA 2MIZA 1YPZE 1E4KA 1FO0A 3UIZA 3EF7A 3QIBB 4NO3B 2P9RA 2BRRL 3VH8B 2NT1A 5GZND 5F3FA 3QJXA 4N5ED 1OALA 2Q3ZA 5DJXB 5GGUB 2AJSL 5HHMB 1JZ4A 1SJHA 3GJEB 5D4HA 1IB5A 4UUJB 1A14L 3O6LH 1P7QA 1OSPL 2PTVA 3D08A 1UWEL 2W0FB 5F93C 3V7AE 2XZZA 2EDHA 4LEEA 2A83A 4H26A 1EA9C 1LLAA 3QA3A 1FN4B 3DGGA 4ZRGA 5I82A 5D8JH 5EOCL 3HB3B 3RKPA 3GBDA 3I6SA 9CGTA 1FAKT 4OCXL 3EJUA 3QQ3A 3UBHA 1O6TA 1LK2B 4AKOA 5TE6H 3W5NA 3FN3A 2TAAA 3L3GA 4JR9H 3DX1A 4WEBH 4HJGA 1O0VA 5HDWA 3HRZA 4XE0A 3H7BA 2JCCA 3BOVA 1MLCA 2R23A 5JQIB 2E75C 1FFPB 2D0GA 5SWQA 1RUAH 2BSBA 2FUQA 5TF1L 3KBPA 4PMFA 1VESA 3QUMA 1KIUB 4Y1AD 4MXVF 3NQIA 1NAML 3H9SA 4ZFOB 3UBGA 1WITA 1BP3B 4N8CL 4XNBA 4C57C 2EVGA 4AITA 1AQHA 3SDAD 2OBGA 4DKTA 4Q52A 1S78C 3T3MF 4H1LB 3BW9A 1VJSA 4GRLC 2VDKL 1WBZB 4HEMA 3SE4A 2C9PA 2X6AA 3ARFB 4L8BA 3VB9A 4PJ8B 5ID0A 3ULUH 4NQDB 1D2PA 4EIBA 2JKXA 1MRFH 3HG4A 3G5WA 4LEOB 4MJ2A 4BFRA 2BIOA 3C5ZA 4NHCH 4N0CD 4QXTA 1MJJB 1OAYH 4R3SB 5EZOH 4EE2A 4AYGA 3ALXA 2YAOA 2ID5A 4KPHL 4E5XG 1LO0L 1EEQA 3RB7A 3DX4A 2YEVB 2CG9X 3P9LA 4OLYH 1IC4H 4ZTEA 3RVUC 2IALB 3L3DB 4NZRL 2QADC 4KROC 4KMTL 3OAUH 2BVOB 1JI2A 3BIBX 4FFYH 4XAWL 5CEZE 3IDMA 4U1MA 1J1XL 2EACA 4YK4C 1QRNA 1V54B 4Y5XA 2DS4A 3WS3A 3S7GA 1J0IA 4AUYA 1HYSD 1YMMD 1DJWA 4TSAH 5J13B 4K0OA 5MI0C 2UY6B 2HG0A 3F6LA 2HP4A 1L9SA 1NOAA 1EXUB 1M42A 1HXMA 5K69A 4WGVB 1CICB 2CQVA 4A39A 3BRDA 4UWQB 3GIVB 2VYRE 3C2AL 5MENA 1B4LA 3DK2A 5IJKA 25C8L 3MV8D 2R4SH 3R0MA 5G55A 4NN5C 1IFRA 3DHUA 3SY6A 1IKOP 1KT2B 3RQ3A 1A6VL 1CGTA 1ECYA 2Q7NA 1MCSA 1FZKA 3FQWB 2XG5B 3OXSA 1CC3A 1X9LA 2ZOOA 2AV7A 1GVIA 3VXNA 2COVD 2X12A 5FS5A 1II4E 2EICA 1CL7L 3EW3B 3B83A 4AQAA 4POYA 1URIA 3L4VA 1ZT7B 1NGPH 1QFWH 4FNSA 4TOYL 1A2YB 4YGVB 4UNIA 3HFML 4JDTH 3EO1A 3OTTA 1I1AC 1E5CA 1P7KA 2ZKXA 3TFKD 2EVFA 1XF2B 2ZUQB 3KPNB 4J4PD 3AG4B 2Z31D 2ENPA 1KXTA 1LJMA 3BESR 2JB5L 1CMOA 2IV9A 1KTJA 1NC4A 4N8VB 5ETUA 5HY9A 2KL6A 5C0CB 1SXNA 35C8L 4F7PA 2A6JA 3GNML 2VR4A 5D5MF 1A4CA 2C9VA 4K5LA 5EO9B 3VXRA 1NCDH 3SY0B 3ZHFA 4L1HA 5FYKH 4YBHA 1Q72H 3BT0A 1ZLVH 4MXWH 5CLZA 1Q0XH 2FLRT 4A7VA 1RZJH 4Y2OA 3SE6A 2FIKB 4NJAL 4HCIA 4HJEA 1SVZA 3EDKA 2CNYA 2G75B 2YO3A 2ZZUT 1QQDB 1FNEA 1MI5A 5F44A 2VKWA 4R96B 1K4CA 1T5WA 3X13B 1H3TA 1RZIB 5D93C 2BSDA 4NKOA 4PJ9D 3IMRA 2FBJH 4E9TA 3CX2A 2XA3A 1U8LA 3OPUA 3RX7A 3L1EA 2PW1A 1HX0A 1R46A 2AGJL 2RFXA 3RY5A 1IC7H 3HAEA 2LAGB 2VC2L 1N5AA 5A40E 3VXSB 3A6BL 3OAYH 1YSOA 5I24A 4XNYL 5I1IL 4KQ4H 3O4LE 3CMGA 3KCWA 4P23D 2JI1A 3ARRA 4XVUC 4M8RA 1YMHA 3J7HA 4PJGE 4W9CC 4XMUA 5T5FL 5DHMC 3MODL 5IBTL 5BO1L 3MXVL 4FI6A 3BH4A 1IZKA 2MPVA 1NDTA 2PO6C 1NLBH 3NJMA 2DLTA 4F91B 3S98A 3VACA 4Y9EA 2OXHB 1JNLL 4B9YA 1NCTA 3PAVA 4MJIE 2WLKA 2WUCH 1G9ML 3DUHA 4XC3H 5FUZH 3N42B 4OGQC 2X2JA 2XDHA 4ZOBA 1LO2L 1A1NA 1N26A 2J6EA 4M56A 3MLRL 5D2NA 4UU9A 1TO5A 3CTTA 5CP3H 3RTQC 3NCFB 3P30L 2YPLE 2ZPKH 1M53A 2ZX5A 2DYPD 2YWZA 3BAXA 3TIEA 2OJZL 2A4EA 5A2JH 1KB5A 3P0GB 2ZWLT 5EUOA 1XV8A 5C0DB 5C8JA 3W56A 3BYYA 2XIIA 3DWTA 3II3A 1QBBA 3QQDA 4JY5L 2VDMB 1J0JA 4HUKB 3ZJAA 1DSYA 4CADB 3QULB 3DX3A 5E6IA 3CN4A 1ZHBA 5DJ0A 3A47A 4J23A 4JQXC 4X7TA 4AYBA 2FJGA 1JYVA 1DQDH 1RAMA 1NOFA 4RFEB 2CBMA 2VIRB 1H15A 5L6YH 2XQBL 4FA6A 2D3LA 2WVUA 2P8MB 1QLEB 3KYNB 2GTWA 4K7PL 3CZNA 2D7MA 3VFWA 5ISZD 4F7EA 3IMTA 3KDPB 4RMUA 4HMDA 2D2OA 1A6WH 2FL5B 5DHDA 1FG2A 1J8KA 1CFQA 4HJTA 3Q2LA 2VB5A 3ES6B 4H8WC 4U1IB 2EIEA 4Z78A 1SYSB 2LV4A 5B7EA 5HDRA 5BUPA 4CDHA 2P5EB 1W16A 5IVZB 2YMXL 1IGFH 2AJUL 2MKWA 4CJ1A 3VU1A 5KBMA 4L8SC 2R0WL 4P5SA 3BPOC 2IAMB 3BWUC 3S35H 5EMYA 4QRPA 4BE6A 2AQQA 5DC0A 2WZ0A 4AW7A 3DNKA 1IBYA 2E5EA 3V8OA 1T6BX 4KZDH 3QG6B 3K2IA 4Q58C 5H8DA 3X1FA 5EIIB 3TEXA 2BFGA 4H5SA 3MTXA 2QKSA 4P5KB 2GITA 3NFSH 4X98B 2J73A 5ESAA 1DQKA 1FL5A 1B0GA 4MX7B 5BQDA 1S7XA 5DJAB 2BPBA 4RISH 2J56A 2WBJD 2OZ4A 3DPBA 3R4DA 4ORGB 3WIHL 2EDOA 3GJFH 4NRYB 3RX9A 4XXDA 5I6XB 3RP1A 4ZDHA 3GMRA 3V4VH 4M48L 1UZ8B 4NP4L 5M7QA 2IDUA 2OYPA 1J1PL 2NNRA 4AYEC 4I2XA 1DJXA 4JE0A 1EDYA 3DECA 1Q94A 4CSZA 1A3RH 5JW3L 4Z7QE 3PHAA 2OFQA 1B0WA 4PSRA 5D7JD 4GW5B 4K55A 2J1KA 2WQRA 3CZLA 5D1QE 5FOJA 2XG4A 1BQLH 5A2IH 5CZVL 1MRCL 3D3VD 3QZWB 3QG7L 1SXZA 5JW5A 3G5YB 3L9YA 4DPRA 4Z6AT 5I2IA 1NPJA 4G43A 1D5MB 1NFIA 2M8XA 1AACA 2CM6A 1XH0A 3UG3A 5IB1B 2AQNA 4X6CF 4R7VA 2F8VA 4ODSH 2G4EA 3VQLA 2Z7UA 3VWJA 5HHQB 3AGWA 1NJ9B 2Q8BH 2FLBT 1U6AH 2JKTM 3E9UA 3MC0A 2ED9A 4QJ3B 4JFWA 3OHXC 4PJAB 1E5BA 5K9QG 2C1PA 3MHZA 2ZCKH 2CPCA 1BIIB 1T66D 1TJIL 1OCOB 2XKSA 4U3CA 3C8HA 3N3EA 3B3BA 1QVOB 1U58B 2BIPA 5CGYC 1TQVA 2MNUA 2ARJA 3KLKA 3BGAA 1NH6A 2APVA 1OCCB 2GG1A 3C9NA 3QUGA 3QIUD 3UZEA 4JFOA 5AUMA 5EZJB 4G1EB 3KJ6H 5EN2B 1KIQB 5I66A 5H4YA 3WLBB 4HKXB 4EUPA 5KW9L 1B0IA 1XVSA 3VMNA 4DIXA 1E9PA 5BXFA 1NGXA 3O8XD 4Z77B 2BP0A 1KACB 5C09A 2IQ9H 4HFWB 3KLSA 1WZ1H 3B6SB 1DUYA 3BQUC 4R7NB 2V2XA 1G7PA 1YCSA 4LSUL 1T1ZB 4JFXB 3ELAT 4OGXL 4OT1H 4NQVB 2FEEI 1JK8B 1DL7L 3U4BL 2E9WA 1FYTE 2A9DA 4KI5D 2GSGA 3RKDD 2RA1A 4JM2D 4Y16C 3T3ME 3LJ3A 3ARWA 5B4MD 3BIAX 2J1YA 4IMLB 2BINA 2M83A 4EIUA 2ICEB 1V3KA 3N40F 3RGVA 4YPJA 3ILDA 2E74C 4X9FA 5I0VA 3FU7A 5DRZB 1PFOA 5F70A 5B39B 3NZ8B 4ZSOA 5JW4M 3S36H 2O6PA 1VAHA 4IIQB 4Z0XB 1X3DA 3BLBA 1ZHNB 1C7SA 4YSEA 3L4XA 1WWCA 5I8CA 2EZ0D 4G6FB 4X5XA 4YLQT 4TSCH 5HYQA 3FSZA 4PWIA 4YHYC 4YBLB 3CQPA 4QHLA 4MHHI 4U1LB 1BXUA 4AL8H 3NSCA 5E8OB 4S0TD 4Y88A 1XH3A 5AAMC 4KOCA 3WNPA 3EDEA 3QUKB 3RX8A 2A1WL 1OZUA 3E8UL 1BG9A 1FE8L 3HE6A 3LYRA 2CUAA 3MFGB 4BKSC 1X5GA 2OW7A 1LP9B 2TSAA 1MCHA 1T6WA 1OHQA 2PR9A 2IADB 2NY7H 3QXDA 4PB0H 1J5HA 3W38A 1IL1B 1FQ9C 2ITDB 4U1SB 1NCJA 3P11L 3SO3C 2E56A 2FAUA 1ZY9A 2XPGB 3STLA 1QUNB 2D3NA 2VZ1A 4KQ3L 4KH2A 3BVDB 3G5ZA 4YR6B 2HPTA 2Z93B 1ZD6A 2VM4A 3OM3B 2IEPA 3HLAA 2VR6A 1UWYA 3BGFC 3G04B 3CBJB 2YD1A 4G8GB 4AENA 3L4CA 5IZ7A 5A2FA 2OX5A 3BFQG 3SO5A 4HSQA 1QHQA 1SLWA 4U1HA 5IW6B 3QZPA 1S7RB 2EDJA 3GSVA 4IRZH 1F56A 2WY3B 1R3LB 5E0FA 2MWCA 4OCRL 2DIEA 1PAZA 5AW9B 2NXYD 3FCSA 2DQUH 2FO4A 5FGSA 1S3KH 1KFAH 3MV9A 1B3JA 1D5ZA 1HQRB 4FFWC 2VDNL 3SDDA 3MBXH 5JMOC 1AIZA 1G1YA 1LEIA 3GS4A 4HKBA 2KPNA 2J2ZA 1NIDA 5ADOH 2N7BA 1KYOK 1KZYA 4TUKH 3L2MA 3ZHNA 3CDFA 1EHLL 3ULVD 1CPUA 1SVBA 3IM1A 4TNEA 1HXYA 2WTRB 3FFCB 5IQ7H 2DH3A 4EI5B 3A4DA 4WI5A 5DVLA 4Y5VC 3V6BR 5FF6B 1OT4A 3RFZB 5D5ME 2OSLB 2PCPB 5E2VH 2QLVB 1DLHA 2D0FA 2XQYA 4X7EC 4BIKA 3H6JA 5H35B 3LIUA 1AO7E 2VMFA 4XBMA 3V5KA 2Q0ZX 1TZOA 3ZOAA 3LKQA 4MTMA 1XT5A 3QI9D 3NTCH 4HKZA 3QPXL 1U8KB 3HR5A 4TLTA 1BLNB 1ECZA 4WU7B 2K9FB 5FGCB 1ZOXA 1P4LB 2W1NA 1IKFH 5CJ8A 4MMXB 1A66A 1YZZA 2MPAH 1BHGA 1CLCA 1D7BA 1AS6A 1H19A 2O26U 3ZE0B 3C6SA 4PRPB 4IRJB 4TULH 4U0RC 5LCVL 3PABB 2XN1A 3CSBA 1QBLH 3RIAF 1AZRA 2WXPA 3WFZA 3P9MA 5F7EL 3WIIL 3WDHA 3LPGA 1HCYA 4XCFH 1DVTA 1IC1A 4OAWB 3ZRFC 4PG2C 5LGHL 1UWXK 4OI7A 3BMVA 3VE0A 2OULB 1JZ2A 1DBKH 5JPMB 3FSOA 5J11B 4GUOA 1FO0L 4HIXH 4LKCA 2IPUG 4LAJH 3SCMC 3AQXA 4ELMF 1IU1A 3ZY7A 4QTHB 3UYOD 5HSFA 4G42B 4HLZG 3DSNA 4XNQB 2IH9A 3S48A 1LO4H 32C2A 1AHMA 1BZ9A 2V3EA 2VDRL 3FF8A 4I18C 5EBWB 4ZD3L 4UV7H 2ADJA 4PGCA 2BVTA 1T22B 3O6FB 2DLGA 4G8FA 4AE0A 4AXWA 4CSTA 1VA9A 4EI6B 1VKXB 4E9XA 2DMHA 3FN0H 3UGXA 2WQVA 4G9DB 4YSOA 1TKWA 1VIWA 5FLVA 3RZCD 3HN5A 5DGQA 4H25B 4YHZH 1LDSA 1AP2B 4KK9D 3GBML 3RPIB 5I1KL 1ZHKB 1E2WA 5D7SL 1U36A 4WEMB 2E7LC 1BREA 3CDCA 4KRLB 5EZPA 3QUYA 1YAZA 1GL4B 1JP5A 4JFQA 5FA3B 3ZW3A 2O61B 3I50L 4Z95L 1M05A 3S37L 1DCLA 1I8KA 3LKOA 4TPRL 4H1LH 2BNUB 1MCEA 3W57A 1R0AL 1BVKB 3FF7A 2WVTA 4F2MA 4PGEA 1TU2B 4U33A 3HFFA 4HVBA 1G7JB 1XEUA 3S5LA 3U0WL 3CJJA 1SOQA 4FTDA 2E27L 2OR9H 1MNUL 3CFBA 4F58L 3WTWA 2NXZC 4QT5A 1E4XI 2NYKA 3HJ0A 3S6CA 1RI8A 2QFPA 2FCBA 4P9ML 4FQQA 2IBGA 1KCSH 5DLML 5L2JA 1CLOL 3MFFB 2XQ0A 2W5PA 1BZ8A 2KKQA 4KTDH 4P5TD 2BSRA 4WAFA 4JZJB 4PCSA 5F89A 3V6ZB 1N7ML 1UT1A 2V5RA 1QZNA 1KCWA 2DWTA 3MLWL 3BN9D 2FEDC 3ALWA 3EJZC 2XA8L 5CEXB 2XPZA 1WCBB 5FB8B 1OGAA 4IDJH 1ORSA 4AV5A 5C0GB 4JGNA 3HNSL 2EQDA 3GBNL 3BKJH 3TYFA 1BYNA 5C2BH 2VDQL 3ZYZA 3ABKB 3SEPA 2ZCHH 2G2RA 2B5IC 2NY1D 3V5DA 2B16A 1BAFL 3HTLX 1K8IB 2BSEA 4FXGA 1IEHA 3VXOA 2BWDA 5E94A 3PU7A 1JMXA 4XWOD 5F7WC 1CFTA 3TA3D 3O9WD 5G2NA 4P2OC 2OMBA 3JXAA 2BSSB 2X4SA 4K9EL 3ULSA 4G11A 3GO1L 4P3CL 3RIKA 2XTJC 5DEZA 4UANA 3Q44A 5JYMA 3OR6B 4U1GC 1I9EA 2EVIA 1OT1A 2EINB 1QZ1A 3WNJA 3OWRA 5BQ7B 5H37A 3E6FB 5AG8A 1ZEAH 1XR8A 4IRSB 2IO5A 2F5AH 2X88A 5D7LA 3O4OC 2ZONA 4QHNA 4GEIA 1KCRH 3K2UL 1I9IL 1YEGL 1P69B 2F9BT 3CLEL 3ULVL 3EG9A 4ERSL 3V0GA 4OIFA 5I1EL 3NBNA 4O5LH 4QF1B 3D05A 2JMRA 4OJFL 2WJ5A 2Z34A 5D9SA 4DESA 2WZ5A 4XNXL 2EIKB 2A77L 2EUXA 1H3VA 3FQ2A 4OCNC 3EBGA 1KY6A 2NY6D 3GMQB 5IHHA 4BQ6A 2ETWA 3L3HB 4AI7A 4OKDA 3U1SL 4F57L 1V7NL 4IOFD 2OMTA 3BRFA 2XFXA 4Y4FC 1T5KA 3AMLA 3HS0A 3T6WA 3S4SA 1IBBA 4I3SL 1QNZL 4XOEA 3UJIL 3ABMB 2EIMB 1GZPB 2K70A 2FSDA 4Y4HB 4WHDA 4HGWA 3U2IA 2GSMB 3PQYB 3TPKA 2F8IA 1N59B 4D9LL 4S2SA 4WHTA 4UDUB 4MS8D 3VWKD 4NFBA 3SOBL 1VFOA 2ICWA 4DGVL 3NMEA 5HDQL 3EJJX 3ABLB 4GP8B 3K0WA 3FAXA 2N1TE 4MYWB 4A7SA 1NAKH 5DJ2B 1FC1A 3AITA 2R69H 3PWLB 2B4CL 5K59F 4DERA 4YDMA 2Q1EA 5LBSL 5SWSA 2V7NA 3STBA 2B1AL 5ILTL 2OTPA 2K0RA 3AS2A 1J87A 3IMWA 5F1IB 1YAIA 4KDWA 2Z7ZA 1RZKC 5BNXD 3WJJC 3JVGA 3HC2A 4XGZA 4QD2E 4HGKC 12E8L 4R5TA 1DQJA 1RVFL 3UO1H 2R2HA 1OAQL 4BUGA 1T7YA 3AS1A 4MNGA 3SDCC 5IB4A 4ZMAT 2GSIA 4H20L 3SQOL 2QQNL 2YKLH 3CSFA 4OV5A 4XVOA 4K4KA 5F3BA 4LCYB 1KUMA 3RWFB 1WA2X 5GGTL 3U9PL 5A3ID 3ZVVA 3H1ZA 2ZCLH 3NQKA 5IK3B 4A7GA 2PLTA 4P5RA 4KRMB 5F1SA 4IBSA 2AEQL 4NQEB 4K71B 1AGFA 3RL2A 1P0SE 2ZX9A 2BC4A 5AG9A 1PIGA 3NJGA 4UAOB 4NCC2 4MS6A 1G4MA 1SMAA 3MLSL 3KDMB 3OLGA 5A43C 1EJOH 4FG4A 4QKXB 1TCRB 5DJCA 3HKFA 3QUZC 1F90L 2YD4A 2JCWA 1PL3A 5AVUB 1UEYA 2VDMH 4PR5A 4GKOA 5HHOE 3BP5B 3VFUB 2A4CA 1IAIL 1TYJA 2Q6WB 3I6GB 1RUKL 5CR8A 2R56H 1IBDA 4ZW6A 5AZ2L 4B5ZA 1KGUA 2DQFA 4G83A 4DEPB 1KBGL 4TRPH 3EOYG 3ZUNC 2YK1H 2E86A 1L6ZA 3L3JB 1URLA 4ODXA 1EEYB 3LN4B 4LHUB 5FCUL 3JTTB 1QLEH 3MGTB 4KVCL 2PPAA 1RK7A 3TBVB 2CHWA 3UTQA 4O2CA 5F88A 3K6IA 1DP0A 4AJ0A 1UM5H 1WS7A 2CUIA 4C56A 1I75A 5KVEH 4MCZA 3CSPA 1RMFL 2Q7YB 3QS3A 4KDTC 4J6IA 3HZYB 4ZAKA 1PU0A 4FFVC 5MEPA 4LL9A 4MAUH 4NAQA 3KBEA 3WNKA 4M6OL 1NCHA 1MHCB 1QO3B 5TH2A 1E9OB 1HCZA 1T1YA 4YXKL 1NGQL 5F7FA 2W9EH 2Z1PA 3DIVA 3N85H 1P1ZA 2HLEB 3CPLA 2HUEA 3DX2A 4KOBA 1KCUH 1NC2B 3SJVB 3UGUA 4P2RB 3V52H 2AQ2A 4M02A 4BDVA 5IKCB 1UM6H 3LEYH 2EVHA 4F3FA 3E6HB 1RXLA 2B1HH 1E2VA 1MFCL 5J6HB 4HIJB 5BV7L 2G4GA 4AQEB 3T2NL 5SWZB 1NM9A 3QR2A 5A2BA 4FFYA 4FLHA 2AITA 3CDYA 4NNXB 5ESQB 3SDAA 5T3ZE 3FAWA 4X8JA 1DTUA 2FT6A 5TJWK 3WFDH 1D9KB 2ALWA 3DX0A 4YO0A 3IWUA 3BD3A 5I75C 4IHBA 2BP8B 2KBGA 4JFED 4LLQB 4MVBD 5JOPE 3GXNA 2PYEB 1UJ3C 3P02A 4YHIA 4ZS7H 5E2TH 2VLKA 1UENA 3C8DA 3DRQB 1E5UI 1T0NB 2V7HA 4S1DC 4DP2X 3NCMA 3CFMA 3DVFA 2Q8AH 2Q9OA 2F58L 4PJGB 2APTA 3CG8A 4UINL 1ETJA 3TO4D 4UIKL 2VDLL 3M86A 4Z7AA 3CBKB 1JFHA 2H26B 4KY2A 2OLDA 2WWMC 5F0JB 1V8HA 3IGKA 3MNMA 5EWIH 3C6LB 5INCB 3O0RL 3NN8B 5B21A 1PSKH 5DMKB 2APFA 1QFPA 4WHYG 2CKBL 3K1KC 4MJIB 1K85A 2J5LB 1ETA1 3QDGB 5AVWB 1YUKB 4HZ1A 5F6IB 4M43H 4ZX6A 3TBWA 2EXYD 3VGFA 3PJNA 4B3VA 1VADB 4ETQB 4L4TE 3TNMB 4JL1A 4E36A 3K71B 5HJGA 2JLPA 3CFDB 3ZTJG 4YXLH 4QRQB 3JV0A 2D7QA 2WOBA 1KXQA 2X2YA 5I1AA 4UTAH 1T7XA 1IFHH 3FHAA 2GEQA 1EAOA 4NWUL 2GBAA 2NCMA 4ES8A 1AGDA 4O4YH 3ZYIA 2L7EA 4MA1B 4ELME 2XZCH 4OCSL 4QY8A 1EFXD 4F37K 5HDLA 2Z91A 3QJFA 4LQ1A 2GCYA 4KJQD 4ZW7A 3FSWA 3BUYA 3MRCA 1RZQA 5I1DB 1H9VA 5E1AB 1OGTB 43C9B 5CHNA 4JRYE 2Q87A 4GW1A 2R4RL 3GSNL 5F0LB 3MRJA 3D8MA 1ZT4A 1WO2A 3DX7B 4ZMPA 3CZFB 4DW2H 1B2WL 1PY4A 2OK0H 3Q48A 5DEFA 3HC4H 5KSVA 1ROCA 3S35X 3GSQA 4NOBA 3OXRA 3OG6B 3V0DA 4HLEA 1A47A 2WZ6A 4WKZB 1U8CA 5L2KE 3H3PH 4AQOA 1A7NL 4R26L 5GGRA 5BUGA 1RK0B 2L7QA 2DQEH 5DUBB 2X89D 3TEZA 1DQVA 2KC0A 4NKDA 2CO1A 1UH4A 1BYOA 1DVXA 3TJHC 1JPFA 3BJ91 1K72A 1HOCB 2UYLB 4DN3H 3UC2A 2Y3AA 4JEGB 1S7TB 1KJ3H 4RMQA 1LO3L 1UT9A 3EJYC 1AHKA 4ZMYA 3SKNA 3ZMNA 3CFKA 2W0KA 3IMUA 4MAYA 1IBGL 4G6AC 1G0DA 3IJYB 3LRGA 5KVDL 2UWEF 4PGJA 1HN1A 4PLJD 1AXTL 4J2XA 1G6VK 2P80A 5CCGE 3U4AA 5GS3A 3VFOA 1CFSA 1GKOA 2BNRA 1X44A 3ZIMA 1QNIA 4X8CA 3FKUS 2VH5L 3FRUA 4NT6B 4P2QE 4NZUH 2J3SA 2EIDA 3ZIYA 3W39B 3NFPA 2OAAA 1AC0A 2MQ3A 3KYMA 4ONGH 4R8WH 5E4EC 2XY2A 4NQCA 5BZWB 3ARYA 2QQKH 1J48A 3JWDC 2PCFB 1MCKA 1Y6MR 4G9FB 1LK3L 4FYTA 3F62A 4IJ3C 1BF5A 2NLJB 5BS0A 3SKJL 3ARUA 2JV6A 3RDTA 4XVSL 1F00I 5FYJE 4HIHA 4M5ZH 4E9QA 1FSKC 3ARBB 1OK8A 2H2SC 3C5SA 1J5OL 1FGVH 4YVUA 3AG2B 1RPKA 5B8CA 1AQDA 5SX5H 3DETD 4MAZA 3VNZA 3ARXA 1FL3B 4KZEH 2P8LA 4GSDL 1I85C 5AW4B 1A9BA 5CKGA 4HJ1A 5DI8A 4WTQA 2CGZA 1GC1C 3BXNA 3VTTA 1PCXA 2P44B 1QLFB 5J9PB 1FIGH 1DVFB 2HT3C 4JFFE 4KXZH 3I9GH 5KYYB 1QI5A 1Z9MA 5IOPA 1BBJA 2DF3A 2PTTA 1X5MA 2E46A 3BE1L 3EJQA 4HSCX 2EDWA 5CF3A 1N6QH 4AMXA 3APFA 2XI9A 4XP1H 2RQEA 3BISA 5KYWB 5IESL 4MCMA 1KYAA 4DUWA 3Q43A 3QIWC 5E56A 4LRNL 1F2XK 1KLFB 3QNZA 2C7UA 2F54E 2VXQL 1I8MA 1GGBL 1XXDC 3NG5A 1YDPB 2ZX7A 5ESVA 4GT0A 2R9HC 2DKSA 3RU8L 5IGXL 1OP3H 4NPKA 1NL0L 5I74B 5I5JA 4BA8A 4K5PA 5B7FA 2NX5D 5JNYA 3J07A 5E8NB 3NFNA 3U0PA 4NYLA 3SE9H 3DI3B 2CO6B 1AZVA 4AIXA 5DQ9B 3MBED 3FPYA 2YAEA 4ZW8A 3S36X 1U2YA 3U6RA 2I24N 2Z7YA 2A6DB 1L7TL 2ZWSA 4YBQD 3TO2B 3AB0C 3MRQA 2X6CA 1R19A 5FHAL 2PXYC 3GPSA 3T3MB 3GMOA 1R5WB 5C0BA 2L04A 1BAWA 4DP5X 1SY6H 1QHOA 4N25A 1L0QA 3LEXB 2VN7A 3FCTA 3HG1E 1BQHG 3MX0A 5GS2H 3MV7D 2YD5A 4PCTA 1BFVH 2AJYH 2P5WE 4NQXA 3F83A 3ECQA 3FULA 4ZPVA 3T0VA 3DBSA 4ODUA 4MKMA 3UTTB 1MH5A 4Z3HA 5EO0B 2N7SA 1L9TA 4FFZH 2X44D 3DURB 4UTBH 5KEZA 4XVJL 4OCYH 2ESVD 4JNXA 4UOW0 1BEXA 1YEKH 3VDCA 3J2PA 3KJ4B 3ROLA 3S97C 5BOZG 4JVWA 4QOKA 1ZE3C 2VE6A 1OWRM 5AW3B 4K3GA 1GYWA 3FK3A 1OAUL 3QEQE 2FJUB 2JJTA 3K3QA 1A25A 3RWCA 5F7AA 3E0GA 2ICWJ 1AR2A 1GY1A 1RZPA 5EUKA 2BVYA 3H9YA 1X7SA 3D2UB 3UEQA 3QORA 1SLXA 3IU4H 2YPVL 2OJEB 2MNJB 4PG9B 4QR7A 4ZXBC 3OQ3B 4PWFA 1OY3B 2GUOA 2NNXA 3HUJA 2BMKA 4DK6A 5AOMA 3MAWA 1Q1JH 3AUWB 3UBXA 3CFTA 1ETZA 3W0WB 3HMXL 1S7UA 4D9QD 3ZT7A 2VLRD 4QJ5B 3DMMC 1HQ4A 4Y4KD 1OQOA 4Z76B 4HU8A 3FT9A 3AT0A 2I85A 3MPCA 3X11A 3TASA 3DKHA 5DMIL 3MLZL 3WY4A 3IE9A 1QFUH 3CVHB 2XTJE 3O6ML 4AYFB 4H13C 1U8HB 1BXXA 3R0NA 2FVNA 4JFSA 5GS0H 5I0DA 5KYNA 1R3JA 1GSMA 1U95A 2VLMD 3N2JA 4MXQC 4LCWE 1GAFL 2JF1A 4OZHA 2PF6A 2BNQD 3TT3L 2P52A 3DVIA 3NRPA 4TLSA 3T8XB 2JH2A 5ID1A 3L2NA 5EOQL 4UM8A 3KXFD 1A7RL 3KCPB 5T1KB 4AVJA 4X4YA 5BRZE 1U3HC 2QR0B 3MRPB 5H4ZA 2XT1B 2ADIB 5DYOA 3O41B 1F4YL 1V7MH 1AKJB 3DUSB 4I3RH 2BLFA 3INOA 3MRRB 5F7DB 3ARSA 1HHJB 2CE6A 3BPCB 3QIUA 5D6DA 3X12B 2E6QA 5D5MB 4AM0B 1RUPH 5F1NA 4ZYKB 2EC9T 1Q9LB 2FHFA 3H55A 5AVXB 3VXUD 5HD8C 1J9CT 3G6JA 3PWVB 1EPFA 2BCMA 1UXSA 4U4IA 1AO7B 4A04A 3QH3A 4BQCA 4DEWA 2JELL 2CLZA 2OPCA 4XN2A 3FOLA 3TNNA 1X5AA 2WKOA 3NJJA 2IDTA 4XH2B 2DTMH 4S10A 5IEHB 4KK8D 2NY2C 3T77B 5ANMB 1EZVX 2ICWI 3GRBA 5IUSA 5AKTA 2J5WA 3WS6A 1IGML 3DGDA 4LP5A 4GRLB 4RX4D 1ZA6A 4Q4IA 3TH4T 3Q8EA 3ZMRA 3M8OH 5JORB 4JO4H 4H2CA 1YEEL 1QKZL 5E1QA 3WUWG 3K7UA 4APXA 4JKPH 3WXVL 1RZ7H 1I4FA 4WWOA 4APQD 4NGHL 1SDYA 5IW3A 4EPSA 5A2CA 1CT8B 3DYOA 3WJLC 4B9JA 1VACA 3CC5B 5I16A 4FNRA 1HTYA 4KZCA 1CDCA 2QADB 2YAFA 4KROB 1GCYA 1FGNL 4XODA 3RWIA 5E1GA 5T5NG 2NYYC 1JPGA 1UCTA 3FSVA 3LY6A 3OVUB 3ZKND 3AWGA 3TBBA 3BRGC 4E2OA 2ADYA 3WXWL 4YK4B 3RVTD 4A6YB 3GMNB 2HT4C 4IRZA 2E6JA 4B95C 1SEQH 4FNPA 4EKJA 1N4XL 2HJKB 4MJ5B 1DQQA 2GBTA 3FU6A 5MI0B 5FFGA 2N0KA 2Y25A 4UT9L 4BGDA 1SOSA 5AL8A 3RVWC 1LNUA 1P2CB 3GXDA 5DWPA 3RE0A 3NH7L 1QSEE 3NK3A 4I9XA 2DQIH 4WTZG 4YPGA 1KBKA 4BWTA 5GHWL 1AZUA 1NIFA 4I0CC 3TESA 1GYUA 4QDGA 5LXGH 4PJDA 1RJZA 3DHMA 3TVMA 4WSKA 3FO1A 1K5NB 5DD5H 1DR9A 2HRPL 5JXAH 4CVZB 5L8LB 1JGLH 2ZXWB 4AQ1B 1A5FH 43CAB 2DWEA 1FP5A 4F9PA 4U7MA 4X99A 3WV0A 4X6BA 4XTRC 1SM3H 5C7ZA 4DN4L 1XCWA 1K2DB 3FUEA 4PRBA 4QRBA 5LKNA 1AC6A 1G1KA 2X4RB 1CGYA 2HJLA 4WLCA 1JV2A 2F5BL 4B9IA 1E6OL 2NW3B 1I1AB 1EVUA 4P0DA 3VA2C 3C60A 5CEZH 3B43A 5EZLB 5IR1B 3WY2A 3BAWA 1XGPB 1OPGH 4WFHE 2O5XL 5C9JA 1JXKA 1KPUB 4KNQA 4MDIB 3D12B 3Q8BA 4HX1B 3MOAH 4HWBL 3EYVB 4NO3A 5K9KB 2Y07L 3GI9L 4BGLA 1UC6A 5HYEA 3IN2A 5IT2H 3LZFH 5DJXA 5I8KL 5I23A 5I71C 1FBIL 5C6WH 2C7FA 2VAJA 3GJEA 1NMCB 4EDWL 2ARWA 5HJBA 1TEFA 2UWEE 3PUUA 3REVB 1KIPB 2IPKA 3DTUB 5IVOA 2WZPD 2VZUA 2W0FA 4KK6D 3TGXA 2RALA 3QXUA 4ONFH 4XBEH 4JG0H 4MMZC 4MSWB 5ITBL 1FN4A 5GZNC 4X42A 2YRPA 4R90H 5HYSG 5J3HD 4N5EC 5D93B 4MQSB 1J11A 3S5YA 3UO8B 1PYWB 3HZMB 3O6LL 1LK2A 1JCKA 4NZJA 4YSCA 2DQHL 2IWFA 5GS1C 3GS0A 4XMZA 4YXHH 4PJIF 4OIIH 1U92A 3GIZL 2NY4D 3TLRA 5D55A 2Y4SA 5D8JL 3FQUB 4WGWB 4NS0A 4ZFOA 3MREB 5IJDC 1UCBL 3TWYA 3MJ7A 2PO6B 3ISYA 4WEBL 3FOMB 4GNKB 4C8XA 4H1LA 3VXTB 4LLVA 4R2GD 1RUAL 1G9MC 3LN5B 4K3JH 3EOTH 3IDGB 5E8EB 1G94A 4FS0A 4NQDA 4E42B 2NOYA 1HHHB 4L8DB 3RZWA 4X5QA 4LEOA 2HKHH 4X6CB 4AW4A 3BFWA 1QFWI 1KELH 2Y1ZA 4LFHG 2XACC 1MJJA 3O4LD 2CO3A 4R3SA 4LLMB 3RZCA 2DZEA 3FO9B 3RTQB 3BLPX 3NUKA 5B38B 2D8KA 2VN6A 2W07B 4XZ4A 3VDAA 1JZJA 1J0KA 3ULUL 3L3DA 3KGSA 1MRFL 4MNQE 3H3KA 4FLRA 1XB8A 2NDFA 3KPRB 4Q0XL 2DJSA 2YMTA 5FFOA 4F5CA 1U8IA 1WTLA 4L3EE 4NHCL 3MMEB 3NABH 2Y0SA 5LNDA 3L54A 5EZOL 3IJSB 3NZHH 4N0CC 3PLYA 3W11D 1AZZC 3GF8A 4OLYL 5C08D 2UY6A 3FJTA 3BO8B 5KWYC 4MRCA 2YOCA 1ZK5A 1QOKA 1CICA 1SFDA 4M3KB 1BVOA 5FDWB 5B3SB 5DVMA 2Q20A 2YPLD 1BX2A 4ODHH 2KZBA 4MBOA 3PJLA 4M61B 5BUAA 4FN0A 4BZ2L 1W2KT 1WWAX 1UOWA 1Q0YH 1HYSC 3P73A 2JB6A 1D6VH 1KT2A 3IJ9A 3L3KB 1XSOA 1PKQE 2ZCZA 4G6JH 1KTLA 5SV3A 4OLUH 4LT7A 5T8IA 3FQWA 2XG5A 5J89A 2ZOWA 1JHLH 3IGUA 2FB4H 4A7GF 4FADA 3GMLB 4NAMA 4F7CB 3M1OA 2R4SL 3N0AA 2XWJA 1JZ8A 2FECL 4L8SB 1PNDA 3QRFM 3NJFA 3BPOB 3PHSA 2WVVB 4FCHA 1NWPA 1MCCA 1CGVA 2Y2WA 1AMYA 1H5BC 1UD4A 1ZT7A 5CNHA 3NJKA 1NM4A 1TQSA 4YGVA 3DUUB 5JO5B 2CRYA 2VUOA 3JWNC 2WCSA 2YBRB 1FIEA 1N3NB 4HQQL 4N9OB 1XF2A 3QWOB 2IOMA 4X9GA 3O9WA 5EU6E 5B7MA 3GK8H 1Y07A 3KPNA 5DHYB 3B9DA 4PRDB 5GGSY 5J1TC 1N8ZA 5FGBA 5KS9F 1N18A 5C0CA 3AM8C 1CFNA 1S9YB 4N8VA 4RDBA 1N5YL 1E67A 1U8PA 1NGPL 1QFWL 3WG7B 1U91B 1KB3A 5HYJE 1XGUB 4JDTL 4GXUM 4OVVA 3TEYA 1B0RB 4J27A 4U6VL 5EO9A 3ATEA 3MR9B 1W8OA 2HTLD 5C92A 3HBQA 3TFKC 5DT1H 1RCYA 3DOSB 4P99A 2Y7LA 3SYOA 3EOBB 4J4PC 4N6QA 2FIKA 2VTFA 2Z31C 2VSCA 2IFFL 3HG0A 3TWCH 1BXVA 5DC9B 1CI3M 1IGJA 2GQHA 4W9KC 2OXGA 1QQDA 4OFYA 4AEHH 4R96A 3LHAA 1NCDL 2QSCH 3D4YA 1Q72L 4NNPH 3CAFA 3X13A 3MA7B 3K6DA 3EADA 1TVHB 5ICXB 1BFTA 3FQXA 1M4KA 1ZLVK 2OYKA 2CZNA 3LEVH 4ANXA 5BVJB 4M7ZC 3KPPB 4B7LA 3UP1A 2O5ZH 3VXSA 3T0ED 3FQTB 2I32A 2R69A 2LTQB 3AU1B 2E7MA 3QXWA 4ODTH 1TJHH 3BN3B 1MW0A 1GS6X 4IBVA 3HE7D 2GFBA 4JKWA 3EYUH 1UYWL 4PJ9C 3TS8A 2K6ZA 5IOKA 3OHXB 3N50A 5JW4R 5D1QD 1UFGA 2VLJB 5IBLD 2GPZA 4GMTH 1G1OA 5CBEB 3MNZB 4KQ4L 2Z8RA 3RJDA 4X4ZA 2D7PA 3VXME 1OP4A 2YRLA 3WKMH 1X5HA 3OAYK 1NCBL 3AVEA 4EN3D 4P23C 4FZEH 3FTXA 1R3IL 2AHIA 1A6UH 2YARA 1DUZB 2RGSA 5J8OA 3FBQA 4LBAA 5K1NA 3U46B 4PJ5D 5JR1H 3VI4F 2P4AB 5AKVA 3BQUB 2R1WB 5F6HJ 5FFLA 1FVDB 4W4NA 1AR1D 1QWNA 3Q1SH 5FXCH 5FUZL 4TVPE 1U2HA 3CV5A 4W9FC 3TT1H 1FG9C 1T0MA 2WBXA 3A67H 3JBG7 5C0DA 4WTXA 4KO7A 4DQOH 1KGWA 2WSPA 3E7JA 5DJDB 5KJ4A 4PRHE 4K8RH 1KEGH 2AANA 3F12B 2M2DA 5EPMB 4POZD 4AE1A 4CADA 1GMEA 5E8PB 2Z8SA 2IIJA 3IRCA 4L4TB 1QSVA 2WQUA 3TPUB 1QSFD 3QZNA 3NRQA 2JE8A 5SX4H 3C08H 2X4QB 3N9GL 4U6HA 1UURA 1DQMH 1SBBA 4LF3B 3B8SA 4CBPA 2VABA 2F53E 4D8PB 3KYNA 4YMPA 2D7TH 3TJEL 1NUDA 8PAZA 2WLHA 2XBTA 3BUIA 4GY4A 4KH9A 2FL5A 4YHYB 1H0DB 1ZTXH 1FYTD 1PZ3A 2KT6A 3ES6A 1Z5LB 3JT0A 4U1IA 4X6EA 4ELMB 6FABH 1SYSA 2VUYA 1E3FA 1OEZW 5DQDL 2NNFA 5L6YL 4MJHA 3M1BB 3MCKB 4TNVF 5IVZA 1VPOL 2SEBA 3FT2A 1R5IB 4OKVA 4EKXA 1IM3D 2WSKA 1TQCC 5I17B 4JRYB 2IAMA 4LMQI 4JG1H 1ZJAA 5JLZB 2IC2A 5E2UH 4JKNA 3UBXI 2BOBB 2O6FA 4L0ZA 3QG6A 4GI9A 4XX5A 1MZZA 5DZVA 1QI3A 5CSZB 5AW1B 3SO3B 5I30L 1QABA 1JRHL 4WHCA 3JWNG 4WDIB 5IUCA 1D5IL 4KKBD 3KR3H 3FTGB 2J55A 4P5KA 4X98A 3NCYS 4J3OD 5IHWA 4P2YA 3BGFB 4AVHA 5DJAA 4KZDL 2X4NB 2HWZH 1HZLA 3NCBB 4ORGA 3U4EB 2Y6TE 4OZFG 3VD3A 2C3XA 1QPKA 4M8VA 4NRYA 4EMZA 4HJJL 4FQLL 3OJDA 4JG5A 4XC1H 4JGJA 1UZ8A 4WWKD 5F6HI 2PKDA 1TSHA 4N8PA 4XAKD 2UXFA 4EBQL 5GRZA 1X5JA 4G8IB 5HPOA 1M3JA 2VXSL 4P46D 2WBJC 3L1OH 1KLGB 2ZXCA 3UCRA 1XGTB 4KBPA 2JLLA 3DXAB 2A9ML 4A55A 4LDCA 3GJFK 3V4VL 3QZWA 4KKLD 2RH0A 4P2QB 2R1XB 4M7LH 3G5YA 1KGYE 8FABA 3Q0HA 5D70L 2GJ6E 1D5MA 1INQB 4MASA 4CMMA 3TXAA 1BA9A 3L1FA 1YY8A 5D7IE 3ZR6A 1A3RL 3HC3H 4RWYH 4Y5VB 4PLNC 4CRPA 4XR8C 5E9DD 5IB1A 4ABWA 4RESB 5LUMA 2GAZB 4IQHA 1TZHB 5D7JC 1RHFA 4PEEA 4QXUL 3BEVB 1TQTA 4UQ2B 3MRKB 2BOCB 3F7QA 3OKNA 4PREA 1NJ9A 5ERWA 4AQZA 3T1FA 2ADFL 3K46A 3TZVD 4PJAA 4UTAA 3SODB 5FKAB 5GXBB 1E7VA 4JHZA 4MA3B 4A68A 1BJ8A 1BIIA 2XJLA 4MD4B 5GGVH 1QTYT 3GEWB 4ODSL 4M7JH 4RRPG 1MAMH 1QVOA 1U58A 3CVHH 2Q8BL 4X5RA 4G1EA 3U79A 1P4IL 5EN2A 1KIQA 1ZWIA 3WLBA 3QIBD 3WENA 4HKXA 1MVFA 1JF6A 1SJHB 3MSPA 2WKLA 4Z77A 4QHUB 4V1DE 4AYID 4PJIE 1T66C 2CU9A 3B6SA 4NZDA 2OL3A 1FFQA 4I0KA 3Q9QA 3SZKC 2EC8A 2OZNA 5DR5H 3FTSA 3HI5H 2RQ8A 1T1ZA 2A83B 4X50A 5F0MB 3VGHA 1SHMA 4RAVB 3ZZLA 2DICA 4NQVA 4I87A 1JK8A 3RPKA 2F54B 4JK0D 4JY6A 4CU6A 4DT2A 1IAIM 1QFOA 2VQTA 4QEGA 3SCMB 3O8XC 1EFXA 1WZ1L 3BCDA 1R33A 1A4JB 3L3GB 2ZUXA 4IGBD 5IM7B 3BLKA 3T0WA 1GH7A 3FUIA 4HJGB 3T3PF 3H7BB 3FQNB 4OT1L 3ZE1F 4D0CB 5B39A 4K9JA 3NZ8A 2ZXAA 2Y7OA 3QUMB 4JANB 4PGZA 4AT6B 4IIQA 3ETTA 3ZTCC 1NWOA 2AEOA 5DUJA 3L17A 3UMNA 5J06A 1L6XA 1ZHNA 4KI5C 4NWTH 5T33H 3RKDC 4WI2A 1MFEH 4JM2C 4PRAA 2H0PA 2EIBA 1WCQA 4WUUE 1TZAA 5B4MC 1JF1B 4DP7X 5JXED 4I9WD 5DC4B 5GRVK 4D94A 4U1LA 2XVLA 4WW2C 4L8BB 1AE6H 3FB8B 4MQTB 5ID0B 2X89A 3S36L 3H54A 3QNXA 4HS8L 5GRJH 4JCWA 2JQMA 3D0VA 1T2XA 2ZJSH 3VSVA 3HG1B 1W72B 2PPEA 4OLVH 2VL5A 4QXTB 4TSCL 2EZ0C 5E2WL 4OGAD 2P5WB 5CLWA 1IL1A 2ITDA 4U1SA 2EKSB 5GGVY 2AK4E 2X9WA 3T4AA 4MA8H 2QBWA 4OJCA 3IDMB 2BW4A 2XPGA 15C8H 1QUNA 3V10A 2IPTH 2GY7B 4YR6A 2Z93A 4XP6H 3KH4A 1HKLH 2C3HA 3HCVB 3D4CA 4Y5XB 2YUWA 5DD1H 4N8UA 2A74C 3G04A 1UB5A 2DAVA 4FMKA 2FE0A 2AABH 2ENSA 4RSVA 1HXMB 1RIUH 3NIFE 2XIDA 1S7RA 4A6YH 5MHSD 3HUJF 1R3LA 4KRPD 1NEPA 1IZJA 5J5EA 4JFZH 5E8DL 1KGXA 3SQBB 3WY3A 4BCZA 4FQCH 1DDHB 2L7UA 3F7LA 4JM4L 2OW6A 3W82A 3B2UD 2GUYA 1HH9A 4IRZL 4RZCA 5J57B 4A2GA 3KG5A 4M3JA 3UTZB 4K9EC 1TQBC 4P2OB 3UTSE 1M7DB 2NXYC 1S3KL 4HWNA 1MCOH 3VXNB 2WTRA 2XN2A 3FFCA 3BH9B 3FZUD 1MLBA 1X6LA 2XTJB 4FTVB 4EI5A 5KS9E 4OZHF 4ZX4A 3QVAA 5HGAB 5FF6A 4E9VA 3MBXL 1NCCH 2A38A 4U1GB 4C83B 3RFZA 1OVZA 2OSLA 2PCPA 2QVKA 1J5DA 5ADOL 4TUKL 2GC4C 1FNAA 3D39B 5C3LD 2EE2A 1AYRA 2MQCA 5IQ7L 3ULVC 2OCJA 3T65A 2FX8L 3LZLA 3OMZA 5LN4A 2AXGA 3D5OF 3PL6D 5CFAA 1ZLWK 1KXTB 2P43B 2X70A 1NC4B 2FQEA 3ARED 4DKEL 3HVNA 1U8KA 3K1DA 4W68A 4XXWC 5E2VL 5BRZB 4LIQH 3EDFA 4WU7A 1LGVA 4Q6IC 5AALA 2VCOA 2IF7A 3HJEA 1CYGA 1P4LA 1CZ8L 3UAJC 4NM8H 1SY6A 1V10A 3G6JF 3WYRA 1MPAH 3AS0A 4JUSA 4PRPA 3NRFA 4NJ9H 4IRJA 4QRRD 5J1SC 3FXIC 2GIMA 4HWUA 3NTCL 3MUHL 3FHQA 3PABA 4K3DL 4KV5F 3D9AH 3IETB 3QI9C 2CWRA 4Y1AE 4NZFA 4JZOB 1NIBA 3WNOA 1DJHA 3OB0K 4HEPG 4KI5F 2HAZA 3MBEA 4OAWA 1T5WB 4KKZA 1BD2E 4JM2F 4FFZA 4UTBA 3FH7A 4R0LC 1VB9A 4LK4A 4TULL 5JPMA 5HHVH 2ED7A 2QKIC 1QBLL 4M8QA 2MNWA 4QTHA 3NDZE 2IGFH 2RFXB 3HAEB 4N3UA 4XNQA 5DJZB 4OF7A 4QYOA 4YZFE 5TDPB 2I25N 2YAPA 2XKUA 5EBWA 5FCSH 2J8UA 4R97C 4YSUA 1DBKL 2EDBA 1UZGA 2EKJA 1ACYH 1T22A 3CQQA 5ACZA 1YMHB 3LQAH 1VKXA 2ZAIA 4Z3TA 4ECNA 2B4CC 4H8VA 1B9KA 3NESA 1EZSA 3ZGIA 4DNLA 1MJ7H 2DRUA 1LMKA 1NICA 4GKZB 3U7AA 3VI4E 3CVBA 1LO4L 1AP2A 2YGNA 1KTRL 1ZHKA 3KH3A 5HVGB 4ZFFB 4N90E 1IO4C 3D50A 3PWPB 4DTGL 5FA3A 4XOCA 4ODBD 3AUVA 1F02I 3FN0L 2BNUA 4IBTA 3II1A 2CNZA 1TU2A 1GJUA 3SDCB 3VG0H 2BM3A 4CVXA 1I7RA 4KK9C 1MG3C 3MV8E 1OL0A 1D7FA 1PFCA 1VGEH 2XNAB 2KZWA 1ZHLA 1HNYA 5KYUB 4PJDF 4D7BA 3JWNE 2OR9L 2NZ1A 1JZ5A 4JZJA 1DZ0A 4ZUSB 3UAAA 3V6ZA 3VFTB 4A66A 4B9GA 2CRZA 2Y5TB 2WV3A 5E6IB 1LL1A 5DJ0B 5F7BA 4ICXA 3QUZB 1Z2KA 1IBHA 5CUSH 5FUOH 5C71A 5I6NA 4X7TB 4EXKA 2YGPA 4WF7A 4OFPA 5FB8A 1WCBA 2VMDA 3CMOH 4HUUB 4NO2B 1G84A 4BFIA 2COQA 1A1OA 3GD1C 1KXHA 1INDH 1YEJH 4D9RE 4LB8A 1E2ZA 4KWUA 4UBDD 4PJ6A 3PDOB 5ICZB 1TETH 2DM4A 1QTPA 1H3XA 3GSOB 1KTBA 4P5TC 3NACH 2HFFA 2ZOTA 3RYMA 1K8IA 3ULVF 5KSAD 4XBGB 3MKGA 4IDJL 4KTGA 1EHXA 4YN3A 2R1YA 3V9FA 3BKJL 1FFOA 1HL4A 3AZUA 3QEUB 5C2BL 4FULA 3RIFK 1T0OA 2ZCHL 3AW5A 4H8WH 5I28A 3O3BA 3KPSD 4J3SA 3OR6A 5HHOD 4Y19E 5FV1L 1A8ZA 3T0XA 3CDGB 3T6QC 2WNGA 4R4BA 3AU0A 4G80B 4WO4D 1V3LA 4Y5YC 3E6FA 1SXCA 4IRSA 4M62H 4TL4A 4XWOC 3TA3C 4XO8A 1AH1A 4NOFA 3CDZA 2Y1YA 1MIMH 4PU2A 1UA3A 3WBDA 5C0ND 2UWEB 2VAAA 1E8ZA 3VI3E 5IREA 2A2QT 2VQ1B 2K8MA 4QF1A 5CJBA 4ZODA 1FL5B 2Y06L 1T83C 1IVTA 4UILL 1OKEA 3QUXD 3VYNA 1EGJH 1ZEAL 1TEYA 4RWHA 3SPVA 1OP5H 3ZU8A 4F24A 3PAZA 1KCRL 4DP4X 5A7EA 4HUWA 2AEWA 2O6EA 3ARGD 3MNWB 5I75B 1C1EL 4O5LL 3SGJA 1Z9SB 3L3HA 3Q2NA 4IOIB 1UJ3B 4LDEB 1R1CA 3D06A 1UD2A 3BKYH 2C3VB 3KLAB 2NY5L 4X7SH 4XO9A 2ZP8A 2HFTA 3R8QA 3ROOA 4AJYV 1FORH 2NY6C 1N64H 1YLBB 2WBWB 4H88H 2DQTL 4Y4HA 5AB0A 5JW5B 2VZ3A 5I2IB 3Q2CA 5T3ZD 3UXFA 1N59A 2N7AA 5L4IA 2ZWZA 2WNWA 4IOFC 4UDUA 4QHMA 2PPCA 4JKKA 1CDBA 2VDPL 5F96L 2Y5EA 1F5WA 1GGCL 2G5RA 1A4KA 2CKNA 3GSUB 1IQWH 5JOPD 3G6AB 3RI5K 4YH6A 5AVQB 2H0JA 1MCJA 2DKMA 2QVTA 4TF4A 4N5UA 3N1GC 4HLJA 3ARTA 1G7IB 1YQVL 4WFED 2OYLA 3D52A 3RJOA 1HSAB 1CDUA 1PX8A 4JO3H 2W65A 1I8LC 2EH8H 1MFBH 3BIKA 1M71A 4PCYA 2ZG2A 4MS8C 5F1IA 4PTTA 1GS8A 3VWKC 4HWEH 2HFGL 4WK2B 4OQTH 4J39A 3JTSB 5JQ6L 4BQBA 2FJFA 2WCPA 4MNQB 3BKCH 2BY2A 1NAKL 4JFOB 4OZGE 5AUMB 3FU3A 3MCLL 4L3EB 4M6MH 1F1DA 1OSZA 3ELQA 3O6KH 4Y16D 1AGEB 1UATA 2MFNA 3ARPA 1DUYB 2C4XA 4LCYA 4YDZA 3T3PE 5H2BA 2V2XB 3RWFA 2Y22A 3F58L 4HJUA 4GQRA 1G7PB 2F7OA 3SD5A 1E4HA 3Q8FA 1JNHB 4A1RA 3LS4H 3ZE1E 2A6IB 5F8RC 5IK3A 3M07A 4LASH 4IMKA 5F7UA 5ISZE 1BFSA 2FJHB 1MCRA 3KBHE 3T08A 4L5FH 1WDAA 2HRLA 2I5YH 4JB9H 2GSGB 3SDXF 3RWDB 3LVEA 1XD0A 3KDMA 1EVTC 1I1YA 1TCRA 1P7HL 1PKQB 3JYBA 3WI9A 2ZCLL 3WEOA 2ZUUA 3RY6C 1QR4A 3RGVB 1XFPA 4GBXC 3ZR5A 2V37A 3BP5A 4LPCA 3VFUA 1YQ2A 4LPWA 4UTCA 2A99A 4KU1A 5CCJA 1JAEA 5I8CB 3QHZH 3UPRB 5FYJU 4KX7A 4QHLB 3VXQB 3L3JA 1EEYA 2VDML 5BZDB 3LN4A 4LHUA 1M7XA 2MOVA 2X2IA 3B5GA 1FHGA 3RPBA 3L4ZA 1XIWD 3MCYA 5TDOA 5L2KD 2YGQA 3WAJA 3FC8A 1KJ2B 5KJRL 2QDVA 3GINA 4WFGD 3U2SB 1NMAH 1FAIL 1EERB 4GRWE 2NTSP 2YK1L 3IAPA 5IW1B 2V5SA 3A4EA 4WU5B 3CFCL 4K73A 4ZJ9A 3F7RA 1QLEL 3HZYA 2HZHA 1EWHA 1BCIA 2NQCA 2XTLA 3U6XS 5DD3H 1Z5YD 5E4EB 1QO3A 1E9OA 3MRIB 3TOPA 1SUHA 1UM5L 3DK0A 3STLB 5ALBH 3BUDA 1EHKB 3SJVA 4MFHA 1NC2A 4IJ3B 5KVEL 3SGEI 5IKCA 2ZG3A 4V2BA 1Q8MA 3E6HA 5J6HA 2GTQA 2VLLB 3D3VE 3NSXA 3C5JB 4MAUL 5SWZA 1FLRH 2ALAA 1SOKA 4JJHA 2OX5B 4DK3A 1FSKB 2I60H 1SGKA 5F1KC 2A9NH 4MB4A 4Y9CA 3WKQA 1T2QH 4PP1D 2W9EL 3GSVB 1CE1L 3N85L 5IQNA 2FGWH 1KCUL 5LDUA 1Z9PA 1UM6L 5DMJB 3X1BA 2FEJA 2B1HL 5IHUL 5L8KB 3IN0A 3MV9B 1D5ZB 3BJLA 2PYEA 3ZL4L 4E41E 1OAKH 1QRKA 3WTXA 3NIGF 5LXVA 2CDGB 4JM0A 5C6PB 1OPOA 3DRQA 1A3QA 1T0NA 3QRGH 4ZNCD 2IG2L 2WLLA 4L3CB 3OF6D 4PJGA 3EZ8A 3O2DL 2YD6A 4JN1H 2H26A 3ESMA 3BAEL 4JFDB 3C6LA 3R18A 4MVBC 4GIAA 4ZS7L 5AOZA 3QIWB 1WGVA 3NN8A 4RAHA 4N2BA 4QGTA 1F4WH 2WIIB 1JHKH 4MJIA 4DGYH 4XMLL 3LMJH 2BIMA 4AK2A 3OD3A 2Q8AL 2WYZA 3MLXH 4I0PA 2WXGA 4JPVH 4BE5A 5EHFA 1R3KB 1VADA 4ETQA 4O58H 5BRPA 3TO4C 3TNMA 1LE5A 4GSUA 3CZSA 3V5KB 2A6KB 1NUFA 5EWIL 3K71A 2WXQA 5EEXA 1XCXA 1CGSL 1KTKE 1PSKL 1QHPA 2HJFA 3CFDA 3LKQB 4P59H 3LOWA 4BSVB 4RGOH 4HKZB 3HR5B 4L05A 3F2LA 4PS4L 5FYJH 4QRQA 3KL5A 4XP4H 4M43L 3UC0L 4KI5E 1ZLSH 4PBXA 1JNNH 1F11A 2EXYC 4FP8H 3ZRSA 7FABH 3INUH 4ENED 1C9SA 3AB0B 5F7LB 3LQZB 1SBSH 2PXYB 5EU7C 1XD1A 1S5HA 4X4ME 3RILA 4UTAL 3P9MB 4WCYH 3WTYA 2D31B 5KUKA 3QK0A 1DJYA 3O2WH 2WANA 1N19A 3VE0B 3DX7A 4BK4A 1NDGB 2UXTA 2XZCL 4PY7B 4XPBL 2ATAA 3O3AA 5EBMA 2EDDA 2F53B 3JQOB 4X7FC 4LKCB 3LVTA 1SHSA 4BKTC 4AGQA 4FI7A 4HEME 4WKZA 1R47A 4KJQC 3FU9A 1S7WB 2FYYB 4DVBB 5GRWA 4EUPG 3MLYH 3GZOA 1DJSA 3B5TA 3E2HC 4M5TA 2WJ7A 5CR1A 4AXWB 2OK0L 4J3VA 3HC4L 2Z4TA 4GG6F 1HOCA 4LEBA 1ERNA 2RCSL 3U7WL 1U42A 2A9BA 4GUPB 1D5XB 1S7TA 1NKGA 1PG7H 3H3PL 5KS9B 4JHUA 4JRXD 2XRAH 4OI9A 4QXWA 3SYCA 2AJZA 4ZXBB 2NXZD 1D7CA 1QACA 1TNMA 3ECBB 3QUYB 4R4FH 4W9LC 3IJYA 4JFQB 4KKQA 3G6DL 3NAAH 1M05B 4HSAC 3CVDA 4B27A 1I8KB 3LKOB 3GDCA 4DN3L 4PCKA 5TQ2L 1JL8A 2ZYIA 4XWGH 3LNHA 2DMGA 3MDJA 2CXGA 4EZMA 1RPUA 1KJ3L 3GFUA 1WQVT 3S5LB 1B4JH 4NT6A 3CFBB 5D1XC 1EMTH 1T04B 4QT5B 4M4RA 1G7HB 3W39A 3L9BA 1W72H 4Z7UF 3AXLB 3N1QC 2MCMA 5BZWA 3AXHA 2OV0A 4Z23A 2J72A 3QHTC 2PCFA 1HJBC 1H3GA 4R83A 4W6WB 3EH2A 4DHLA 1NSNL 3IU3B 1NCAH 2NLJA 4NZUL 5F89B 2ZKYA 4DCQB 3RNQB 2HB0A 4LLWB 4LNVA 4ONGL 4R8WL 3ULVE 1AJ7L 3ARBA 4F8LA 5CINL 4HP5A 4G3YH 5CJQH 3FCUB 3FONB 1BBDH 2EDEA 4GB9A 4RMSA 3UROR 1FL3A 4A7TA 3GUFA 4HDIB 5D6CB 5FYLD 1L5GB 4G7YH 3EDJA 2IBZY 2NR6C 2E0PA 4M5ZL 3TFBA 3O3DB 4EN3A 4IBUA 2F6AA 4LCWD 1QLFA 5J9PA 4FXGB 4OV6F 5E94B 4LGPB 4ABQA 3WE6B 5KYYA 1Q9WB 3US9A 1F2QA 1HWHB 4YJZL 5I1CH 2P5PA 2H3KA 3DJ9A 3L5IA 4JGUA 3DETC 2QJDA 2X4SB 2NPLX 4B7IA 5IJBC 5KYWA 2F68X 4N0UE 4YHPA 1NAMB 1KN2L 5ABZA 2WQAA 3I9GL 1YDPA 2NY2B 4LVHB 1XR8B 1Q9OA 4I5BB 4TUJB 5LAPA 2Z65C 1IT9H 2VDKB 4YE4H 4UNUA 1E6JH 4QHNB 5FW8A 4AQ8C 2JIXD 5E8NA 5DO8A 3ZKMD 1DQLH 4HHAA 4PJIB 1HK6A 1MI5E 3QJZA 2CO6A 2R0KH 4B50A 3BKML 4I77H 4RVBA 5DQ9A 4Y4FD 4CC0A 4E5XA 4ATTA 1IUZA 1WFNA 4JO2H 2WM0A 3EGDA 1QFWM 4O00A 1FYTA 2C3GA 1ODAA 4DVRH 2Q76B 1OP3K 4Z3FA 4KMQA 4YHKL 4AGNA 3ZO0A 1R5WA 3N41F 3QFJD 3QEHA 3ZO9A 3LEXA 3EYFA 2R8SL 3HS0B 4H0HB 1TJGL 3GZPA 5IMLB 4RBPK 5TF0A 3UDWA 4RNRA 4GJTB 1ICTA 1BF2A 5I6MA 4OLXH 1YC8A 4LU5L 1OSYA 1VFBB 4NLAA 1EHNA 5DS2A 3ASWA 3FUFA 1RZFH 4PJFF 3ZYJA 5EO0A 4PJBF 3DURA 1XTMA 2V9RA 4Q89A 2WQXA 4RAUA 5F72S 1T21B 4KJPD 1PNCA 2EEXA 2ICWB 4K3HA 2AJYL 4JHAL 4Q9QH 1S7QB 3Q3GA 4ALAC 1BWWA 4PIRF 5HYFA 4PJ7F 4X0NA 5JIDA 3HAEH 4YFEA 4M1DH 5D2NE 5DZPA 3OLIA 4S1SL 2V2TA 1HFUA 2WGXA 4XPFH 3OZLA 5SWSB 4U1NB 1HNFA 3D2UA 1JGVL 3PNWB 4OCYL 5E1HB 4PG9A 2OJEA 5A1AA 3D30A 3X3GH 4NUMA 4GMSH 4WWKA 2AK4B 3BUTA 4YLCA 2G5BB 1YNLH 2IQAB 4JVUA 4EAEA 1BECA 2ZSVB 2R7EB 2K9UA 5CD5D 1DQJB 3HOGA 2R2HB 4P46A 3SDXE 5IB4B 3F01A 4HETA 1QSED 3I02A 1UEMA 2WXIA 3GYRA 4HOMA 2J25A 3MXWL 2NSQA 1RZKH 5F3BB 2B0SL 1UOVA 3F6IA 4Z7NF 5DUPL 4AYFA 1TTAA 3CVHA 4HCFA 4X0KB 2V9UA 4JUTA 3CFQA 5T1MB 4LNRB 1GR7A 3UL4A 1DBAH 3DX6A 2FNBA 2WAQA 4TQHA 3N40P 1IAOB 3IJEB 3P4MB 2KLTA 3OMIB 3M46A 4Y4KC 2BC4B 4U1KB 3T8XA 1WAEA 2K7PA 2XWXA 5I71B 3Q5YA 3E1ZA 1GKEA 2X7LB 2XOTA 1M1XB 3UTSB 2R0ZL 1MCFA 1OOWA 2ADIA 2WLZA 1ILSA 3DYPA 1AZCA 5E51A 3V4PB 1AKJA 1WAAF 3DUSA 4UF7C 1A7QH 2BIQA 3FU8A 3MRRA 2HN7B 4MMZB 1HHJA 2DQFB 5F7DA 3DIDA 4AEFA 5K9JL 3BPCA 1MIEH 4OCWH 3X12A 1VZIA 5D5MA 2XN9E 4ODXB 4ZYKA 5D1ZD 4UQEA 1P6FA 5ACLA 1V3JA 2VZVA 2YUZA 4F9LC 3BGMB 3PWVA 2XETA 4MGXA 3ZHKA 4OB5H 1AO7A 1V7ML 4WV1C 3EH3B 4I3RL 4K3EH 1PLBA 2VRAA 5F0PB 3DGCR 2H9GB 4OM0H 2GBVA 5FYLL 2PWDA 5E6SB 4K94L 3T0DA 1RUPL 3SE8L 4E9WA 3SPIA 1DFXA 5CWSB 4X8XA 4IBLT 5FAAA 3TF4A 3I3EA 1M6OB 1VFUA 5MEPB 4WFFD 5CZRA 1X5IA 1PLCA 3D18B 5I6LA 3LNIA 4GRLA 1HZHL 4ZOEA 4PY8I 4DKDC 1P1ZB 5DZLA 3QJTB 2FGZA 5ACMA 2YLKA 2DTML 4Y1AB 4NO0D 3KPTA 5D4JA 1BVZA 5LHDA 3C09C 4P2RD 2X41A 1WHOA 4KK8C 3WKPA 5IROD 3B1UA 4PM1A 3KZ8A 3OX8B 4XPAH 5LNEA 1HWGB 3SDAB 5DTFB 3TU6A 3HG2A 2CH8A 3ULUC 4NRZA 4JO4L 1PEWA 4L1DA 2BRQA 5FM4A 2G9HA 3GB7B 3V0JA 2DD8H 3FO2B 5CN1A 3T6VA 2J8UF 2DW5A 4JKPL 4F8OA 1D9KD 4GQ9H 1C12A 4BFKA 3PUCA 4YHIB 5TFSH 1URZA 3DV6B 2ZXEB 4APQC 4BUHA 3S2CA 1ADQL 1N2RA 4A6YA 2V7HB 2WLJA 1VFMA 2GKIA 3VO0A 3ABGA 3FTVA 1BZDA 1N12A 1PCSA 7PAZA 2WVSA 3AROA 2XV0A 2UZXB 5FWQA 4LCUA 3VI4B 2CBOA 4BA0A 5TQ0L 2ILLA 3BP4A 5DHEA 3I9AA 3ZKNC 2C9UA 4FNQA 3CZUB 2B20A 1P5UC 1IM9D 1F13A 3RBGA 3RVTC 4Q8BA 4HKJB 4NX0A 4XXCC 3D48R 1YMMB 3Q8CA 5I1HH 3JUYA 2Q5BA 4ILDA 3VD4A 2FH6A 3GRGA 4PV9B 4BFNA 3S4SG 4YUEL 1ITBB 1GIGH 1K5NA 4K7FA 3SB3A 3KYOB 1J9RA 2K3HA 4PIBA 1MCPH 4RCAA 4CVZA 4ZMLA 1W9XA 43CAA 3MV8B 3QR1A 4S1QL 5DFTA 2X3AA 2PPFA 4FRWA 1YYLL 2WQWA 1H5BB 4U3SB 4OFIA 5KVDE 5DD5L 2NW3A 2AJ3B 5JXAL 2Z91B 1I1AA 3QDME 3QJFB 4UT7H 1IV8A 2AVGA 1A5FL 5EZLA 4KVNH 1MFNA 5IR1A 3BUYB 1M2OA 5E9AA 4MDRA 3W9DB 3CFJB 2WYIA 2F1AA 3SDYL 3B9KD 3ESOA 4OZFB 4MDIA 1ONQB 4GG6E 3GLEA 3EYVA 5DEFB 5EC2B 5KSVB 4ZMXA 4NBYB 1GRWA 3OXRB 3FUDA 3VRIA 1SZNA 5K9KA 2IWGA 1OP9A 2DIJA 2VRKA 2NZ9D 1OPGL 4NPYB 4YSRA 5A6MA 2ISDA 5ANHA 4DPCX 2Z31B 1QLRA 1VHPA 1G5GA 2AQPA 2OP4H 3REVA 1KIPA 5EU6D 1KZQA 3TV3H 1JPFB 4OIAA 2ZT9C 1YPZF 4N1HB 5T1LD 3SGKC 5D2LE 3KWWB 5C0JB 4U7KA 2R0LL 3LZFL 1XBDA 2IANE 1NFDF 4HULB 2N56A 3IXTA 1TF4A 2GIYA 3CFKB 3ATBA 2G3MA 3R06B 3V0WH 4AGPA 5KTEH 2D9CA 4G82A 4OJAA 1S5IH 5TE7H 1P9MC 4KJWC 4M7ZB 5TDNB 2MOQA 3MCG1 1YUHA 4JN2A 4ONFL 1UD8A 1U0QA 1ZVHA 4JG0L 4KK6C 2RB8A 3FL7A 3EFDH 5K5YA 4RMRA 3FQUA 3EO0B 5J3HC 2GIXA 4IW4C 2E7HA 1J86A 4PJ9B 4HPHA 4QO1A 4IBQA 4YXHL 1KJ2H 5CN3A 2PO6A 4RSYA 2LU7A 3FOMA 1IBZA 3IF1A 4JFEE 3FNKA 3VXTA 2NY4C 4XNUH 2R2BB 3LN5A 2IMMA 4CMHC 5E8EA 2CHDA 4E42A 3VFNA 1HHHA 4G9FD 1FC2D 4L8DA 4L2LA 4LL4A 4P23B 1I1FA 1RUMH 4M6NH 4HIHB 1CI5A 4UM9D 4EQ2A 4X6CA 1JV5B 1A7BA 1TTUA 2KQNA 4GI8A 4ZS6D 2HT3D 2B59B 5AZUA 5GZOC 4LLMA 1KN4H 1Z7JA 4CVUA 4IU3B 3RTQA 2NRDA 4ZT1A 1FNHA 1FNSH 3TTYA 5B38A 1MKFA 3VW3H 2W07A 4R2GC 2FO8A 2P8LB 2DWSA 3FRPB 1E7UA 4HCRH 3NIDF 3TONA 1A9BB 4R5VA 2DIAA 2HKHL 5DI8B 3D85D 4IS6A 1YEDB 3GKWL 4YHML 3TN0C 3MMEA 3VXMD 3A6CH 5I1LB 3IJSA 3FMGH 4AKPA 4LDLB 4OLWL 5IOPB 3DPDA 5EU7E 2BP5M 1L9NA 3LRLA 3BO8A 1DVFD 4YX2L 2EO7A 3VFPB 2KDGA 1NEZG 3AT8A 1NGYB 3CVIH 4JQXA 2VERN 2CRMA 3ZGHA 4XPGH 5FDWA 1GYAA 1S9XB 1E42A 2WUBH 3QNZB 2C7UB 3QWQB 3QEGL 4M61A 1WFJA 3KYKH 4TVPD 4BFGA 4YL4A 2W59A 1C5CL 1I9RL 1MQKH 3W11C 1MHPL 4FKHA 2LLLA 3L3KA 3NP3A 4YHOL 3DV4B 4PRHD 1OGPA 2WP3O 4ODHL 4ZOAA 3HN8A 3GMLA 3LB6D 3T3PB 4QXGL 3NGBC 3V0IA 4AY0A