1SNRA

Nitric oxide bound to cu nitrite reductase
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
336
structure length
336
Chain Sequence
ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
publication title Side-on copper-nitrosyl coordination by nitrite reductase.
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
total genus 91
structure length 336
sequence length 336
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2004-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1snrA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1snrA02
1AIZA 2CCWA 5A7EA 1AZCA 3EH3B 3QPKA 1WS8A 1JVLA 1SFHA 2N0MA 3AY2A 4YSAA 2WO3B 1AQ8A 4DP9X 3T6ZA 1V10A 2AFNA 4F7KA 1AS6A 1GY2A 2CALA 5B1JA 2CAKA 4E9RA 2IWKA 2XV2A 2XXGA 3OMAB 3AZUA 2FT8A 1NWPA 1PAZA 1ET7A 2PPEA 3NJHA 3ABLB 4HZ1A 4A67A 1NZRA 2PPFA 3HEIB 1RZQA 3FT0A 4E9VA 1F56A 2W88A 2HXAA 1X9UA 3PPSA 3ASOB 1PCSA 3V9CA 5I5MA 2QPDB 3FU7A 2JFCA 4KNSA 1KCWA 1AACA 3CDZB 4UANA 2LLNA 4E9YA 2YAOA 4MFHA 2XYBA 4G70B 1JZHA 4HALA 3PAZA 1ASPA 3DKHA 3OM3B 3UABA 4E9XA 1PY0A 4NERA 1E67A 4DP4X 2YAQA 1FFTB 4YSRA 4N8UA 1W6LA 1L9PA 3AW5A 2B08A 3FQ2A 4YL4A 2PPCA 1BQKA 1E65A 4GP5B 3TU6A 2XWZA 3HB3B 4PCYA 2TSBA 2AZAA 2H3XC 2CUAA 3NYKA 3AG3B 1AG0A 3QJRB 3WG7B 1KDJA 1WA0X 3FSAA 3IN2A 1L9TA 2XX1A 3T6VA 3X1EA 1L9RA 4DPBX 1J9SA 3H56A 3SBQA 2BWDA 1PNDA 2IWFA 1GS8A 3G5WA 1HFUA 2TSAA 4DP7X 3NJKA 3QJQB 2I85A 4WKXA 3TBBA 2FT6A 3KW8A 3QJTB 4A2DA 3WI9A 4DP5X 2IAAC 3D12B 1EHKB 1PLAA 1JZJA 1NWOA 1XB3A 1NINA 2PCYA 3QJUB 2VW6A 3H4FA 3TBCA 1GYCA 1W6WA 1PZAA 1AAJA 3AG4B 4P5SA 5I6OA 1ILUA 1NTDA 1AZRA 1JZFA 2H5UA 1OCZB 2HX7A 4Q89A 1B3IA 3NSDA 4YVUA 4AZUA 2YAPA 1NIAA 2DWTA 4F2EA 1NIBA 2QDVA 1AOZA 4YSTA 2GHZA 2VM4A 3FSZA 4KO7A 2H47C 2VMJA 2Y1AA 5I26A 1JXGA 3PLYA 4YSPA 1ADWA 1EZLA 3NSFA 3FYEB 4GYBA 1E30A 3FPYA 1JERA 2BP0B 2J56A 4UAHA 5D4JA 3S8GB 1SFDA 2P80A 1HAWA 2WSDA 1L9SA 3UAAA 3SBPA 3N2JA 4GP8B 2QPEB 2X88A 3ZDWA 2BO0A 4DP0X 3ERXA 2HLEB 3OQRA 3JT2A 1QHQA 4QKTA 3FPXA 2UXVA 2PP7A 3IEAA 4G7QB 1ID2A 2Q5BA 2JKWA 1SNRA 3ZIYA 2DYRB 2YXWA 4A2HA 4YSQA 1ZV2A 1RZPA 1W8EA 4P5RA 3UADA 3MX0B 1ET8A 3CG8A 3H4HA 1SDDA 4K9JA 4KNTA 2BWIA 1XB6A 1UATA 2HZHA 2PP8A 2UX7A 2FQEA 4F2FA 4DP8X 2BW5A 4KOCA 1CUOA 2VW4A 1GS7A 3ABKB 2EINB 1BXAA 1E5YA 2OJ1A 3U25A 2WO2B 1VLXA 1OF0A 4AKOA 4YSOA 2J5WA 2GC4C 3IE9A 1A65A 5PAZA 2Y69B 4UF7C 5B1JC 4DP6X 1R1CA 3ABMB 2ZONA 4N4YB 2CJ3A 1PF3A 3GDCA 2ZOOA 2YAMA 5E9NA 2FQFA 1BXUA 2MRYA 2XV0A 3X1NA 1WA1X 1MG2C 2J55A 3V9EA 1TEGA 1YLBB 1PMYA 4KOBA 5TK2A 3SBRA 4YSEA 3WNJA 1GW0A 2BP8A 1BQ5A 1MZYA 4YSCA 1CC3A 4BK5C 1N68A 3PAUA 2RACA 1OV8A 5AFAA 2BW4A 4W9ZA 2X87A 1KV7A 4E9WA 1AANA 2QT6A 4X4KA 1BXVA 7PCYA 2IDQA 2HX9A 2VSKB 3SQRA 2OCCB 3ZX1A 2DWSA 3X1BA 1ASOA 1FWXA 3X2QB 4ZK8A 1JVOA 2FTAA 2QDWA 2XLLA 4AX3A 1AS7A 1PZCA 3FU7B 4HHGA 1AS8A 1NIEA 3CZUB 3IBOA 2XV3A 3QJSB 2VM3A 4L0PB 2IWEA 3FQ1A 2HRGA 4JHUA 1J5CA 1M56B 2UXTA 2XX0A 2GSMB 4BDVA 1JXDA 2PP9A 3S3CB 4A2GA 1J5DA 3OMNB 3S3BB 2YXVA 1DZ0A 2R7EA 3NJGA 1QNIA 2EILB 3FSVA 2W8CA 9PCYA 2FT7A 2BP0A 3N55A 3NJNA 3T9WA 2BZCA 1WAEA 2FQGA 4G71B 4HAKA 1J9QA 5B1AB 1TKWA 2Q9OA 2IDSA 1OCCB 3TA4D 4GP4B 4BXSV 4GY4A 1BYPA 4HCIA 5I6PA 2IH8A 2GI0A 3S8FB 1BEXA 2JXMA 4E9QA 1ZDQA 5I5JA 1J9RA 1J9TA 3EF4A 1E5ZA 1MDAA 1ETJA 1AG6A 1RCYA 3NJIA 5F7AA 2CBPA 2PLTA 5EHFA 3DTUB 3S3DB 4HIPA 4CSZA 3T6XA 1PLCA 3C75A 2EIJB 3PAVA 2DYSB 1SHXA 2EIKB 1GR7A 4M4RB 3OMIB 4HHWA 1ILSA 2IH9A 2OV0A 1AR1B 1X9RA 1RKRA 4G72B 1M9WA 1T5KA 4A66A 1KCBA 1AZBA 4AI7A 4CSPA 1NPNA 5FC9A 1NICA 1SJMA 1PLBA 4E9SA 1XMEB 1AZNA 3IN0A 1DYZA 1OCOB 2GBAA 5I6KA 1ZDSA 2BZ7A 3CVCA 5I28A 8PAZA 3NT0A 3RYMA 3QJVB 4A2FA 4TXVB 1KBVA 4RH4A 4DPAX 3NJFA 3ABGA 5PCYA 3CDZA 4JHVA 4BWTA 3X1FA 4ENZA 2MTAA 1FA4A 1A4BA 1JZIA 1BYOA 1CYXA 2XUWA 3WKQA 1JZGA 4M3HA 3WKPA 2J57A 3PXLA 1OCRB 2A3TA 5B7MA 3X1GA 4GXFA 4YSSA 4AKQA 2VN3A 1IBZA 7PAZA 2PPDA 3DIVA 4W1TA 1L9QA 2VSMB 1KYAA 5B7EA 2YARA 5I6MA 3GXUB 4KO9A 2FWLB 2NRDA 2E86A 2YAEA 1SDDB 3ZBMA 1KGYE 1OOWA 3KW7A 4DP2X 2YAFA 2AANA 4DP1X 1NPJA 4YSDA 3NSCA 5B3SB 1WS7A 2UX6A 5F7BA 2VW7A 1JZEA 1KBWA 1GS6X 1L9OA 4BWWA 1CURA 3UACA 4AKPA 3CVDA 2FNWA 2FJSA 2I7OA 2BHFA 3NJMA 1MZZA 1V55B 1ZPUA 2IDFA 2AZUA 2ZWNA 4KO6A 1NDTA 1GSKA 3ASNB 1TEFA 1ET5A 4BXVA 2HRHA 6PAZA 3EHBB 1KDIA 3EH4B 4QLWA 2ZXWB 1WA2X 1ASQA 3FYIB 3NSYA 2IDUA 4KO5A 3CVBA 1GY1A 1V54B 3QQXA 3PCYA 1OE2A 5TK4A 4E9TA 2BP8B 3BVDB 3TASA 2DV6A 1M57B 1XB8A 3MBWB 1SF3A 5AKRA 2UXGA 2YAHA 3T71A 3OD3A 2DY2A 1OE3A 1BAWA 1ZIAA 3BQVA 2FQDA 4G7SB 4Q8BA 3FU9A 1A4CA 4FA7B 5IY5B 1JXFA 1A8ZA 1BQRA 1QLEB 4YVNA 4BWUA 2XU9A 1ZIBA 3T6WA 1IBYA 2GB2A 5B1KA 5B1BB 5D4IA 1I53A 4G7RB 1IUZA 2YQBA 3WIAA 3FSWA 5B7FA 2GIMA 1URIA 2UXFA 3L45A 5I6LA 3JTBA 4BDVB 3FQYA 5D4HA 6PCYA 5LDUA 3EH5B 1NIFA 1OE1A 3WNIA 3NP4A 1NIDA 1PZBA 1HAUA 2B3IA 2R7EB 5I5IA 2I7SA 1A3ZA 1SHWA 1IKOP 2PPAA 2XXFA 5ANHA 4HCGA 1TU2A 4A2EA 1IC0A 4A68A 1SF5A 3NJJA 3AG1B 5I6NA 3UAEA 2PCFA 3FS9A 1PNCA 4YSUA 4KNUA 1A4AA 1JOIA 2GC7C 2HX8A 2P80D 2XVBA 4NAJA 1AZUA 2IDTA 4PAZA 4WTQA 4HCFA 2EIMB 1MG3C 3FU8A 5AZUA 1N70A 3AG2B 3UGEA 4NB7A 4DPCX 2AVFA 4JKNA 3NJLA 1CYWA 3GYRA 4FAAB 3NP3A 4EF3A
chains in the Genus database with same CATH superfamily
3QFGA 1DP0A 4P2RB 2LOEA 3VGAC 5CZVL 1FLRL 3QVAA 2WLHA 4PJ5D 3MV7D 4FI7A 3WMPA 1IC5H 4P9HH 2X4OA 2R23A 1DVFD 1E3ZA 4YE4H 4YJZL 1AS6A 1T80A 4AV5A 4PIRF 1IMHC 2WLJA 5AW0B 4P9HC 4Z7VF 4QHKJ 1XSJA 3H53A 1LO0H 1PVHA 2PPEA 1FE8H 2W0FA 2R2CA 4JHZA 2LVEA 4WTWA 2WXPA 4G2AA 3ARUA 5B39B 5IK3B 1RUKL 4GW4B 1HCYA 1MN4A 3WU1A 2KI6A 4K3DL 4QRPB 3CDZB 4XC3L 3TA3D 1YPZE 4BZ1L 2WMPA 2NZ1A 1Q94B 4NM4H 1WZ1H 5AOLA 2KT6A 4HALA 5F96L 2OSXA 1F4XH 5DQ9A 3QUZA 3N04A 1PY0A 5I8CA 1FZKA 1FF5A 3M45A 3AREA 2W91A 2G3MA 2X10A 3QCVH 1CF8L 1CICA 2NNAB 3DO7A 4EXPX 2QADD 5F3FA 4GP5B 1Z1WA 1MCRA 1JK9B 3LKRA 2DQHH 3GJFB 2IG2H 1EO7A 3L4TA 3WIHA 2AZAA 3NEXA 3LQAL 2EEBA 3U48A 2XKUA 1R24B 2GJRA 4XPBH 2OK0H 3QDGA 4LKXB 1G7HA 1KDJA 2W0KA 3IMWA 3MSPA 4OCXH 4QHLA 3UTPE 4WK0B 2ADIB 2WKOF 4P2OC 2JVUA 5E70A 3W56A 4P9MH 4NO0A 1CGSL 2H2PD 4NYLA 4TLKA 1KCLA 3J7HA 2HT2C 1HHJB 2TSAA 4H8VA 4WNJA 2YMTA 3LZLA 4HUXB 3C6LB 4XI5D 5CHNA 3D12B 1DJHA 2VLLB 4Z18A 2WYTA 4PJHB 2LLLA 4KROC 2VW6A 4LSSL 1OO2A 2ADGA 3I6KA 1SBSH 2XG4A 2Q3AA 3ECVA 3K2KA 3KDMA 1RUPL 3PABA 1A6PA 1Q1PA 1DQKA 1ETB1 2GSIA 4RDBA 5F6HI 4PJ8C 5DYFA 4LQFH 4ODWB 1AZRA 1CFBA 4C56B 4LLMB 1IQDA 1OCZB 2XQYA 4WI4A 5JW3L 1JGDB 2YSSA 5AW6B 1P6WA 1G0XA 5GGVY 1KCSL 3IVKB 4G6MH 4HKXB 3FSZA 3OZ9L 1DO6A 1U92A 3LOWA 4JPIB 3DVNB 2XTSA 4WUKL 4XN5A 3VQ1C 4JDTH 1DDHA 3PGFH 2BSRA 2YXMA 3F5WA 3OB0K 1XF4A 2WLIB 3VXRA 3BRGC 5ICUA 1J5IA 1JPEA 3HG1B 1HHIB 5JZ7D 3B7RL 2B59A 3ULUH 3UCQA 4NWUL 1RP8A 4NAMA 3JZ7A 3N2JA 4JFHE 3VGGA 4YR6A 4OLZH 4JFPB 1ZV5A 3MLZH 1B3JA 3JT2A 5D96C 1CGXA 3D0LA 4K8RL 3ARFD 3WXWL 2BP3A 2DQ6A 1ID2A 2AXFA 1A5FH 5BZXA 4PRPE 1CXFA 4NO2A 1I7TB 4CU7A 4PJ5A 3BHBB 3ZE0E 1DVFA 3LRHA 2G4GA 3PWLB 1RZJH 3GSNL 2DEYX 3IT8D 4P3DB 3ISYA 3D51A 3W11C 2CR6A 3P2BA 4Z7QE 4U6VH 1QR1A 4BGDA 4OKDA 3UBXB 2IC2A 3P4NA 1QEXA 4HGWA 1GTNA 3V0WL 1AQMA 4G8GB 1E5YA 4O2EB 3RWHB 2R1WB 1SMOA 5E8NA 1N6VA 1PLGL 3MCKB 1BIHA 1ZLWK 1FN4A 4MBRA 2X6CA 5FK9B 2HTKD 3TO4C 5L9DH 1A65A 1J18A 2X7LA 1F13A 4PJEE 3IU3B 3GSRA 1EO8L 4HF5H 4H0LC 4TUKH 2JTDA 3EJZC 5AL8A 3FOLB 5CN3A 1AR2A 1ECYA 25C8H 3PQYB 2WLMA 1WA1X 3LXAA 3MRNB 4KX7A 4PP2B 2PYEE 4MXQC 4GAJH 4NIKB 3BO8B 1QTPA 4DO6A 1T83C 3LXUX 1R4XA 4DGYH 1ZSDA 1FAIH 3PWUB 4NGHL 4DVRL 4AJYV 3LZQA 2OPCA 1ZEAH 2IPUK 3DO4A 1E9OA 3QUZC 3QZBA 3TWCL 3VW3H 4IQHA 4HJ0D 4LIQH 4QTHA 2UUDH 5DVOA 1BBDL 3AREC 2ZP8A 3GXPA 3RX7A 3QQNA 3MRDA 3GB7B 1CICC 1ZT4A 2A9NH 2IDQA 5DJ8A 3WIHH 1WH0A 1UM5H 3PP3K 3WJJA 4S1RL 4P5TC 3GRWL 4KHXL 4XWGH 3RNKA 5C0CD 1PY9A 1NH6A 5M95B 3D50A 2DRUA 4ZXBC 1AS8A 1C7SA 4L4VD 3NDYE 2XA3A 4N2NA 1EMTH 3ZTNL 3TPUA 2GAZB 2XX0A 3P11L 5I8EA 1CFQB 4L23A 2BP5M 1IAII 2H1XA 3L1GA 5C0BB 1FFNB 3UZQB 3DSNB 5SWSD 4U1JA 3VE0B 4CVXB 2K3HA 5JHLL 3BESR 3CFJA 2BY3A 1QLEL 3IXAB 3TJPA 3HC0A 3L4UA 4WY7H 5B1CA 4YX2L 4GQ9L 3IFNL 2YPLB 4XB8A 4JRWA 2DMKA 1ZHKA 4KQ0A 3I02B 4NUPA 2VDNL 1FH5L 1MJ8H 2DQTL 4C4KO 1ZTXL 3PGDA 1EUUA 4L3CA 4M48L 3CZFB 1U8LB 5I74C 3OAUL 3WGUB 3LEXA 2IANA 2WO4A 5I6PA 3N42B 2GCYA 2IIJA 2MMXA 3ARFA 1MFBH 2GK0A 4NC2B 1ETJA 3TJEH 1D9KB 4HUKB 4X5XB 3UTTB 3A4EA 4WO4C 4MJ4A 4NP9A 1QO3B 4CSZA 4ZTPL 4GQPH 2QJDA 4AH2A 5IVZA 4QXUH 5TDOA 4D0CA 5DJ0B 2OMNA 4DF9A 5KBDA 2OV0A 5CZXD 4Q14A 1ZK9A 2WHVA 4OI7A 4IDJH 1S7UA 3G6AA 2DH3A 2WB1A 3JWOL 3UO8B 3ZL2A 2FR4A 5CZRA 4HIQA 3KPRE 1SJMA 5BV7C 4N8PA 5EOTA 5T1LD 3ZT5A 1W2KT 4UQCA 3RI5K 2J8UF 1TR7A 2XNAB 3N40F 3UFIA 3V95A 4NXKA 5GSRB 5DJXA 4DKAA 2W9DH 4P05A 1MJUL 2G2RA 5D2NA 4W6WB 4JHBA 1V7NH 2A9ML 3OKKA 3FQRB 4QRPE 1EAJA 1TJMA 2CK0L 4J3OF 5C0AB 1U8OB 4H0HB 2GUYA 3W2DL 4OV5B 4Q9RH 4R9HA 2X0WA 3J8F7 4Z9KB 4HMCA 1RVFL 2J57A 3OL2A 4L4TB 1MJJA 3FN0L 5FDYA 4A63A 3T2NL 2ZYSA 4P23A 3VRIA 1KENH 2VMDA 1D5IH 3F85A 3BW9B 2A6JB 3TA3C 2IPKB 1L6PA 1DQIA 2VDOH 2ITDB 2PPDA 1F3DJ 5KVMC 1QFUL 2F18A 3QULA 1BM3L 2HT3D 1U8QA 4Y2DC 5KSBE 3ZO0A 2UYLB 2IO5A 3TV3L 1BAFL 5CILL 4XN8A 2RALA 3SKJH 5JORB 5MEOB 4KO9A 4XXWC 1INQA 2WXJA 4AL8L 5EC1A 2V33A 3WFHB 1T21A 3KLLA 4NIYE 3KL0A 4YXKL 4ZMNA 5D2LB 4YZWA 2QADC 3FTYA 2LU5A 3SJVB 2H0PA 3OZKA 4W4NA 2QMKA 3MN8A 5FO7B 4QTIH 5K9OA 1XT5A 2ZIDA 5EBGA 5FF6A 1A6TB 1QFWI 5CWSB 3K5SA 3VFWB 2PYFB 1MDTA 1A9EA 1MHEA 3QXAB 2DQIL 4FLSA 1M1SA 1BLNA 4L4VA 4N2FA 1JHKH 4KFZC 3U2SA 2BNUA 3VG0L 4JPKH 3VD4A 1OF2A 4C56E 1ZS8A 3EDEA 4XI5C 2YLHA 1PD1A 2ZWNA 4ZUTB 4BBWA 5JMOC 3K4DA 4JDEA 2C7FA 1NEZA 3FCBA 3L3DA 3LKPA 3SE3A 4XE5B 4ADGA 1M6OA 3B37A 4LLDB 3I9PA 1ZT7B 4IHOB 3BVNA 2JK5A 1OWRM 1AIFA 4E9TA 3HG1E 2BSSB 4OUUA 3GMQB 3CNKA 1DQDL 5IV2A 1PD0A 1DLHB 2NXYB 1OPOA 3QEGL 2OBGA 2YGPA 3SB3A 2UXGA 4BHUA 4EZJA 3RUGB 1BD2A 4KMQA 1OE3A 3D9AH 5AOZA 1SUHA 4AQ1B 3BQVA 4U1MB 3CLEL 1OT4A 1K3IA 4GMSH 1BP3B 1YAZA 5DQDL 1XQ4A 2Q10A 4ZJ9A 1A14H 2Y7LA 3CAFA 3QIUB 4NOBA 5CBEA 5JZ7C 5DK2A 5KVEE 4HDIB 5TFSL 1CXEA 2HB0A 5K1NA 3QIWA 5E6ID 1EA9C 4MD0A 5D7EA 5FS5A 4F15B 5E24E 3LKOB 3G5XB 4PY7A 3RBSA 5TE6L 2HJLA 1IGJA 3JWDL 2G9HB 4YGVB 4HGKC 4Z7WB 1DJIA 1FPTH 1KLFB 2VYRE 4NJAL 2ORBH 4KDTC 3VSUA 4X4ZA 3ARFC 5I6LA 5T1LA 3QSKB 1OSZB 1KT2A 4JNXA 2BJMH 5LDUA 4NRXB 3QDJA 4J39A 1NIFA 2VDMH 4W9FC 4G8GE 1I3UA 2MPAH 3QNXA 3C9NB 3KBHE 1N6QL 4KHTH 3X12B 1SHWA 1IKOP 1GPOH 2HG0A 1JPTH 3FO2A 3H85A 3V4PB 4YHNB 4L9DA 5ACZA 3PGCB 3K4ZA 2B9BA 1NBCA 3KJ4B 3WKMH 3MRMA 4DK6A 2LABA 4JVUA 4N0CD 1WHPA 5J56B 4WW2F 2A9AA 1ZVYA 1Z5HA 1WFUA 1MOEA 5I1IH 2HTKC 2ZCLL 3PQYE 4YHPB 2DM7A 3QIBA 3BMVA 2AQPA 5D2NC 5HYJB 1J8HD 3GMOA 4JKNA 2XN2A 5F7YC 2VLJD 3DJSA 4K5LA 4I88A 4QRQA 4X7FC 1A1NB 4K55A 5E51A 2ZNWA 3WN5B 4N8VA 3RURA 1AZCA 1UWGH 3QUXD 5EN3A 4BH7B 2R27A 5EIIG 4Z7VA 2A7BA 2HFFA 3VXTA 3TYGL 4E9RA 3Q2LA 2VDPH 4NQXB 5C0EB 4YUEL 3K6DA 3V0HA 1H3UA 4JFDD 3O41B 4FQJL 4XO5A 3AU0A 1MAMH 3PV6B 3QQDB 1QNZH 1JVKA 4UQEA 1MUJA 4HJ0C 4HX1A 2BVOA 4CVZB 4RMQA 5AAWC 3UZEC 2FECL 3KXFD 5F70A 3FULA 5BRQA 2BNRB 5LAXA 1PY4A 4WEBH 4Q9QL 3FU7A 3CFUA 2C3XA 3GSVA 3H7BB 5EU7E 5FECA 1F11A 4MFHA 4OD1H 1Z9SA 2ED8A 43CAB 4I0PD 3H2QA 5C0BE 3K8MA 4JG9A 1KXTB 3UPAA 3GINA 5DD3H 3T0WA 1RU9L 2WCPA 3N50A 4L2LA 4LSUH 1R0AL 2JWYA 3MO1A 1U8CB 5DJAA 1HCFX 1BQKA 1CE6B 1MRFH 2VN4A 1VDGA 2PPCA 1DQLL 3EO0A 3K2MC 4J5VA 5TTRA 4GH7B 3VXMB 3QORB 4GB9A 2XWZA 3HB3B 5L8LB 1Z2KA 3L3HA 2FO4A 2R1YA 2X0VA 5KBMA 3QPQD 4GS7C 4ZW3A 3GJEB 3NBNA 4G8FB 2G60L 3HS0C 1F45A 2VRQA 1BF5A 1B88A 2FH6A 2DDQH 2XX1A 2OXGB 3IFPA 3GO1H 3UTZA 4C58B 1E28B 2X12A 4AGMA 4YHYB 4ZMYA 3H54A 5DUPL 1YC7A 5E6IA 2RQ8A 1A9BB 1MXGA 1LVEA 5KVFL 3KYKL 3T4YA 3NJKA 1BZQK 4PH8A 3CHXA 4A6YA 3C5SA 1IFRA 5JXAH 2DLIA 2K78A 3M1BA 4PJBF 4TVPL 3W0WB 1TJXA 1PLAA 5HYEA 2VMCA 4ZSOA 2EVFA 4IGBD 3MXWL 5JQ6L 1VZHA 1X7QB 3CFEB 4UCFA 2E6PA 5TE4H 2IBZY 1P7HL 4XMLL 5DUBB 3MLUL 5JA8B 4P46D 1AE6H 1K5NA 1KCKA 5F21B 5E4EC 5JNYB 4OU3A 3V0GA 4HUWA 5CZXC 1GKEA 1YHPA 1MQKL 1ZHBA 4JRXB 3LSOA 4NX0A 4RFEA 2C1OA 2B5IB 1S6NA 2E7MA 4J2QA 4DW2L 3C08H 4ELMF 1Z0NA 3FQNB 4UAHA 1ODAA 1IM9B 2CRZA 4LU5H 5C0AE 3WJMA 4R4FL 4B9PA 1ACYH 4HIXL 1S7QB 2X88A 2AK1H 2JKJA 2APSA 4L8CB 2UVFA 2RTTA 3OQ3B 5IGXL 4L4TE 1QQDA 5KJRH 4ODBD 5D7KD 1UB5B 3OKLA 1JGVL 2R2BA 5JO5A 3ARYA 3PU7A 3HI6H 3VU2A 3GHEH 3Q48A 1CFNB 1E6JH 3QUXA 1K2DB 4M62H 2HMID 2B4CC 1N67A 1I4FA 2J6EL 2DZEA 3B5GA 4M8QA 1VJSA 1RI8A 2BVEA 3QUYB 1SDDA 2H8PA 4JFWA 1LEGB 1H9DA 3X3FH 1UUSA 5D2LE 3SJVE 3ELQA 4KOCA 1IEAB 5EEXA 2HT3C 4LL1A 4AW7A 4LCVA 1EXUA 4IKKA 1MVYA 1R3JA 5K93A 4QRRE 4ODXA 1ZHNA 1IKFH 3A6BL 5HGHB 1S9VB 3VXPB 3KXFA 5J3HD 3BPLB 3HBGA 3K72A 4BSWA 1TTCA 5HD8D 5BQ7A 1MCPH 4J3OD 4W4OA 5L2KB 4FP8L 1A6ZB 4HT1L 3U7WL 1NGQH 1DUZA 1EZUA 4M5ZL 4O2FB 3GZQA 3C5JB 3OR6B 4LBAA 2F54B 3O2WH 1RPQA 4XOEA 3ULAB 1BV8A 4W93A 1S7TB 4AVKA 4M5SA 3EBHA 2FE0A 5E1AA 1G9EA 2J55A 1WAAA 3CFCH 3FNKA 4HS6B 4KOBA 2MHAA 5E99L 5JXED 4B5EA 4BFIB 3C87A 1JHLL 5CS7A 1E4XH 2BFGA 1UYWH 2X4QA 2E27L 1IFHL 2I07A 2WAQA 4QY8A 3RUGE 2BW4A 4PP1D 5LBVA 3N41B 1KPRB 3KEHA 4GKNA 1QPKA 4MMYA 5IB4B 1EDHA 3F04A 1GMIA 3GMNB 3F62A 4IGBA 1GJWA 3RAJL 4LDLB 5LNEA 2E76C 1MKFA 4HU8A 4KTDH 5BVJA 2DAVA 1NIEA 3IMRA 2DJMA 4E41D 4PV8B 2AQ2A 4P46A 5FGBC 3QZWA 2ZJSH 4A6YH 3L3OB 4JPVH 1FQ9C 2Q1EA 1MCSA 4U2ZA 2ZXEB 5JHBA 5J11B 1JD9A 3AXHA 3MLYL 5FB8B 4XN2A 5DEFA 2WYZA 3P4OA 3PIQB 3BUBA 5IBUG 3V6FB 4JFOA 1OZUA 4J3WA 3TGXA 1VFOA 4GAYA 2VAJA 3WMSA 1VSCA 2DTSA 1PZDA 2M8XA 2DWEA 2BOBB 3CDGA 4LEOB 2IDSA 3V2AR 5BRZD 3ZTJG 1OY3B 4MA1C 5IFHL 3EOYG 4N2LA 4EKJA 2FSDA 4MNQD 3RY5A 5J13B 1Z32X 1KJVA 1RUAH 4IHBA 2XZQH 4HUVB 3SOBH 3UG3A 2IH8A 4ZMWA 2ZUQB 4G43B 2IH1A 4CRPA 4MNGB 2FZ3B 3U9PH 4F20A 1AG6A 5HYJE 2F19L 3HRZC 4P3CH 1KXQE 3F7YA 5J4MA 4AXWA 4N0CC 4PHXA 1UWXH 2VDRL 4LLYA 3RG1C 3CFKB 1WYJA 4M4RB 3IJYB 3OMIB 1CDJA 4HUNB 5FM4A 4ZUVB 3U30C 1GYAA 1FO0H 3C8KA 1B2WH 4PSRA 4GKSA 1FORH 1B0IA 4PG9A 1T5KA 2YLKA 1QBML 1KCBA 2VR6A 4BCXA 5JHDE 2HCZX 1T5WB 1T1ZB 2NT0A 3JV0A 1QSED 2AMUA 3FOMB 2J2ZB 3P02A 3ZL4H 3QUXC 1KXVA 2MJWA 2ZAGA 5C6WH 4FFWD 2BNQB 2GG1A 3MI6A 1EHLL 3GSWB 2BNRE 3DOHA 5C0DB 2P5PA 2X3AA 2NUTB 3GSNB 2BLFA 1RHHA 2A4CA 2FLRT 2OM5A 4UT9L 3RILA 2DL2A 1M7IA 1PBYA 3MLTB 1XDTT 3QFDB 4ZUSB 3SY0B 5EF0A 1PZ5B 4ZT1A 3WFBH 3WO4B 1CI5A 1A4BA 1OAQH 3ME0A 4JY5H 5GS2D 3GTVA 2CO1A 3PXLA 3FSOA 3CLFL 2WXRA 4U0RC 5GS0D 3FRUB 3OLDA 3ZYJA 2AJYL 4XPTL 2D7OA 1FNEA 3PHOB 4Y7OC 4Z76B 3VXME 4G11A 1HHHB 2DQFB 4I0PC 2AK4D 3FB7A 4LP5A 1LQSR 1QI4A 3CFBA 4KKCC 2OYLA 2V7HA 5JIKA 3ZBMA 1D5MA 5CR1A 5ADOH 1W9XA 3HE6D 1CTMA 5IVXF 5DRWA 5GRUL 4A7GF 3MU3A 4JG1L 5AZ2L 3RY6C 1NPJA 5EZIH 3VH8A 3EYOA 1WS7A 4P2CG 1HESA 4MB3A 2CA3A 1FH2A 1MREL 3ESPA 3AXIA 5IBLD 4HEMA 3VJ6B 1EFXD 3AC0A 4XOCA 3S34L 2ZUXA 1RJYA 1V3LA 4XZ4A 1N59B 1EX0A 5F1KC 3D69A 1T20B 2P5WA 3E38A 3O4OC 5IEKA 1YEFH 3NABH 3UZVA 1WJ3A 3NFSL 1MZZA 5B3JF 1S5HA 4LLQB 4NJ9H 4Y9FA 1Z9LA 1FNSL 2HT4D 1F8TL 2BC4B 2EVGA 4XVJL 1NKRA 2AV7A 5T1DH 4KVCL 4IGBC 1TEFA 4OF3A 2Y06L 4GW5B 4IYKA 3BAJA 1D6VL 3EH4B 1UA3A 4AY0A 3T0ED 5I23A 3L5WA 4CSSA 2QVIA 3LN9A 4RGOL 5BRZA 4U6YA 3G08A 4P46C 3TBYA 4K7PH 4GRWH 4ZUUA 1PX3A 1QABA 2WKLA 2DV6A 1I7RB 3BXNA 1CFSB 1NM9A 3VVVA 1KJ3L 2WTOA 2FIKA 4AV0A 2UY7B 1MAKA 3CFQA 4GLRH 3OJ2C 3JTSA 3QDHA 1DQMH 3CX5K 5DZ9A 3UH8A 4WCYH 3QYMA 4I89A 3Q1EA 1OCWL 4WHTA 5BS0A 1NGWB 1G9NL 1L7TH 2OP4L 1QLEB 5DWUL 2KKQA 4KMTH 1C12A 1RZIA 3P3TA 1E6OL 3N85H 2P42B 3GI8L 3OB8A 3TZVD 2QLVB 3T6WA 3GPSA 4FERA 2VDNB 5I1LA 1E5AA 5KOVC 3F6LA 1IUZA 4OD3H 3CDFA 2XA8H 2R59A 3GC3A 4PS4L 3FSWA 3O3BA 1AKJD 2GIMA 2UXFA 4MASA 4OJDH 1CU4L 2EH7L 5DD5L 3BH4A 1PS3A 5K1JA 2HMIC 3WNIA 5JPNA 3Q6GH 3SGEH 1EXHA 2OULB 1PZBA 5FCUL 1Z3GH 5CMAA 1N0LA 3IDYC 1R75A 4RGND 3TIDB 1A3ZA 1TU2A 1EK3A 3AQDA 2XTJE 2R69L 3CK0H 3LZFH 2CO6B 3BWUF 4Z1PA 2DD8H 5L2KE 1A3RL 3AG1B 3VB9A 5D7IF 4TSBH 2AF2A 3FN3A 4PJ8B 1Y6NR 5HYSA 5GHWL 3P3UA 1T7ZA 1E4WH 1KXVC 1UWFA 4GRLB 5J3HC 1MI5D 2VUKA 2F54E 2Y36H 1L5GB 2ENYA 4KI5F 5HD8C 1KIQA 4J3OC 4OLXL 1XR9B 5ICYA 3I2CH 4JHWL 2AXJA 5F7FA 1IC4L 2QKIB 2AK4A 3VSQA 2WOBA 1AMYA 4OQTL 3U36A 4BELD 5G4MA 5HHQA 3W1ZA 3SE8L 1WS8A 3O3EB 4LSVH 5I8OL 2AQSA 4J6RL 2CLZA 1TMQA 2HFGL 1LE9A 3HE6A 4PR5A 2AFNA 3QO0A 4FHKA 3PXJA 3TIEB 2CUIA 3M46A 3WL9B 3EBGA 5JXEC 3N43F 4PGBA 2IGTA 2XV2A 3H2WA 4RMUA 5D96B 2X70A 3SBPA 3BWZA 1G7IA 3KWUA 1EFXA 1U0QA 1T5XA 3MV9B 1Q90A 4HIEB 1CLZL 1MHHB 3P0YH 2F7QA 3EJPA 4JFFE 5I1HL 2R29L 4LCIL 3HNTH 3CGTA 4OF6A 1H3PL 3FBKA 3V5KA 2IGLA 3CXDL 5E9AA 4XAWH 1JPSL 3L95B 4JY4A 3EOTL 3RU8L 4FXKC 4ZFQA 4AJVA 1HT6A 4QHNA 2XYBA 4QOKA 2A73B 5DS2A 4A04A 4LGRB 3OPZH 4XBMA 2FJGB 3POHA 1R5IB 3DSFH 3MUJA 4X5WA 4F58H 2LT9A 1IV8A 1PQZB 4KXBA 3IXTA 4PG2C 3BZ4B 3EYSH 3FONB 4AQ8A 3FT1A 2YA1A 2P47B 3RNQA 3EHBD 4LZKA 3L3KA 1SDAB 1NCBL 2PTUA 1XCXA 2ICWJ 5D72H 4CW1B 1EJOL 1QLRA 5EOCJ 1UA6L 2QELA 2P1YA 3D1MC 4H88L 4MCNA 5CUSH 4YDLC 4AZ8A 3FL7A 3WG7B 4X7EC 4AUYA 3GDBA 3MKKA 1MCCA 3EO1B 3TF7C 4FCHA 1XBRA 1CR9H 3PP4L 2YPVL 4UDTB 5GS1C 4IRSD 5K9QG 3ESOA 3VDCA 1LO5A 5FHBH 2OMXB 4GFXA 3G5WA 4FYRA 1P4LB 1WUZA 4R26L 4Y16B 3TBBA 3O6FA 3HLAA 1LGVA 2WGNB 4FL4B 4PRIB 2G4EA 4IKIA 3KL3A 1TCMA 4UAOC 3RTQB 3DMMA 5DF0A 1QZNA 1AO7B 2UZIH 5I19H 3BUDA 2OTUA 5ILTL 3Q2NA 3AG4B 1VFUA 1NFDA 2V3EA 1ZLVK 4D2NA 3R8BB 3KPOB 4XOAA 2VLRD 1LJMA 4YVUA 2YAPA 4WFGD 1TIUA 1XGRA 3ATDA 3GSQB 3P9MB 2BFVL 1E9QB 5IFAH 3GT6A 3RDTC 1KEGH 1AD0A 3QR1A 1OTTD 4U6HA 2ZXAA 2BNQE 4ELMA 1KN2H 3OKEB 5JLZB 3G9VA 3QXDA 3HRPA 1JK8B 3X3GH 3VWKB 2ATAA 2ENJA 1A2YB 2QVKA 1UD5A 5C07A 5FYJU 1ADWA 4ZXBB 2O5XL 1KYUA 2LR4A 3NPSB 1CDUA 3T77A 4WO0A 3QW9A 32C2A 5H2BA 4YPJA 1MI5A 5JPNC 1RUMH 1E8YA 4FFWC 4M8UA 3H9SA 1B4JL 3MLSL 7CGTA 3ZDWA 4BK4A 4JM2F 1JV5A 4DZBB 2EKSA 2DBLL 4IMKC 4WEUD 3OF6D 4S2SB 3QFJB 2JELH 4WW2C 1A7RH 3FCTB 3MTXA 4NKMB 3WEMA 4DVBB 4U1GC 3BDBA 1X5ZA 4B9CA 5BO1H 1OKEA 4I0KA 2YXWA 5GS0H 2F2HA 4YSQA 2BOCA 2P49B 1QPPA 4V1DB 3DV4A 3KS0H 2BSED 1RZPA 3M8OH 3VFPB 3MV8D 2AKRA 2Y7NA 3NH7H 5F1NB 4LP4A 3K3QA 3SQOH 5CD3A 3C8HA 1IVLA 2UX7A 2FQEA 2VISB 3E9TA 4F2FA 5KVDH 2WN2A 4UYPA 4ES9A 4L5FE 1MHCB 2F53B 2VABB 1H3VA 4WO4B 3GMMA 5E08L 3NZHH 5D7JA 4KGLA 3IJ8A 4CMMA 4H13C 1UENA 4L8DB 4P06A 4CGUB 1NCAH 4AG4H 4FD0A 4LCCB 1NAML 3JV6A 5DC0A 1WV7T 5I30L 2WQAA 3MRPA 2NSMA 1BQSA 1GHFH 2D7QA 3QUMA 5E8DH 1KIPA 1QPXA 1NANI 4M3JA 4UDUA 5A3ID 5L0QC 2HKFL 3OC5A 3QG6B 5BV7B 3GDCA 2D31B 5SV4A 5IBLC 3GEFA 2C1PB 3U1QA 3GWJA 2A77L 3QAQA 4NNXB 3UC2A 3DRQB 1FJ1B 3QQ3A 5G5DB 1QZ1A 2Z9TA 3HNVH 4G1MA 1V27A 4P59L 5D6CA 5HHNA 5GRVK 1U8NA 3WNJA 2HT4C 5KVGL 1PYWA 1A1OA 3SY6A 3UBHA 1HYSD 3ROLB 3WTWA 3PWNB 5DD1H 4AC2A 3ZY7A 5D1ZD 5IHHA 2B77A 5DZVA 4BK5C 4O2CA 1N68A 3QEQD 2A74C 4O02A 4IRSA 3T0EC 2QT6A 5I1GH 4ZPVA 1PG7W 3MNWB 2K3TA 4UQAA 1JV2B 5SWQB 5LXGL 3L9YA 3STLB 1KG0B 1M9SA 3MYJB 5IJVA 3KYNA 1A0QL 1GC1L 3E3QC 4Y2DB 1JJUA 2V3DA 4HJTA 3IAPA 3WAKA 3X2QB 3JTTB 2W07A 4QGTA 4XNQA 4HBCL 4Z95L 4H26A 4HHGA 1IGFL 3QJSB 2QHRH 4N2OA 2PNDA 2ZSWA 4GSUA 2VLRA 1BQLL 3J07A 2QADB 4FLQA 2R1XB 5FM5O 4EUPG 2DWYA 4IOFD 4JQXC 4PBVC 4XHJD 3TN0B 3TZVC 2WUBH 2E6JA 2NSQA 2NW2A 2LU4A 3IJHA 4G9FB 2EP6A 2PWDA 5GPRA 4GW1A 4F1SA 5LN4A 3KWVA 1FVEB 2C9QA 2BZCA 1SOQA 2BIMA 3FKUS 2VQUA 1E40A 4ABUA 5MP6H 1WO2A 1KC5L 1RJZA 4ENED 4QO1B 4E9LA 3W9EA 3DGGB 3TF4A 4MD4B 5EU6D 5GGSB 1ND0A 4XO4A 3P0GB 3B9KC 1BSIA 4RGNC 5T3XH 2ATKB 2SEBB 3JV4A 4HIHA 3OAWA 1B0RB 2JB6A 4B50A 1BEXA 2JXMA 2FSEA 4AQZA 3L5JA 5ICXB 1HZHL 4FXGA 1T1XB 1IE5A 1SXBA 2YO3A 4NC1C 4Y19D 1UH3A 2ZPKH 3LDBC 2ICCA 3B2XA 4XMPH 3T6XA 4DHLA 1TPXC 1HU8A 4F7MA 3MV8A 4J27A 3WGVB 4WKZB 4ODHH 1PPIA 1ILSA 2JCCB 3IDIA 1JGIA 3AGWA 2VITB 4G72B 1KN4H 1UUNA 35C8H 2F0CA 1OB0A 1Z9PA 1AZBA 2X89D 4HWBA 3U1SL 4JFEB 4YAQB 3Q5YA 4B95C 4O51B 4FQLL 4JPSA 2XQ0A 1NCNA 3HG3A 5JTWA 3U2IA 3WNPA 2FBOJ 3GMRB 3H6JA 2YJLA 3WNNA 1RIVH 3BDYL 1T6BX 5JPMA 2FJFA 2FX7H 3MV9E 3SDYH 5DMKB 3FT4A 4IK6A 4KKBD 3NOIA 2IAMD 4QEGA 1QA9B 1X9LA 4YXLL 8FABA 4OSUL 5AW2B 3B2VH 1MFAH 2J88H 2Y7QA 1LO2L 1BYOA 4KI5D 3H3PL 1A4KA 3VG9C 2X6UA 4FYSA 5J57B 2F5AL 1GGBH 2NDGA 4M7ZC 4OAWA 4XX1G 3QUMH 3ZDYE 5B7MA 5FYKD 5F0JB 3PFUA 1BVKA 3MCG1 2WQRA 1W0WA 4KJYA 5AW3B 4PJGF 5DVMA 4JG0H 3DYMA 3DIVA 5K59F 5KYYA 5TQ0L 5JDJA 3CHSA 3AU1A 4HK3N 4MXVE 4PLKD 2ADJB 4BFOA 4FLHA 4HHAB 3HBZA 3BE1L 3MA7B 3MJ8A 4Y4FB 3V0AC 5I6MA 2G0KA 1BX2B 3QEQA 4L0ZA 2AJUH 2H0JA 3AUVA 3IDJA 5IJBC 4JKPL 3N1PC 5IUCA 2ZOLB 3C5ZD 3SYCA 3BQUD 5I1DA 1S46A 5IR1A 2FX9H 1F58H 5JUEH 4FTVD 3U6RB 3EHBC 4KKLD 5HVGB 3ZHLA 4MJ5A 2X41A 3BT2L 3VM5A 1JZ5A 2XDHA 4Y0GA 43C9A 2BMKA 1DJZA 5DQJA 5DJZB 4EBQL 4AQOA 3D6GA 4ZFZA 4N9OB 5J12B 5DHMC 3C12A 2BHYA 4O4YH 5C7XL 2DI8A 1KBPA 4WI2A 4G7VL 5DD6B 1AXSA 4I13B 3F01A 1FCGA 4DFHA 3K6IA 1AGCB 1YVLA 2GJ6D 3TCTA 4HK0B 2NMSA 3GF8A 5FWQA 3VXQB 2QV4A 1KULA 1MWAB 1SY6A 2J5LC 1A02N 4LKCB 2QQNL 4WAFA 1YJDL 4TQHA 1PZ3A 3ZDXF 1RV6X 2WKGA 1QUPA 4AQAA 2EE0A 2PXYB 4MCYB 5J0BA 3BD3A 5BZDB 1O9WA 1JUFB 1XO8A 1K4CA 5FYJL 3RVTD 3MOAH 2AEOA 2Z0BA 2V0AA 1G7LB 2FBJL 3TASA 4ZTOL 1RIHL 4GXVL 1XB8A 3NCXA 4FQ1H 3UCRA 2BIQA 2PTVA 1OTTC 2XWXA 3ET9F 3BRDA 5FO9A 1J0HA 2EDXA 3BKML 4LP8A 1ZIAA 3IDMB 2VT0A 3B1UA 4Y19A 5EBWA 1A6WH 1RZKH 4J3SA 1BIIB 4K94L 1Y18A 1A8ZA 3EFOB 4L9LC 5KG9A 2HVJA 2UWEF 1X5JA 3QFJE 1UJ3C 3JVGA 4IMLA 2VJ0A 4BH8A 4RSYA 4HWEL 1RZKC 5DA0B 4POUB 3QYCA 5DK0A 1MJ7L 1XGQB 2J1YA 4V1DE 2X4UA 4XCNB 1RUQH 5B1BB 4GS7B 4HUUA 4ZW5A 3HS0B 1INDH 1KB5L 3QWRD 5CJOL 1DBAL 4AGLA 4NLHA 3VFNA 4PJ7E 5GGTA 2Q6WB 4QAMB 3LRKA 2NY5H 1TQCC 4RWYL 4IU2A 2CNYA 3NP4A 2ZYIA 3QR2A 3MGTA 4HJJH 2HUEA 3TCLB 1MCIA 4WFEE 2ZOKB 4HWBH 4TQEL 5ANHA 3SPJA 4FDWA 4LL9A 4WUUE 4CILA 4Q56A 1TQTA 1MIMH 1SF5A 2XFXA 1Q1JL 5KUMA 2VE6A 1HKFA 4F3FA 1AZZC 4KH9A 4OZIB 2H7WA 3Q9PA 4B9IA 4P2YA 4JM2D 2CKBA 4PJAB 4NAJA 1F2XK 1SJEB 4L29A 5E4EB 2VLKA 4B60A 2BRRH 3HIZA 3ILPA 4E0RA 1U8PA 5I15H 3MV7E 1G7JA 1JRHI 1U95A 3KGRA 5EU4B 3TEYA 1GAFL 1PKQB 4P4KC 1KWKA 1LE5B 4RBPK 3ARBD 1D7BA 3NZ8B 4PRHB 2NY1D 4YEFA 3ULVF 1E27B 3ARPA 1KJ2H 1KBGH 1I75A 3UYPA 5A7EA 3EH3B 3IFOA 2NQCA 1IAIM 2RBLA 5F6IC 1IGML 3C5ZA 4YFDB 3BQUA 5EIIB 3L7FB 4FTVA 1TETH 3DTXB 3DX9B 2Y07H 3BP6B 1JZ3A 2C8NA 1UM4L 4Y5XB 3RWCA 2YD5A 1V7ML 5EEVA 3AZUA 1HYSC 1IGIL 3VI4B 3DX1A 1UJTA 4Y1TA 5D1ZC 3RGHA 3EFDH 3WY4A 1NZRA 2VERA 5F7HA 5F0PB 2W80C 2YOCA 1F56A 3U6XA 5F7EH 3D8MA 5CCGE 1I8MB 3Q43A 5HI4D 1CL7H 5E9DA 3W82A 4S1SH 4EMZA 1IC5L 4MA3B 4P9HL 4E9YA 2H3NA 2JSFA 4IKNA 1KEMH 4YE4L 5HI3C 3SSGA 2GJ6A 4JFXB 2F1AA 4ZUWA 2ZG2A 3UABA 4H8WH 1N26A 2EDYA 4XN4A 1YPZF 4LF3A 4PREB 3BEWB 3GKZA 4RVBA 1LO0L 4R7XA 3EZJB 5CEXB 2DKSA 1DN2A 3GEWB 4ELKB 4H8WC 4X0KB 1FE8L 4XVUC 3T65B 4Z23A 1X7SA 3VO0A 3TU6A 3MRGA 3OXSA 1VIWA 4YIQA 2A83B 1WT5C 4X7SH 1P5UA 5DS8B 4D0DA 4IOFC 4XHJC 3UYRH 5INCB 1SY6H 3LZRA 2FEEL 4JFVA 1FIEA 4KJWD 1HWWA 4NM4L 4B7IA 1WZ1L 3IDXH 4JEGB 2Y1ZA 1F4XL 4BFNA 3LNEA 1TVHA 5FYLD 4TYUA 2BH0A 3VRLE 1SXZA 2DKMA 1C9SA 1YECH 4AV4A 4ENEC 5BZWB 1S9WA 4LPTA 5D1XD 2M26A 4QRBA 3FH7A 3QCVL 1IT9H 2J71A 3F12B 3QJTB 5AYUH 2IAAC 4ES8A 2DQHL 4NC0B 2IG2L 4NNYA 2JCCE 4N2HA 2P8PB 4ELDA 2KERA 4XMTA 1TZHA 4WI0B 5IF0B 2PMZA 3ZL1A 4Z7UF 3ZMEA 5EBLA 5IEHB 4G42A 4N86A 4XPBL 2OK0L 4OCXL 3BUIA 2H5UA 5G2NA 4QRSA 2XT1B 4JKLA 3RL2B 1AGEA 1YN6B 3RTLA 1OXYA 2HG5B 4P9ML 1AOZA 3AM8C 5E8OB 3APCA 1T3FA 1AGDA 1OT1A 5DTFB 3RRQA 5F7DA 3AROA 5GGTH 5IJDC 1N8OE 3P77A 5I26A 1HIMH 1XGTB 3DUSA 4N24A 1OGTB 3MRLA 1FFPB 4IBSA 1E30A 3RZCC 1FFOA 3KPSB 1SBSL 2BP0B 1YY8B 4RNRB 3BAIA 4LLVB 4PS3A 4JM2A 3ARDA 1EZVY 1KB9J 4KZDH 4P57B 3ILDA 4LQFL 4M1CD 3DVGA 1QFWM 3BWUC 4WRLA 1JZDC 2BO0A 4TRPH 3WS3A 4KKBC 2IAMC 4QDGA 3R06A 2QQKH 1ESOA 3ARBA 3QP3A 4XRCA 1EJ6A 1CTNA 4G6ML 4HXBH 1N5AA 4G7QB 2CKBH 1TVBB 2ZAHA 1Q8MA 1QI5A 1QSVA 4JDTL 3UBXI 3PGFL 3ZHKA 4A2HA 5C9JB 3QS2A 4KI5C 1U8JB 3G04B 3RFZC 4MA1B 1JNHA 1IGYB 4QUOA 3UADA 2F08A 2L7EA 3GMLA 3LQZB 3BPCB 3ULUL 4KVNH 2OYKA 3CTTA 4NI6A 1K6QH 4GO8A 3ZE0F 1WBZB 5CXPA 2BW5A 4GG6B 3DIFA 3EGSB 3QNYA 3PUUA 4H1LA 4OLZL 4PLKC 2NY4B 3MLZL 1IL1B 4YO0B 1QUNB 3SDDD 1R5WA 4Z7QF 4X6DB 4LGPB 4PWHA 4P4RB 4YGAB 1A5FL 3RWGA 4U49A 3C5ZC 1SXAA 3CHOA 4DN4H 3BQUC 3EUUA 1BXXA 4APXB 2XV6B 3KCPB 4UWQB 3BGMB 1M71A 4KKLC 3WEBA 4EIBA 2DQEH 5IHWA 5HPMA 1UVQB 1HOCA 1RZJL 2C3VB 3GSOA 4UM9A 1HEZA 3MRBA 3U7AA 1NDGB 3FRPG 2FCBA 1NBYA 5E9NA 4U6VL 1M3JA 4U7KA 4UOQA 1M3IA 3UPRA 1KELH 3N40P 2GKIA 3CH1A 5J1AB 3K81A 1IAOB 1P6AB 2EECA 1I3VA 1TCRB 2BK8A 1SEBA 1NCWH 4JLRA 3BKCH 1TZAA 4XHQA 5FPIA 5L9DL 2MNWA 5E8PA 4JFQA 4JFDB 3TO2B 2AVGA 4W6XB 1MCWM 5IQ9B 1TQBB 5C92A 5LLIC 2D0HA 4HF5L 2YA0A 2OQJA 4QYAA 5C0CE 3AY4A 3L9EA 4ZOBA 4TUKL 3SKNB 3MBEA 1NCOA 5D9SB 3TM6A 2AJXH 4U0RB 5D1XA 25C8L 5DZLA 2P5EA 1PSKH 3MRKA 5I9QC 1CDYA 3CPLB 1P5UC 4WF7A 4JQVA 4GAJL 4LLWA 1JGEB 2VLMD 4RZCB 3LXCA 1JVOA 2WWNA 5SWSE 2QDWA 4DGYL 4AX3A 4F8QA 3QZMA 1AS7A 1FAIL 2OX5A 4Y2NA 4R4BA 5TD4A 4BRJA 1ZEAL 2RCSH 4TSAH 3QQ9D 3VW3L 3RQ3A 1CT8A 2WLLB 4LIQL 1JXDA 2PP9A 5HGBB 5JW4Q 2I5YH 1OPGH 1DZ0A 3WIHL 2A9NL 2R7EA 2YD6A 3NJGA 4ZPTB 3D2UB 1HXYA 1UM5L 5A2IH 3GLDA 2KDGA 5AALA 4OCYH 3TT1H 4FQ2H 4AYSA 4XWGL 3JT0A 2OZNA 1P1VA 4QKXB 5C09B 1HI6B 2GUOA 3O4OB 4FQIH 2IJ0C 3E6HA 3X11A 4WU7B 5AVTB 4F7CA 4L8BA 3MGOB 2B1AH 3SPVB 3T1FA 1DQQB 4OZIE 5D55A 5HP5A 3GBLA 2XG5A 4NQDB 1LYQA 4DZ8A 3NFPA 5FV2A 3S8FB 1CCZA 5I5JA 1Q9WA 2YGVA 3AQXA 1HSAB 5EHFA 4X2UA 2ZCKH 4XBGB 3MJWA 3PWVA 1GR7A 2BSTB 4WY7L 1I7UB 3PDGA 4WU5A 1HKLH 3G6JB 1A7BA 4GKZB 4HHWA 4UQBA 4ATTA 3QZPA 2FLMA 1SXCA 5DC9B 4Y8AA 3SIKA 3K6SA 2WWOA 4QJ3B 4C83A 1ZWIB 4AI7A 3ARBC 3KEDA 5FC9A 2FGWH 3D25A 4E9SA 2ZKWA 3ARVA 2OLDA 5A2BA 3DX8A 4I18A 1MFBL 2OSLA 3TJEL 4H0GA 5LDSA 2ROYA 3F83A 3WE6A 2LU3A 3OX8B 3OAYK 4QXUL 4OZ4A 5GGSY 2KMWA 4EIZC 3ZR5A 4LOEA 4H1LH 4NKDA 4TLSA 4D9RD 2VXSH 1IM3B 3FCUB 1CG9B 2Z8RA 4NSKA 4TUJA 4ERSH 1ZRUA 1AHKA 4IDJL 4BUGA 1YEKH 3LEVH 2W60B 1JZIA 4V33A 2XUWA 3MCYA 4X7CC 3WEXA 3CCHB 4M3HA 3UTSD 3PL6D 4IBUA 4PJGA 1OCRB 4UT7H 2F5BH 3TFKD 2VJXA 2ZUSA 3CSTA 4LOFA 4XNMA 1T0OA 1NOAA 5AD0B 3ULVD 3LB6D 3MVSA 4W1TA 1NAMB 2W9DL 2J8UB 2NY2C 3GIZH 1F5WA 2YARA 1RJLB 1V7NL 4F7EA 5JQIB 2NRDA 3DPBB 3FUEA 3PNWB 4JM4H 3IMVA 4Q9RL 1JWSB 3WIIH 3V6OA 4JZJB 2NTFB 4MJID 4ZMXA 2I9TA 2AANA 3GGWB 4U1HB 4YSDA 4ZS6D 2AHIA 2G75B 3CIQA 1KENL 4K4KA 1JZEA 1D5IL 4U3XA 4ABVA 1L9OA 5A6MA 1IGCH 4FFYA 2Z7YA 5JIIA 2VDOL 4CC0A 3OKYA 3RWFA 2VXUH 3ARGD 3SO3C 2AEIT 4BK8A 3ZTEA 3CZSA 4GIAA 1KTDB 4BE6A 1NUDA 1JYVA 1WBYB 5D1XC 4PJHF 3TEXA 4ANWA 2WZAA 5DYOA 3I75A 3BVTA 3NQIA 2KZBA 4K7FB 2ZXGA 3K80A 4ISVB 2HRHA 4QHUB 4QTIL 4DKEL 3RIKA 3VUAA 1DE4B 1GZQB 3UGUA 4GSXA 1KDIA 4X4XA 2WBWB 1YMMB 5JYLA 2EIEA 2WXHA 5F88B 3CVBA 1URLA 5AVSB 5TK4A 3U4EA 2BP8B 1JI2A 4N3UA 1M57B 4ZMAT 2UY6A 4EI6A 1AHMA 1JHKL 4JPKL 3MFFB 5IOPA 1UC6A 3MRCB 4JJHA 1FI8C 2NX5B 3MGAA 5A40E 2UWEA 2QKSA 5FKPA 4F1ZA 4KZEH 3HZYA 4M6OH 4F7TB 1OANA 4FFZA 1SJHA 2AP2A 3MACH 5IY5B 4UIKH 3QRFM 3QRLA 4E41B 4XP5H 1IBHA 3A6CH 2V5YA 3OLIA 4IRJD 2CCVA 4MSWA 3G3LA 2VDQB 1H8OA 2P8LB 4M1CC 1II4E 1H8NA 3DGCR 2VZSA 4LCUA 3CU1A 1QFPA 3DRTB 2ICWB 4YDLB 1H0DA 3P3YA 3LY6A 4BDVB 3O8XB 3DECA 3D9AL 4GG6E 2GEQA 5GS1B 5TDPA 5DJDA 3LPPA 1FVDB 3MRJB 3A21A 4GMSL 5CSBA 1A14L 5G4NA 3VI3A 5J9PA 1VFAB 3HCVA 4L37A 4GSDH 4M7LH 5E95B 3BSZA 1I8KB 1PJWA 4MQSB 3JWNC 1K8DB 3D85B 2BVUA 4UAOB 1KIUB 1Q0EA 1QLFA 1FPTL 1Q38A 2WTRA 4ACPA 1J8HE 3SDDC 4Z5RB 2ORBL 2IQAB 2DOCA 2F1EA 2J43A 3UTSA 3BUYA 1A4AA 3PL6A 2VLJE 3QEUA 4KNQA 2XVBA 2CDFB 2BJML 1KTLA 5CINH 2YHGA 2VDML 3RDTB 3MUHL 2MPAL 4MDIB 4G8AC 2OMYB 5MERA 4AGPA 4DERA 2A6DA 4DUWA 3V7AG 4ORGB 3F7KA 4OT1H 1GPOL 3HHSB 1ZD6A 1JPTL 3HZKB 2OSYA 4ZMZA 1JN6B 4PRPD 4OZFA 2R2EB 3IJEB 3AY2A 4JFDE 3OPUA 2CKNA 3WKML 1H5BC 4DP9X 3T6ZA 4JGUA 5IKCA 1LDSA 5CSZB 4JREB 2Z93B 5B1JA 3P73A 2H32B 2N1KA 1G84A 4PN6A 5I1IL 2Z35B 3NN8A 1GGTA 4K9EC 2Q2EB 4WW2B 1TQSA 3ARGA 3SYOA 3TONA 5SX5H 4LL4A 2ITCA 2WP3O 2ZSVB 1I8LC 1O7DE 1XGUB 4DKDC 2CIKA 2LU7A 3V6OC 2FNBA 5TDNA 1KV3A 1YPZA 3REVB 4B96A 2YAOA 2OTWB 3RIFK 1CGUA 2F9BT 1JZHA 3IFLL 2VDPL 1ASPA 3RGVB 3TURA 5FR3A 2A6KB 5SX4H 2OCJA 3PPEA 5CBAA 4R83A 5E6YA 3QBTB 3OGCB 2XKNA 1A47A 4U4IA 1PZ2A 1MAML 1QNZL 4LEXH 3TBVA 3QQ9C 4OH2A 3KH3A 1TO4A 2PYED 4GI6A 4PJDB 3VXSB 1QEWB 4BKTC 2OMUA 3CMOH 2DM4A 1D5XB 3M17B 4HISA 4X80H 1YUHA 4NS0A 4Y4KD 2XRAH 3KPQB 5EUKB 4RAVB 1MFMA 4WEBL 3PRZA 4MX7B 3QHTC 1WFNA 1YEGH 1YCSA 2WZ6A 2VIRA 4LCWB 4OD1L 3UG4A 4KDWA 4PJXB 3IN2A 1MCQA 3LIUA 4BKSC 1VACA 1KPUB 4KZ0A 3H56A 5DD3L 4IRJA 3TBTB 1HFUA 3SPIA 1MELA 1R5VA 3N42F 3ZZQA 1KWGA 2AC0A 1MRFL 2D3NA 4JO2H 1U91A 1NWOA 3G6JE 1NINA 4F24A 4M43H 5B8CB 1RERA 1ZY9A 4HSAC 3TBCA 1EEZB 2Z91A 3IJ9A 4H40A 3FAWA 2A74B 1EO5A 5LWYL 4OJYA 2HRPH 3LHPH 3EOBB 1OQXA 2DDQL 5I1CH 1WIPA 1B3IA 1MSPA 3GO1L 4AZUA 4XNZC 4G8IB 3Q1SH 4AK1A 4POZC 1EERB 3QS3A 5LNGA 2XCMC 2X40A 4XNUH 3WXVH 4FG6D 1OB1A 5JXAL 7FABH 1KB9K 4L8SA 3T8VA 5KEZA 3SPGA 5HYFA 2XIBA 4GYBA 1EAPB 1NLBL 2EDJA 4D0BB 1KB5B 4HKZB 4R4ND 1TOXA 4PJBB 5TE4L 3UAAA 4ETQB 1S7SB 3DJ9A 3BSZH 2RMNA 4QYOB 4BSVB 2VC2B 5IJKA 1CTOA 3SDAA 3PF2A 4J3XA 5EMYA 1AE6L 5FEBA 1GCFA 2NXZD 3UXFA 2HLEB 1KLGB 3EYFB 1JF6A 2V9UA 5JDSB 1OAYH 5KAQG 5E5RB 2EVHA 2W65A 3IEAA 4R7DA 4L05A 4PRPA 4TUOA 2CLVB 5CO1A 2UV3A 3ZIYA 1S78D 3EKCA 2J8UE 2WXNA 1PTZA 4C4KT 2N0KA 3N1FC 3PL6C 3ULVH 4GSRA 1W8EA 3C08L 3CG8A 4P2RD 4LU5L 3B9KB 3ZHDA 1K9TA 1NANH 2BWIA 1XB6A 4KNTA 2B0SH 1R3HA 4QCIA 1ACYL 1UTDA 1HTYA 3LB6C 4WFHE 3LRGA 2AK1L 4G8EA 3EXJA 1QFUH 2APFA 1D5BB 4OZFH 5KJRL 4G3YH 3I84A 5GIRB 1UA7A 3U25A 2BVQA 4HVBA 3MRIA 4GT0A 3BIKA 3HI6L 3GHEL 5DRXB 1E6JL 4M62L 4S0SD 4OJAA 4ZMLA 3BGFB 4H2CA 1ED3B 4DOHE 4X7TB 5B1JC 4PD4J 4ZS6C 4PJEA 4C47A 1ROCA 1Z66A 3GI9H 1VESA 2PCFB 3TYFB 1OD7A 4QRPD 2H6PA 3X3FL 1SOSA 2D2OA 2H1PH 2EYRA 2FQFA 1JG9A 4X6EA 3O2DA 2DJUA 2YOAA 3WNOA 6CGTA 2PYEA 1VZIA 1IKFL 3HZVA 4MCZA 1CFVH 3V9EA 2X3CA 4Y4KA 2WAHA 3STZB 2VN5A 1YMME 1JZ4A 4OLVH 2HA1A 1N64H 1FVCB 1MCPL 1BQ5A 1J86A 4TMPA 2YMOA 1GZHA 3AS0A 2ARWA 2AJ3A 4D94A 1PDKA 3CZKA 1LK2A 5HVFB 5L88H 3EOAA 4PW9A 3BVWA 3O2WL 1UQSB 3RUGF 1H3XA 1BZEA 2B1OA 4E41E 3FO1A 2QVMA 1A1MB 4HH8A 3BSHA 3X1BA 1BAGA 3CFCL 1YMHA 4DIXA 4I77H 4AMXA 3MFGB 2WXIA 3EGXB 3C6LD 1J5OH 1RH8A 1OP5K 1E4XL 1UYWL 1JPFA 3EYUH 4G9DA 1HH6B 1OAKH 3I6LE 2O6FA 1FZJA 2FBRA 2GSMB 4HJGB 4IRJC 1OAZH 1D7FA 1X44A 2XFGB 4CVUA 4Z7WF 3LYRA 3OMNB 5KW9H 1YEJH 4JVPA 4JO5A 1CK0H 4C56D 2HLAA 4KXAA 5AUMA 4XVTH 4AUJA 4XPAH 3MUY1 3T3PB 3S2AA 3WLBB 4EUPB 4KY2A 4G1EA 3B3IB 4MNQE 1YNKH 2ARJQ 4N2CA 1UH4A 4OLUH 4GBXC 2DEXX 5LGJA 2YN3A 4KTDL 3U0PB 3H0TB 4WWKB 2DBJA 3HG1D 2EUZA 4AENA 3B8YA 5JW4N 2ZJSL 2YBGA 4W9GC 4A6YL 1XSOA 1I85C 3ENEA 4XCYB 4G80B 4JPVL 1NDMB 3FT2B 2XWCA 3SYQA 2WWKT 4OD2A 1MQ8A 2EDOA 3VTMA 5G55A 1YQ2A 2LQRA 2UZXA 4LAQH 3HW7A 3U46B 1QSEE 4MJ2A 2FWSA 2BINA 3ZHFA 3JYBA 3IAQA 5IJKC 3DOSB 2MOVA 1JWMB 1T4KB 1CO1A 5IW6B 1RAMA 3HPJB 3I6SA 1D2OA 3RPBA 1WDAA 1RUAL 3TBSB 3RIAK 2XZQL 3KPRA 4X99B 3SOBL 1G1KA 1IQWH 3NEOA 3OTTA 3SD2A 2YRLA 3U9PL 3B2UD 1RFDH 4G8GD 4P3CL 3QJVB 4QHPA 4RH4A 3TEWA 2H26B 5B39A 5IK3A 4LASH 1HWHB 5ANMB 4YBQD 4AUUA 1U4FA 5CEZE 1B2WL 1YNLH 1W72B 2F8VA 3CDZA 3L1OH 4QRPA 1MCNA 4FKHA 1FORL 4FJ6A 2APTA 4MB5A 1Q94A 5LGYA 1G1CA 1TQCB 1MH5B 5EF3A 5ISZB 2EDQA 2QFPA 3FB6B 2XN9B 1C08B 3ATBA 1PL3A 3US9A 5AG8A 5CKAA 3ZL4L 3C6EA 4KKAC 3PQYD 4ZX5A 4LFHG 4OM0H 2VN3A 4HJ1A 2NNAA 3VXSE 3ECBA 4HEPA 4ZNCD 5KSBA 3LPOA 4LESA 3O2DH 2JJSA 4CC1A 2WGXA 4NO5B 5GRWA 5HYQB 4RIRB 1R24A 2K9UA 4LKXA 3WFBL 4P2QD 4YWGH 2CHZA 5IW3A 4HWUA 1OAQL 3X13B 3S8WA 2ADIA 3P2DA 2HN7B 4R0LC 5KYXB 4GPVA 4Y4KC 2X4OB 1RHFA 1QWHA 2DI7A 4P4KB 2NCEA 3B9DA 3TNMB 3SODB 3GRGA 4HUXA 5BNXD 3C6LA 3CDCA 1Q72H 2NNFA 2VZ3A 1H3GA 1NMAH 2VLLA 5A7BA 4D8OA 1GZHC 2ICEB 1NA8A 4QHKI 1BZDA 1DZBA 2YD3A 1CLVA 5DUPH 1VGEH 4RCAA 3M86A 2ZE0A 4ODWA 5ADOL 1DJYA 1JNLL 3T0EE 4C56A 4JS7A 5KVFH 4LLMA 4FG0A 1JGDA 5I73C 3BYYA 3C2SA 4W81A 5I0ZA 5EZIL 5C0BD 4N2EA 2WMPB 3E8VA 4TOYH 5D1ZB 5JQ6H 2OAAA 1MXDA 3P0VH 2BVPB 4HKXA 3E3QE 4MHHI 3VYPA 4JPIA 5IVXB 3DVNA 3HZMB 2ZF8A 3LNFA 1HN1A 4KJPD 2WLIA 4N68A 4KKRA 3HG1A 1MLCB 4TNEA 2E0PA 1HHIA 3U9UA 5EZLB 2YPLD 4KQ4H 1YEFL 3NABL 3NSXA 4PJBE 4CGTA 4UOZA 1I9JH 3BP5B 5J7CC 4NJ9L 1MFNA 4FG6C 4FI6A 1UKTA 2GW5A 4JFPA 4F9PC 4XTRD 4RFOH 3OKNB 2WINA 5LBSH 5T1DL 4PRAA 1JXFA 4R4NC 4ZDHB 3UTTD 1D9KD 3D7PA 5ETUA 4H0IA 4KRMB 1TYEB 5H94B 4NO0B 3BHBA 1PG7H 1ZIBA 4K7PL 2DIEA 4LPVA 1BOGB 3EJQA 1XCQA 1F4YL 2NXZC 4G7RB 4RGNE 3HBPA 3ZHNA 4EVNA 5CHNB 1U8IB 5A16B 3OV6A 2G2NA 3I6KB 2XG4B 3UBXA 1SBBA 5EIVA 1L6XA 1OE1A 1DQML 2ZXCA 1CD9B 4G8GA 4NC1E 3N1QC 4WCYL 2E8ZA 4O2EA 3RWHA 3TWYA 1JRHH 2R1WA 5EU6B 3VD1A 5GRYA 2PPAA 1DJGA 3MCKA 4MAYB 2R0WH 5FK9A 4ZO6A 3CSBA 4S1QH 2E9IA 1QRKA 1XH0A 2VSDA 2WJ7A 4ZX4A 1ZE3C 3IU3A 5EN2B 1NBZB 2Z65C 1T1WA 5I6NA 1U92B 3BPOC 1UM6H 1WSST 1XGPA 2A4ZA 4TN9A 3CHPA 5C0AD 4M6MH 4WEMB 3FOLA 2OTPA 4AE1A 2ZOTA 1XEUA 3PQYA 1RLBA 3FU8A 3FH5A 3MRNA 1YN7B 1Z3GL 1RZ8B 2AERT 4PP2A 3CVHH 4EJ1C 4GUQA 3HA0A 2AVFA 3BO8A 3Q5TA 3KPPB 5F8RC 1BFOB 2ZWKA 4OM1H 4X6CB 5CFHA 2EEDA 3CK0L 3RZCB 3FK3A 3ZUNC 2DD8L 3PWUA 2N0MA 2EABA 4U1LB 2RFXB 2EAEA 2CJTA 3CBKB 3ZGHA 1BYNA 1Z5YD 3LEYH 3JXAA 2NY6B 4HUCA 4TSBL 3AT8A 4XVOA 1V10A 2XWBB 2WBXA 3AQYA 5LBGA 2OCFD 3RI5F 3VFUB 4ONFH 1E4WL 2E9WA 4LCYA 4N26A 2XI9A 4JPWH 3ZT6A 3GB7A 3ORJA 1TLMA 4LHQB 2Y36L 4OGYH 3SJVD 4ANUA 4JM0A 5CEYA 1FNGB 3I2CL 1NWPA 1LLAA 5F1SA 3N41F 4GUCA 1ZGLM 2CD0A 5AVVB 4I1NB 1UZ8A 3FT0A 3P4NB 3VFOA 4H2AA 3EJUA 2OI9C 3MBXH 5CJQH 3LQMA 4LSVL 1NC4A 4CN6A 2N7AA 5E8NB 4MMXB 1UG9A 2GAZA 1FN4B 4PJCB 3MCLH 1CFQA 3DYPA 3UZQA 5C0BA 1FFNA 2EUVA 3DSNA 2GPZA 2XN1A 3DC0A 2F61A 5BW7A 1DFBH 4HJEA 1FFTB 1XEDA 3DI2B 3T3PE 3P1VA 4YSRA 5DFWH 4CVXA 5ABZA 2X4RA 3AW5A 4FNRA 3RJDA 2B08A 2CE6A 1U21A 3IXAA 3N43B 3D30A 3ZSSA 1DVYA 1Q0XH 3P0YL 3US1A 3L4XA 4ALAC 3I02A 4NN5B 3HNTL 2UVEA 1IU1A 4U3SB 4XAWL 4U1NB 5IB5A 2CHWA 2P48B 4LEEA 3CZFA 1HQ4B 1U8LA 2NXYD 3K6FA 5JA9A 4FC3E 4KQ3H 1L9RA 1J9SA 3OPZL 1KYDA 3KYMB 1D9KA 4X5XA 3ESVF 5ELIA 2IWFA 3DSFL 3F6JA 1HHGB 4DGVL 4LK4A 4F58L 3ZR6A 1QO3A 3QIUD 3EYSL 5F7WC 1JZJA 4R97B 4WFGE 1JPGB 1ZJBA 5D72L 4WV1C 5KVEH 1HNYA 1KCVH 5CUSL 4P5SA 1UWXK 1JZFA 4Q89A 3RKDD 4DH2A 1CR9L 3DX7B 1F3JB 2DWTA 4HGMA 4BQCA 5FHBL 2EQDA 2EACA 2Q2LA 3TPUB 5DMGD 4AIXA 5I8EB 1LL1A 2CDGB 4ESKA 3FTZA 5GSRA 1PIGA 3I85A 1JMXA 3WTXA 1O9ZA 1R3IH 3FQRA 4ZODA 3FTGA 5AB0A 5HHXH 2UZIL 5C0AA 5I19L 3B2UC 1W8NA 4OV5A 1N5YH 4QIRA 2MOQA 4F8PA 1ZHKB 3BIBX 2ZX8A 1EHLH 4L4TA 2XN9E 1U8HB 1BEYH 4YBQC 5IFAL 5IHLB 3FPXA 1KEGL 2A6JA 2IPKA 1FG9C 3LEXB 5CCKH 5HYJD 2ITDA 4BQ6A 1KN2L 4BCYA 2GCYB 2PCPA 3X3GL 4GNKB 4K23H 2MQCA 4QRUB 2B7DT 2NNCA 2VXQA 3BZEB 5DMYA 5MEOA 2CLRB 2DKUA 4KK6C 4UTBA 3BVXA 3FFCB 1NKGA 2ZNXA 3WFHA 4D0CB 4KTEH 1RUML 5D2LA 5BJTB 2XPGB 3SJVA 5EO0B 2VDMB 1GS7A 5FO7A 5DO2C 4A2LA 4RAHA 1HJBC 4BUHA 3G6AB 4QRRA 3KNBB 3REWB 1A6TA 5I1KH 5CWSA 4PD4K 1OF0A 3B7YA 3VFWA 2JELL 1QTYT 2PYFA 3DLQR 1A7RL 4NNPH 5I17B 1G4MA 4RISH 5EOTB 5BO1L 4YDNA 5GS0L 1HL4A 3IE9A 5PAZA 4XE0A 3HAEG 2DH2A 3M8OL 4XMWA 2BNRD 3NH7L 1TNNA 4ODTH 2CJ3A 2FECI 4NQTA 3SQOL 3WTVA 2G2RB 4JDVB 1EEQA 4FCAA 5KVDL 2V2XA 4FE9A 4DK3A 3OKKB 3IKCB 4JGNA 3FRPB 2AGJH 4X5PA 1UURA 3NZHL 5IVXE 2YC1B 1RPKA 1XF3A 4LLDA 1WF5A 5CR8A 3K0YA 1NCAL 1KUMA 5EU7C 4AG4L 1N4XH 4QGYA 1QFHA 3LZNA 2BSSA 2E47A 3T0AA 3VXMD 1H9VA 3GMQA 1CB4A 3QORD 4KK9D 1GHFL 3HB3D 3HFMH 1DLHA 1JHTB 1WRFA 5E8DL 1A7NH 5BW7C 2EEXA 3QULB 3RUGA 5H37G 1GCYA 2VDPB 3F8UB 4AW4A 3T1WA 1N18A 4U1MA 4AQ1A 2FB4L 4KJPC 5J5EA 1QSFB 2BSBA 2DYPB 3IDNB 2DQDH 2EC9U 3QIUA 4PVMA 3KMDA 1T21B 2F8IA 5E2UH 4HDIA 3P9WB 1KIRB 1I8AA 2AITA 4PPTA 3HNVL 1KYOJ 3LKOA 3G5XA 2NY2B 5CU9A 2B15A 4EEEA 1MVFA 1O5PA 3HR6A 5LJYH 1EAOA 4YGVA 4FNLH 3OLEA 1F6AB 3W0WD 1J1XH 2JKLA 1PEZA 4XTRC 1KLFA 5DD1L 2GK2A 1G5AA 3V0IA 3P2TA 5IOKA 1A9EB 1D9KC 3O4LD 1OSZA 2W81C 4KRPB 4NRXA 1PEWA 4BA8A 5I1GL 4FQXA 2X6BA 1QNIA 5EU6E 3BZ5A 2YGQA 2PW1A 2FT7A 3C9NA 3T4AC 3X12A 1ZS8B 4EZKA 2FQGA 3K4AA 3QWOA 4TVSa 3THMH 3V4PA 4HAKA 4JDEB 4JRXD 4IS6A 4YHNA 3M88A 1BREA 1WZAA 1E3FA 1M6OB 1Q9OB 1RIUH 2HSIA 3LKNB 1AD9A 5IB1B 2QHRL 4XC1H 3BSGA 3O11A 1IM9D 2BXYA 3B2PA 1FNFA 3BVNB 2JI3A 1AIFB 2EE3A 4F33B 5IMOB 1FL6A 3B7SA 1ZDQA 1MAJA 2YEQA 4NENB 1J9TA 4JZNA 1E5ZA 2WUBL 4YHPA 5IV2B 5JMRA 4AMKH 5HYJA 2AQQA 1BD2B 1KXQA 4KRNA 2P7TB 4HIPA 4F8NA 3C75A 2EIJB 1SHXA 4X6CE 1A1NA 1N8ZB 3WN5A 1Z5LA 5MP6L 2PETA 4BH7A 2CMRH 2IH9A 5DK2B 4PYHA 2OMTB 4L1HA 3KWXA 3OG4B 2PO6B 3B9EA 3BRFA 1GGIH 3RB7A 3QUYD 1HOEA 1RK1B 3VD5A 5JHDA 2HJLB 1IGJB 3EJJX 4P5MB 5T3XL 3UERA 5EWIH 2ISDA 2FK9A 4NQXA 5CP3A 1PLBA 5D7IE 3X17A 1NGZB 1GZPB 3QZOA 2D4FA 2WY3B 2DICA 3O41A 2KHAA 4UTBH 2GIXA 3PV6A 4OV6F 2ZPKL 3CFDB 4XMPL 4TXVB 3NAAH 2FEDC 3UP1A 3QDJB 4KI5E 5SWZB 1T0PB 2QPSA 2BNRA 3KVQA 1BDYA 4ODHL 1WFTA 3CSPA 1RJCA 4B27A 4AYBA 1EV2E 4KV5F 4LPCA 4OZGB 4XZUB 3R7QA 2WXMA 1VFBB 4YDIH 3L3JB 5FYKE 3X1FA 1KN4L 4BWTA 4ENZA 1J1OH 35C8L 4UV7H 3N06B 4PJCE 5JIHA 43CAA 3KLAB 3OR7B 4QMEA 2MSPA 1MCBA 4L18A 3WKPA 2WB7A 1D7CA 1SRDA 2F54D 2R29H 3H9YA 5F72S 1RIVL 2W95A 3Q2VA 1U8CA 3PDOB 1CE6A 2V2TA 5E0QA 2FX7L 4AYFB 3SDYL 1L9QA 3VXMA 3WFCH 4QF1B 4RAUB 4WI9A 3QIBB 3LX9A 4PY8J 2Q86A 2FEJA 4GT7A 3SDDB 5I82A 3B2VL 4G8FA 4MXVF 2J88L 4QRQB 4X9GA 5E6RB 1WZMA 1UGNA 2YAFA 2YIHA 1I1YB 4I85A 4XMVA 3OBAA 2HFFB 1GGBL 1EJOH 2OL3A 3CBJB 3QUML 5F9WB 1P7QA 1KBWA 5TJWK 4JG0L 3I9GH 3UACA 4XP9H 2NXYC 5AW5B 3QQ4B 4AKPA 4IJ3B 3MHZA 1EJ8A 2I7OA 1IAMA 4DGWC 3EIFA 3SGKC 3CFEA 3ISRA 1S7WB 1H5BB 1WHOA 2KZ1B 5H35B 4FS0A 5E94A 2AJUL 1MUJB 1HSBA 3NJMA 3KLQA 4UINH 2C9SA 1DR9A 5CCJA 3QIUC 5LAXB 3DK2A 2FX9L 1F58L 5JUEL 2MCG1 5JNYA 4F15C 3ASNB 5K9JH 1I3GH 5FECB 1EGJA 1F11B 1AP2B 3SDCA 5TGBA 5ILTH 4PLJD 2GTZA 5JHMA 2J12B 2Z7WA 2CHDA 2V8LA 1URZA 5EU5A 4J2XA 3II2A 1NMCB 5D93C 3A22A 3FQNA 2W59A 4OVUA 1IM9A 2YA2A 5CNHA 4O4YL 2Q3ZA 5DEGB 1TSRA 4PWFA 1CIUA 1O75A 3EO0B 1EHXA 3CV5A 5DMGC 3ZZLA 3FZUD 5JHAA 1D3CA 5EU3B 1S7QA 3V4PH 3UTOA 4NKOB 4L8CA 4OCWH 1PZUB 5IM7A 4TV3A 3L3HB 4PW4A 3HN8A 4YXHH 1UB5A 3FO0H 3QDMB 5CJXA 3F64A 2XWTB 4HLEA 4I7ZC 2TRHA 3IFPB 1IGTA 3KJ4C 3UTZB 1K2DA 1HL5A 2XBZA 3RJQB 2EXWD 3MOAL 4A7UA 3GLAA 4HSQA 4W9IC 4MS6A 3QUYA 2C3GA 3T4YB 3WIAA 3FFCE 4PVLA 4DNLA 3C5SB 1EJFA 4FQ1L 5FV1L 3M1BB 3V6BR 1OARH 3O6KH 4GQRA 3W81A 3ELAT 1QASA 4MD5B 1IEAA 3T6QC 1PX8A 1MHPL 5C7ZA 4DETA 2CRMA 1A6WL 1HAUA 2DTMH 1RZKL 1OM9A 4FX5A 4I1RA 4MNHB 5HGHA 4K8RD 3VXPA 5FWRA 1JWUB 2XXFA 4N5ED 2P43B 1YDPB 4OF5A 3LPWA 3OB0H 5CP3H 2BNQD 1IC0A 4PGZA 4Q6IC 3SO5A 2X1OA 5L2KA 1GYWA 4DGIH 3AB0B 1RUQL 3IRCA 1A6ZA 5T8IA 4RFEB 4ZW6A 4APQA 3ZO9A 2C1OB 2GC7C 1T1YB 3OR6A 5ALCH 2F54A 2NY5L 3LH8A 3NZUA 4XNZB 5GGRA 1TFHA 3IDGA 3L4VA 1S7TA 1XH2A 3T0BA 2QGCA 4HJJL 3AG2B 1UB6A 3LVTA 1A7QH 4EKXA 4N0FB 1YEWA 2YGOA 4M5YH 4HS6A 4HWBL 5AVZB 2NLJB 4EF3A 5A6IA 4BFIA 1FO0B 3IWVA 1J9CT 3OKLB 1MIML 2MTPA 2R2BB 1UXSB 1FNHA 1AQ8A 1BFVH 2AQ3A 3GJFK 4HBQA 3BEVB 4ZFOB 1UT9A 1QRNB 1G6RB 3E2HC 1G9MC 3FO9A 3MZGB 5IESH 2ZX6A 1I4FB 3NIDB 1ZLSH 3DJTA 1T2QH 4M8QB 1AC6A 1QSFE 2BWQA 2O93L 2BRRL 1AHWB 1P0SE 2ARJB 4R5VA 1KPRA 2H8PB 3RX5A 5I15L 5ITFB 5IB4A 3QORC 1BVOA 3HB3C 3ABLB 5TQ2H 1ZLWH 2CIIB 3GMNA 2BCMA 1E50A 1UEYA 4OLWH 1XSIA 1KJ2L 1KBGL 4JFFA 2YRPA 1WWBX 4KNSA 4ECNA 2OL3H 3CVIH 1ROWA 2H9GA 4LDCA 4AEEA 4EQ3A 5GRJH 2LLNA 4YHYC 3VDBA 3LKSB 3V4VA 1UXWA 1L9NA 1NCIA 4BSWB 1TETL 4UOW1 5BQ7B 1BG1A 4G6AD 4OBSA 2Y07L 2FATH 2C7UB 3VNYA 1Y7VA 2BSDA 2C9AA 2P26A 5FB8A 3L8QA 1B2YA 4X9BA 3PIQA 3KWWB 3V6FA 4PUBH 5GISH 3BH9B 3EFDL 4WZ9A 3EGDB 1NOLA 5D1QC 5FYLE 5F7EL 4LEOA 2BOBA 3MLXH 4PWJA 1EGJH 2V17H 2H3XC 2CUAA 4FGMA 5FGCB 1CL7L 4FLRA 2WQ8A 1DBKL 3GIVB 4S1SL 3SE9H 1FRGH 3GBDA 5GZND 1WA0X 1KEML 4HUVA 1XSKA 3O45B 1U2CA 1VADB 4R7LA 5E23A 4CMHB 3PHAA 5F89B 3PP3H 4H8WL 3LIZH 4HQQH 5MENB 3RVXD 4ETYA 2I07B 1NSNH 3II3A 5DSCB 4BRVA 4XODA 3SCMB 3UL4A 3VRLF 4DP5X 3CFKA 4HPYH 1C7TA 4M4RA 3IJYA 1F42A 4HYTB 3GHPA 2PCYA 4X7SL 4ZUVA 1KFAH 4GKNB 1MIEH 2MFNA 3UYRL 1I1AD 1R17A 3PE9A 4CA4A 1SY6L 1XD1A 2HJKB 1PZAA 3SKOB 3VXNB 5DWPA 2CGZA 1T22B 1M05B 2Y6TE 4R96B 1T5WA 1CFMA 1T1ZA 2JCCF 5FUZH 3AGVA 3IDXL 3NA4A 4M03A 2YBRA 1DVTA 3FOMA 4DEWA 4X0NA 4YS4A 4I2XE 2D4DA 4YSTA 1YECL 3S96B 3AACA 3WFDH 4J4PD 3S98A 1NCUA 2BNQA 1FBIH 4B9FA 1IT9L 5A43C 4PM1A 1CFTB 3GKWH 5AYUL 5DHVB 2CK2A 5SWZE 4GRWB 4CU6A 4NPYB 3ISWA 4OZGE 2APWA 5DEFB 2NUTA 4ICXA 3MLVH 1SFDA 2F8OA 3QFDA 2RGSA 5D8JH 3SY0A 4ZUSA 1PZ5A 1L7IH 1ZGLB 4PJ8D 1RSYA 3GUFA 3CDGB 4Z3TA 2YS4A 3FTSA 2QV2A 2WLKA 4GRLD 1FAKT 2CDEB 1IJNA 3OQRA 3FRUA 2WQXA 1CVSC 1UFGA 3VFVB 2O6DA 2WCSA 2XKSA 3JWNE 3L5XH 3PHOA 4GBXB 2E7BA 5GGTL 1HIML 2VUOA 1LO2H 1HHHA 2X44D 4DKFH 1DQTA 1ZLEA 4HZLA 1A4JB 1T2JA 1K5WA 1N9PA 3DK0A 4ODVL 4Q7DA 4KZDL 2WZPD 1FL5A 3MREB 4DP8X 1AQKH 2EZ0D 3C8KB 4Y4HB 2VW4A 3TPKA 4F5CE 1G7PB 2GY7B 3ABKB 2GVYA 4A7TA 5DURB 4PG9B 3HHRB 3T8XA 4NKIH 1LP9B 2QQKL 7TAAA 2NQDA 4U3HA 3CC1A 4HXBL 2YUXA 2ENSA 4N8CH 1QATA 2CKBL 3CIAA 4FA8A 1N59A 3MV9D 1G87A 1S9KC 4ZOAA 1T20A 5AL0A 3ABMB 5K59E 2V9QA 4KVNL 4GUOA 4FEIA 2JNZA 1K6QL 2LAAA 4LNRA 1SXNA 2X2JA 3WHXB 3W11D 3LRMA 1NCDH 1EH9A