1SNRA

Nitric oxide bound to cu nitrite reductase
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
336
structure length
336
Chain Sequence
b'ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
molecule tags Oxidoreductase
source organism Alcaligenes faecalis
publication title Side-on copper-nitrosyl coordination by nitrite reductase.
pubmed doi rcsb
total genus 91
structure length 336
sequence length 336
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2004-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1snrA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1snrA02
3NSCA 4WTQA 1ET8A 2YQBA 1DYZA 4F2FA 5I6PA 4E9WA 3WIAA 3S3BB 3TASA 4HAKA 1E67A 3AG3B 4W1TA 3X2QB 3WI9A 5I28A 1IBZA 3ZDWA 4FA7B 2CJ3A 3SBQA 4E9VA 3HEIB 3X1EA 2XX1A 2PPAA 2FWLB 4YSOA 2Q9OA 1DZ0A 3FSZA 3NJLA 2JFCA 1BQRA 1L9PA 1OCZB 1J9SA 3QPKA 5TK2A 1OCOB 2I7OA 3FYIB 1L9SA 3MX0B 5I6MA 2BZ7A 1TEFA 1L9QA 1NIBA 2JKWA 3FU9A 5AKRA 3FSWA 5IY5B 1GS6X 2HX7A 1WS8A 3QJSB 3FSAA 3T6VA 1WA1X 3EHBB 2BZCA 1OCCB 3DKHA 3NJHA 5B1BB 2N0MA 1PLBA 6PCYA 2FT7A 1NIFA 1XB8A 2UX6A 5A7EA 1MG2C 3FPXA 2DWTA 4ENZA 1WAEA 3D12B 1B3IA 1FFTB 2E86A 3EF4A 3NSFA 2VW6A 4EF3A 4YSDA 1A4AA 2FT6A 2QPDB 5E9NA 2OV0A 3FU8A 3DTUB 3IBOA 2EINB 4CSZA 3S3CB 4E9TA 2DWSA 5D4HA 2PP8A 3NJNA 3ASNB 1CUOA 1AZBA 3IEAA 3T71A 2IDFA 1PLCA 1W6LA 4UANA 4HCGA 2FQEA 1MZYA 1EHKB 1IBYA 4K9JA 4UF7C 1AG0A 3NJGA 1GSKA 2XUWA 1BYOA 5B7EA 3T9WA 1ZIAA 4YSAA 5I6LA 4W9ZA 5B1JC 3WNIA 1PZAA 2BHFA 3UAAA 3FQ1A 1JZGA 1NIAA 3NJKA 2PPCA 1KBVA 4KNSA 4P5RA 3NJIA 1KYAA 2VM3A 2Q5BA 1HAWA 1OCRB 4KO5A 2VW4A 3PCYA 3X1BA 3TBCA 4DPAX 2J56A 1PF3A 2WO3B 2X88A 1RZPA 1RCYA 2GHZA 2VSMB 4AKQA 1IKOP 3JT2A 1TKWA 2H5UA 2QT6A 3FSVA 3ZIYA 3OM3B 4YSUA 3OMAB 4P5SA 1SJMA 1HFUA 3NSYA 2FTAA 1OE2A 5AZUA 1NZRA 4AI7A 3GYRA 1ET5A 1BQKA 2DYRB 4NERA 1JZHA 5B3SB 1BAWA 5PAZA 1A8ZA 1AZRA 1KCBA 4HHGA 1ID2A 2FQDA 7PAZA 1AZNA 2IAAC 4RH4A 1A4CA 5B1KA 1XB3A 1XB6A 1OV8A 3UADA 4A2DA 1T5KA 4M3HA 4FAAB 4HCFA 2UXFA 1GR7A 2QDVA 3SQRA 2VSKB 2PLTA 4YSQA 5LDUA 1PNDA 1NINA 5B1JA 4JKNA 1FA4A 5I26A 4DP7X 1CC3A 3WKQA 3CVDA 3ABMB 2IH8A 4YL4A 1WA2X 4DP6X 1M56B 3V9CA 3X1NA 4BDVA 5I6KA 4KNTA 3C75A 4JHVA 1N70A 3OQRA 4HALA 2FT8A 1SFDA 1JZFA 3AG4B 3T6XA 1QNIA 2YXWA 1IUZA 1PNCA 2XV2A 4GYBA 1L9RA 4DPBX 2JXMA 3AZUA 4G71B 4A2EA 4A2GA 1GW0A 1RKRA 1AS7A 3NYKA 2QDWA 3JTBA 3FPYA 4GP8B 5F7AA 3GDCA 4N8UA 6PAZA 4QKTA 2CBPA 4M4RB 3ASOB 2BWIA 1ILSA 3SBRA 2ZONA 1JVOA 1SNRA 4DP4X 2UXGA 1SHXA 1I53A 5I5JA 4KOBA 1NICA 4BWWA 3UABA 1PCSA 1PAZA 2HX9A 1E5YA 4BXSV 1GS7A 2VN3A 2BP0B 2ZXWB 1NTDA 1AACA 1AIZA 3PPSA 2EIJB 2RACA 3TU6A 1ASPA 2PCYA 4E9QA 1MZZA 3CVBA 1EZLA 3H4HA 1J5DA 1JOIA 1KBWA 4KNUA 2YAEA 3QJRB 5I6NA 4E9RA 3FU7B 2J57A 1NDTA 3SBPA 2GC4C 2DYSB 1IC0A 3FT0A 1SF5A 3WG7B 1W8EA 1AS6A 1V54B 1JXGA 3TBBA 2CCWA 1KGYE 1J9RA 3IN0A 4G7SB 4AKOA 1MDAA 3EH5B 3PXLA 3T6ZA 3NJJA 1X9UA 2R7EB 1AR1B 3NP3A 1JZIA 3EH3B 3NP4A 1JVLA 1KDJA 4G70B 5B7MA 3QQXA 3ERXA 2WSDA 1E5ZA 2Y69B 2ZOOA 2H3XC 1KV7A 3PLYA 4GY4A 1GY1A 1NIDA 2MRYA 1A65A 3ABGA 3V9EA 2BO0A 3CVCA 2GC7C 1E65A 3FU7A 2PP7A 2MTAA 4A68A 4DP9X 7PCYA 1GY2A 2Y1AA 4F7KA 3FQ2A 1UATA 1WS7A 3T6WA 4YVNA 2AZUA 4DP5X 2DV6A 1BXVA 3QJUB 2HX8A 5D4JA 2IDUA 1A4BA 2VW7A 3RYMA 1M9WA 1MG3C 1SDDB 2H47C 2R7EA 4GXFA 4X4KA 2PP9A 4Q89A 4BK5C 2GB2A 1OE1A 2YAOA 4WKXA 2GSMB 2BP0A 2NRDA 3OMIB 9PCYA 2AVFA 1NWOA 2B08A 4UAHA 1CYXA 1ZDQA 3PAZA 1XMEB 5F7BA 4KO7A 3UAEA 1URIA 2XYBA 2BP8A 3CDZB 3KW8A 5TK4A 3NSDA 2DY2A 1JXDA 1SF3A 2XV0A 3AG1B 3U25A 4KO6A 2W8CA 2XU9A 2XVBA 4DPCX 2CAKA 3IE9A 1BXAA 4PAZA 4YSEA 2VM4A 3TA4D 4HIPA 4NB7A 4CSPA 1OOWA 2FQFA 3ABKB 2YAFA 1ETJA 1TEGA 2IDQA 2UXVA 2J5WA 1JZEA 2XWZA 2YARA 4HHWA 3H56A 1JERA 2AFNA 3MBWB 1V55B 4Q8BA 3AW5A 2VMJA 1VLXA 2BP8B 2EIKB 1J9TA 2PCFA 4A67A 4AZUA 1AOZA 1SFHA 1X9RA 3CZUB 2CALA 3S3DB 1BXUA 4ZK8A 1ZDSA 4AKPA 1L9TA 2XXFA 3AY2A 3G5WA 1GS8A 3N2JA 1RZQA 3QJQB 2FJSA 2OJ1A 1YLBB 5I5MA 1OE3A 4L0PB 2P80D 4G7RB 1F56A 2IDSA 1SDDA 1ZIBA 4BDVB 3AG2B 4DP8X 1CURA 4E9YA 1FWXA 1ZV2A 2ZWNA 4PCYA 3FS9A 5B7FA 1OF0A 4JHUA 4KOCA 1AANA 4GP4B 5B1AB 4BXVA 4E9SA 4TXVB 3HB3B 3ZX1A 1J9QA 3S8GB 1BYPA 3L45A 3X1GA 4YSTA 4YSSA 4HCIA 2XV3A 3ABLB 4MFHA 1ASOA 4YVUA 1PZBA 1M57B 2OCCB 4A2HA 1W6WA 3CDZA 2A3TA 1KCWA 2WO2B 4BWTA 2HXAA 4QLWA 3FYEB 2YAQA 3OD3A 2HZHA 2X87A 4DP2X 4A2FA 2XXGA 1NWPA 2GI0A 4YSCA 1AAJA 2TSBA 1NPNA 5I5IA 3WKPA 1J5CA 3NJMA 2HRGA 2EIMB 2PPEA 2GBAA 5ANHA 2I85A 2UXTA 4NAJA 2XLLA 1NPJA 1SHWA 4A66A 4YSPA 5EHFA 1AZUA 4F2EA 3BQVA 3FQYA 4G7QB 2GIMA 2YAMA 3DIVA 3ZBMA 1QLEB 1ILUA 2TSAA 1A3ZA 4GP5B 5AFAA 3PAUA 3X1FA 2I7SA 2LLNA 3OMNB 2IH9A 2B3IA 5FC9A 1PMYA 3CG8A 2AZAA 2YXVA 1AQ8A 1E30A 1BQ5A 1PY0A 2FNWA 2J55A 2QPEB 1ASQA 3EH4B 2CUAA 4AX3A 3UACA 3BVDB 2YAPA 1CYWA 1R1CA 2HRHA 2BW5A 2IWFA 3NT0A 8PAZA 2BWDA 3NJFA 2XX0A 1JXFA 2IWEA 1HAUA 3IN2A 5I6OA 3KW7A 1PLAA 2PPDA 5PCYA 4BWUA 2PPFA 3UGEA 1WA0X 4G72B 3PAVA 2P80A 1AG6A 1L9OA 2EILB 1ADWA 2FQGA 2IWKA 1PZCA 1ZPUA 2YAHA 1V10A 2W88A 2AANA 1JZJA 4N4YB 1BEXA 3N55A 3S8FB 3GXUB 2HLEB 1GYCA 1NIEA 5D4IA 4KO9A 2BW4A 2IDTA 3H4FA 1QHQA 2UX7A 3QJTB 3QJVB 3WNJA 1TU2A 4DP0X 1ET7A 1N68A 1KDIA 4E9XA 1AS8A 4DP1X 4YSRA 4HZ1A 1AZCA
chains in the Genus database with same CATH superfamily
4DW2L 3VXMB 2VN4A 2ZCKH 3F7YB 4X0NA 5DHVB 5JA8B 3BAEH 4Z95H 1UACH 4NQDE 1ZVNA 4N1HB 3BKML 2NXZB 4KRPB 4BV1A 3MROB 3ATBA 5D9SB 2ZXEB 1KYUA 2JLPA 4JJOA 3P0VH 3MMEA 1DDTA 4HA1A 1YJDH 2YK1L 2R4RL 4KKRA 1P4BL 4IRJD 1SDAB 1YHPA 5A16A 2PTUA 3CFKB 4YIQB 3NRQA 2WVSA 3BKCL 1CDYA 3SY0A 1BIIB 1RHFA 2R29L 4U3SA 5TFSL 5FFOA 5FUOH 4PJFA 3T0EE 1U33A 3DK0A 2DI9A 2WYIA 3EJSA 5ESAA 4CMMB 1ZS8B 3JXAA 4LLDB 5AZEL 1GAFL 4NO0A 4W6YB 1A6PA 2YPLE 3V6OE 3QJSB 1BMGA 4Z7WA 4DO6A 2AEQL 2MQ0A 2V2WB 3VRIB 3PJNA 3JV4A 1A8JH 1PLBA 2D9CA 3MV9B 3OPZL 4WZ9A 2MWCA 4JL1A 2WWMC 5E8OB 4OM1L 2B1AL 5JPMC 4PVNA 1Z3RA 4NCDA 2MOGA 3WV0A 1GSMA 1SDYA 3NOIA 2BIPA 1L7TH 1JS4A 3FO0H 3DYOA 1DLFL 1JPFA 3GMQB 2FX9L 2OJZH 2UWEF 4BFBD 4OJCA 1ZHLB 2DIBA 3LZFL 3UDWC 3ASNB 5LDSA 2DQ6A 4ZOCA 2BSRB 1GGBH 2OL3B 2N59A 1I9RL 4NQVB 1VF5C 3HAEA 3RLSA 3SKJL 1YPZA 3VFGL 5IIEB 3K1KC 4TQHA 4ALAC 1Q0XL 2AAAA 3OJDB 5FR3A 3V0VA 3O9WD 4ZMYA 3A47A 4N2CA 3H0TA 2GFBA 3R4RA 5D1XE 4Y89A 1O9VA 2EQDA 3UAJD 4KMTH 4CVUA 1I8MB 4P5KB 2V5RA 1AC6A 4R4ND 3FQ1A 3DPDA 1ETB1 1NH6A 1U8MA 1MW0A 4KNSA 1SY6L 2VM3A 3RL1A 3T2OA 1QLFA 3MLZL 3UMTA 3PCYA 5I82A 3KEDA 5F9JB 4H8UA 3TN0D 2HVKA 5ACLA 1A14L 1SYSB 3FAWA 3MBED 1B2WL 3CE1A 4Y8DC 3BQUC 3H9SD 1OB1A 5D5MB 5D2NC 1IKOP 1KPRA 2A9NH 3LRLA 4N86A 4JFEE 4Y4FA 2FJGA 4ZAKB 4DZ8A 2G0LA 2VABA 4U3SB 3ZE2E 1WC7A 3G6JF 1E6OH 3EFOB 3RL2A 1MNUH 1HXMA 3BSZL 1A7PL 1CFTA 5E1GA 1QYGL 1X9LA 4PLJD 3GO1H 1GC1C 2QELA 3N42F 2AJZA 1MSPA 4Q52A 2BSTA 3MCKB 4YHML 1AGCA 4WO4C 2DYRB 3HFMH 3T0WA 4OCWH 4A2MA 4JFDA 1U2YA 4NSKA 4N2HA 1THAA 1E28B 3HPJA 4XC1H 4A2DA 2LVCA 4LQ1A 4Z3TA 3VXRB 3BLKA 2GJRA 1T0NA 2JKTM 3EBIA 3QRFM 4Z5RA 3QDMB 1TYJA 5I26A 3LRSB 3O3AB 2RMNA 3MKKA 4P06A 4RX4A 3RVTC 2JNZA 1EX0A 4HKXB 2R0WL 2OTUA 3ZKXB 2EEDA 3V9CA 2EH8L 3WY4A 3C75A 1EXHA 4ILDA 2VAJA 2NY0C 1RZGA 5DMGC 5F7UA 5GZNC 3UXFA 1M6UA 3ALXA 3V0FA 5EULV 2Q3AA 1F8TL 1QPXA 2YXWA 4MNQE 4QCIA 2VZSA 4P2OC 1FG2B 1OSZA 4DGIL 1PFOA 3I9GL 3P40A 3E2HC 1BQHB 2R1YB 3KPOB 2UZIH 5IROA 4A2EA 1K4DB 2LTQB 4P5KA 5FYLE 4Z7NE 1SEBB 5FYKE 4YEEA 2DEWX 1NGZA 1TDQA 1U8MB 3VGFA 4YHPA 4F7MB 4GG6F 3ULVH 3QW9A 5I0DA 2NCMA 1LMKA 1OCWL 4R7XA 3J7HA 5A1AA 1MAJA 3QXAA 2WVTA 1IGIL 4IRZH 4PWGA 1PZ3A 1T21B 4EE2A 1ZSDA 1H5BC 4QDGA 5EZLA 5CCJA 4XB3A 4PRPD 5AVRB 5HI5C 3KLAB 2XDHA 1G94A 5EUOB 2E7BA 4YE4L 1HHGB 3O9WA 3R7RA 4HUVA 1Z9LA 3CQFA 3K6IA 3GBNL 5J3HD 2XQBL 4PJ9B 2FBJH 3IB4A 5KBKA 2P48B 1AGFA 1WIPA 4P48A 4U6VH 2MCPH 4DOHE 1SLWA 1GA2A 2YBRB 1J5DA 2IOIA 3QIWA 3CX5J 5ERWA 3QDGA 3RPIB 3CLWA 4HIIB 4HSQA 3IJEB 2DYSB 3ARBB 4KWUA 5B21A 2V9UA 1AS6A 3OAYK 4G42A 3CZFB 3PABA 3UC0H 1BCIA 4I0PD 3PWVA 4H2AA 2ATAA 2HJFA 2XZQH 4JFQA 3FDWA 4Z3IA 5DVPA 1N6VA 3UBGA 3TBTB 2C1PB 1BD2A 3O6LH 3EH3B 3VFSB 4RESB 4BCXA 5F89B 4ZDHB 4HH9A 3BKYH 6TAAA 3MCYA 4PU2A 1HK6A 4HGWB 3DVIA 2EE3A 2GW5A 3V4UH 1IBFA 3WMSA 4I2XB 4AGPA 2W80C 2ICWI 3BC9A 3GINA 4TF4A 1JHLH 5I0XA 2ZXCA 4RETB 4XCYA 1QRNE 2JKNA 3IU4L 3QDJD 3QUXB 4C56D 1IEBB 1VAHA 4A7QA 4C4BA 1T0OA 2N4IA 1PKOA 3H2PA 5HYQA 1NGQH 5HVGB 2YKKA 4HPOH 4YVNA 4NYLA 1BXVA 4DK3A 3QJUB 2YEZB 1F4YL 3IE4A 4KZDL 4R0LB 1L0YA 3BVNA 3U4KA 1G7IB 1UWFA 5JHLH 3SCMD 1M2VB 2WOYA 3NZHL 2YGOA 4PRNA 2PP9A 2XWDA 3WE6A 4JRLA 2V17H 2ENJA 2J12B 1J1PL 4MQ7B 5FO9A 3WL9A 4S1QH 3U30B 3WFCL 3BW9B 1S7SB 5CS7A 1H3PL 1TPXB 2WXLA 1JNNH 1ANUA 2VR3A 1OAJA 2YN3A 3G9AB 2O5NA 4R4FL 5E2TL 1L0PA 1W72B 1LO3H 3V5KA 5ETUA 3B8SA 5LBSH 3BGFB 4HKZB 4YIQA 1E3ZA 3CDZB 1HQRB 4Y19D 3GBDA 5EEYA 2QHRH 1Q4NX 5G4NA 3UGUA 2NY6C 4LSSL 4UQEA 3SJVE 5F7WC 2NMSA 3AG1B 1CFSA 1EGJA 4N22A 3QWQB 3MGOA 4GW4A 2N01B 1USZA 4PY7B 3LV3A 1UOWA 4NQUA 1QFHA 2RIKA 5E6ZA 1ES0A 1IBHA 1I1AC 3S3JA 3V4VA 1CDHA 1U8IA 5F3BB 1J0ZA 3BH8B 4EO5A 4I5BA 4R4BA 3UTQB 1AO7A 1D6EA 4XN9A 4R26H 1QSVA 1A6WL 4EUPB 2AERT 3VQLA 1SBBA 1V55B 1JPFB 1FFPA 4FN0A 3WJMA 4DEWA 4ZBJA 2EDXA 3QUXA 5IQ7H 2X4OB 2EYSB 3CK0L 3FUHA 5DD6A 1T3FB 2VMDA 3GSXA 5DJYB 4HUXB 4W9DC 3AY2A 2XTJB 4HS8L 5HTSA 3SDDA 3H9YA 2CUMA 2FJSA 2OJ1A 1YLBB 3Q2VA 4IOIB 4NYLB 4XCNB 4TOYH 2Q10A 1M1XA 5FWRA 4Z0XA 3CPLA 4LLVA 1FGVH 4E41D 4BYHA 1UT9A 5H2BB 2MHAB 1F41A 4PMEA 2B3RA 4OGAD 1UKQA 1AANA 4HSCX 2IH3A 3BKJH 4L8BA 2YK1H 4B3EA 2KT6A 4B41A 5KVFL 1PZ2A 5GGSA 3QZPA 1UOLA 1HWWA 2C7UA 3L45A 2QQKL 4H1LB 1DQJB 4MFHA 4N6RB 4OJFH 3DHPA 4O2FB 4UT7L 3WUWG 2IOMA 4Y5VB 3P4NA 3TJEH 2P52A 4OZIB 4NT6A 3SDAB 5IJDC 2WO2B 5C07B 2CMRL 4J23A 3L2LA 2XXMB 1OP5H 3FQNA 4M6OL 2XXGA 3JZYA 1XMWA 4Q58C 4DETA 2VLRB 3AREA 1AAJA 4KTDH 3PJSA 3EO9L 4O5LH 4X4YA 5L4JA 1J5CA 1N2RA 4PS4L 5DUBA 5GPRA 3QCTL 3ZMNA 2LAGB 1RURL 2UXTA 5KW9L 3S37X 1FNLA 1WFMA 5I1KL 3SDXF 2GIMA 5FM4A 1E5UI 1O5DT 2UWEA 1XTMA 1TTRA 5ILTH 1G9MH 3V79C 4X5XA 1UHVA 1RHHB 2X70A 2CIKB 5IMOA 1MKFA 2YLKA 4DESA 1UD8A 3FBKA 3VCLB 3QXDB 2R1WB 1NC2B 2F8OA 2X1OA 3FO2B 2AZAA 3NTCL 2FH6A 1XD0A 1KTDB 3V4VL 3UJJH 3IJ8A 2LV4A 1U4EA 1XH3A 2XWTA 3L9RB 4M7KH 3KJ4C 3CXDL 1RXLA 4CMHC 4ZSOA 3KBEA 1MJ8H 3MRPA 2H2PC 5AUMA 4M43L 1SRDA 2BWDA 2H32H 1J1XH 5I9QB 1HHIB 3CNKA 1LEGB 1G0DA 4WNQA 2LFEA 4KMTL 4FLSA 4EQ2A 4CBPA 4ELDA 3QZBA 1CBVH 2BSDA 2ZPKL 1ZLSH 3BVTA 1A25A 2WBJB 3DX0A 1EEZA 1O7DE 1ZPUA 4RAVB 1AXIB 1TSHA 5ALBL 1BJMA 3SE4A 5I5RA 2V2XB 2JKLA 3VXSA 4Z76A 1B2WH 3EGXB 3KPSE 1NEPA 4L5FL 4Q6IA 5CEYB 1H6TA 5D4IA 4UB0L 3O6KH 4OB5H 4LNRA 5C71A 3QJVB 5BS0A 4GBXB 1QI5A 3VSUA 5HBBA 5DS8B 2VL5A 2WXQA 3HNSH 5D1ZI 3SGJA 2PYEB 1KYOJ 2NSMA 1FV1B 5F7EH 2ZUVA 4ALAL 5DHVH 1RQ5A 3QIUD 4IDLA 1B9ZA 1TXKA 3KBHE 1Q1PA 4K9EL 2MCAA 5SWZE 4L1BA 3SZ6A 1Y6MR 1Y18A 1YNTF 4YHMH 1WHPA 1JWUA 3KPSD 5IQ9B 3K4DA 3S35L 4MAYA 1C9SA 4PW3A 4NN7C 3BJLA 4FLHA 1DBML 1W72H 4Z7WB 3QUZA 2WXPA 4KGJA 3MBXL 4U1NB 4XC1L 1SEQH 4X6DA 2IMNA 3WDIA 2JELL 2CJ3A 4L3EB 1XO8A 4ZTPL 2PPAA 1P7BA 4ZPTB 3VWKA 3FSZA 3DWTA 3A5VA 2AK4B 4XB7A 3SPVA 3WO4C 1BQRA 3U0PB 2R1XB 4G8IB 1L0QA 2I7OA 3BN9C 2GUOA 4ZS6C 3V6FA 1R3LA 1TEFA 4OUOA 3GC3A 3VWJB 3U83A 5C0BA 4NEHB 1N10A 3ML9A 4P5TC 4GG8B 3IPEA 5AUMB 2WNWA 2AXWA 3QAZC 4B9GA 2VSCA 4R7NB 1G7HB 1WA1X 2ICWB 4JO5A 5IR1A 1OZTG 3DKHA 3ARFB 4FP8L 3KM2A 1MH5B 1ODAA 3WD5H 4HU8A 1R9FA 4J8RB 4LPTA 3I9AA 2A6JA 3FONB 4X5LA 3H9SA 1ZXKA 2A9DA 2V3DA 3QQ9C 2BMKA 5CD3A 3BH9B 5DZAA 3KJ6L 2RH0A 3CN1A 1G1OA 4JAMB 5E2WH 2WQAA 2Y07H 4BFRA 5C0CE 4WJKB 4CSZA 2NNAA 3HNVL 1XSJA 2H1XA 3GLZA 5F3HB 3WGUB 3RB7A 1FZJB 1QKZL 4E9TA 1XIWA 2PP8A 4BK4A 1MXDA 4X8GA 2J6EH 6FABH 1XEUA 2VOTA 4Y4FB 1RUKH 2EVJA 1HILA 3GBNH 3UPCA 1E2ZA 3KYNB 4HHAB 2OMYA 4U6VL 4QRTB 3FB6A 1G9MC 2J21A 4G2AA 2N0KA 1MQKL 1NCDL 2A5UA 4W9ZA 4KJQD 4M4PA 4Y16D 3IDIA 3NCYP 1R3JA 4KKZA 3MV8B 3WNIA 4TPRH 2CLVA 3UAAA 3OZ9L 4X7CC 2VXSH 1KYAA 3OXSB 5E99H 3LRKA 2ZCLL 3GGWA 4GRLD 5I0ZA 4AQAA 4ZUWA 3U0PA 3JV6B 4AIOA 4H0IA 1WBZA 2DJUA 1JNJA 1HKLH 1WPCA 1CR9L 3V9FA 3FSVA 4ONHB 3CU7A 2FSEA 2C9RA 1B0GA 2AJSL 4ENEC 2CLRB 4P5SA 4W81A 4M62H 5H35A 3BGMA 1CLYL 1NZRA 2GSIA 3PG2A 2ADYA 2J7LA 4JMNA 1TMQA 2ED9A 1UQSB 4G8GA 3O6MH 3QPQC 4LLYA 1UWYA 3DI2B 1OTTC 1DBBL 4NERA 4P2QA 1GGYA 1MH5A 1FNFA 5AB0A 3TEUA 5CEZH 5HY9B 5FGRA 1I4FA 3TWYA 2D73A 2B59A 2P5ED 3REVB 3LS4H 4U6XA 5D7SH 2BMKB 5CD3B 4A7VA 1GR7A 2OQJB 1NGQL 5IM7A 2NY7H 2XN9E 1HCVA 2DYPD 2XWJA 1BECA 4WTXA 1WJ3A 3MA7A 5FV1L 4KK8D 1RU9H 2BFVH 2PMZA 4IJ3C 4KGLA 4B50A 3ABMB 3SE9L 1PIFA 2L0DA 4XWGH 1UCBL 3BAJA 3B7SA 4PJGF 3RX7A 5L9DL 3FU6A 1J1PH 4Y8AA 5GRZA 2DBLH 1S9WA 3X1NA 1J7VR 1U58A 3HLKA 4UTAA 5AB2A 1TZAA 4ZW3A 2X53A 4WVRA 3DJTA 4G6FB 1EDYA 1XCXA 3OQRA 4X9BA 2IQAA 1HX0A 3GMLB 3FB6B 5E8NA 5EBGA 1FL6A 2BXYA 4PLKD 1L9RA 5IV2B 2HMID 4N8PA 1UEMA 4MD4A 1LO3L 2DL9A 1MRDL 4Y5YA 4A2GA 4OFYD 3GXFA 2B5IB 4RGOH 4BKSC 4M8QA 2HT2D 4LEXL 2Q2EB 4K8RH 2PXYB 3QIWB 4N9OB 4NN5B 2YPVH 1E5BA 3FO1B 2FUQA 3SPGA 1J10A 4JX0A 1ULVA 4AQAB 4OBSA 2DQFB 2XTSA 9CGTA 2MJWA 3FULA 2GK0B 3ASOB 1ORSA 5E94B 1INQA 3SBRA 4S1DD 3PHOB 5DFVC 5JDJA 1T2XA 2VXUL 3VI4F 4JFXB 3MJ8A 2WKGA 1HYRC 2NW3A 4I4WA 5KSUB 4HPYL 3TIEA 2P43B 2MH4A 1A1OA 2E7LA 5BJTA 2G75A 1T04B 2BSCA 1QPPA 5GGQL 3OB0K 2NYZA 4R26L 2OZNA 5AVZB 5JPNA 1HL9A 1ZXQA 1U93A 3TU6A 5EO0B 5LO7A 4X5XB 4E9QA 4UTBL 4I2XA 1FNSH 1XGPA 4JZNA 4XVOA 2WUBH 3L2NA 1B4RA 3ARGA 4FDWA 1SF5A 4RIRB 3Q9PA 2VJ0A 1DBKL 5F9WB 1LE5B 4G9FD 1F90H 3SKOA 2JJTC 5FKPB 2H0JA 4Z7AA 4AKOA 1SXCA 3A22A 1NJ9B 2K78A 2NY2D 3RWCB 3MRIB 4AVJA 4YS4A 2YRZA 4FZEH 4WNQB 4BSWB 5BOZG 1OO2A 3FT4B 4KAQL 1R3HB 2V6HA 4ZPVB 5F2FA 4ZMWA 1WUZA 1JVLA 2P5WD 1TOXA 3CFDA 3BUPA 1Y7VA 5DO2D 2WZPA 3V6ZA 4F7EA 3I02B 4HXAH 5HYJB 2WBJA 3PGCB 3PQYB 2EDKA 4WGKA 3QAQA 2H3XC 2W9EH 4JPSA 4N0YL 5IV2A 2ZCZA 5DVLA 4HEMA 3U1PA 3T77A 1UVQA 3UP6A 2X1XR 4FQ2H 1HI6B 1UKSA 1HZHL 2WD0A 4HWBH 3V4PH 1R0AL 3VFRA 2YXMA 4OZHE 2VLLA 4WEBH 4U1HA 4XNXL 2BINA 1NANI 5JW4Q 5CFHA 3GMQA 4U2YA 2FJUB 1FIGH 5C0FB 1QWUA 3F84A 1KB3A 3B3IB 2J2ZB 4OFKA 5IFAL 1WSST 3EIFA 3GXTA 4O5LL 3V5DB 3F7KA 2DQTL 4XMKL 1JZ2A 1D9KB 1P6WA 4G6AD 5ABAA 2DBJA 3ALWA 4X4XA 3PS6A 2NW3B 4FFWC 2A9MH 4FQXB 1DANU 4PRDB 5CJQL 5FYKD 5ILTL 4H4NA 4U0RB 1NFIB 2BP0A 4P2RA 1HSBB 1NCHA 3SQOH 4APXA 2B08A 1OT1A 4I5BB 3RVXD 1WZ1L 1ZDQA 1RPKA 2EZ0C 2D8KA 3MCLL 5HGDB 2CJTA 3LKOA 4M7KL 3RL1B 1ECYA 1PG7W 2XYBA 5EOCL 3IFNL 4X4MA 5DZJA 5BCAA 2I07A 3FMGH 4MMXB 3VTTA 3NSDA 5DD6B 3GMOA 5EV7A 1UADC 3L5XL 4YR6B 3WUWB 4NC1E 3I3EA 2EDLA 2WXOA 5HGAB 3ULVC 3MA9H 4AV0A 1IIKA 4XCNA 3IMRA 1P5VB 3PHSA 4H1LG 1CFNB 2CAKA 2GIXA 1GGCH 5DRWA 3QEUA 3E6FA 2E8YA 4RA0C 4MCYA 1FE8H 1KGUA 4M7JL 5DHVA 1TTBA 3LQAL 1IGTB 4X83A 2IDQA 3HW7A 3RVXC 5EZIL 3QCUH 4O9HH 4CU6A 4OB5L 2EDEA 2AFNA 2OMWA 4DVRL 4G83A 3MLTA 4JKLA 3HG4A 1I7TA 3L3IA 4KROC 5L7XH 4ZJ9A 4B0MB 4RMBA 5F0LB 4AZUA 4NGHH 4WWOA 3FTZA 1N59B 1A21A 4EVNB 1BF5A 1Z0NA 1D7BA 1JGLH 5D1XD 2WM0A 1OPOA 3GK8L 4L3ED 2AW2A 4GAAA 3EYQD 3Q8BA 3QIBC 4NJ9H 2BXZA 3CBRA 4XP6L 4MGXA 3DMMA 2CRMA 2ED8A 4FI8A 1X4ZA 4WW2A 5A2FA 1SDDA 3MJ9H 3Q6GL 4FQIL 1WDAA 1XIWD 5E5UB 4RNRB 4XXWA 3MBXH 2OZ4L 3AXLA 3MRGB 1D6VH 4MJ4A 5F0PB 3VGHA 3FS9A 3CMOL 2OXGB 4GO9A 4GS7C 1IJNA 4ZTPH 1FAIH 3OKOA 5T33L 3EGDB 4X98A 3DV6A 3T0DA 1K4DA 1PIGA 2APXA 4ANVA 3BZFB 3QFJE 2M26A 3GGWB 1FC2D 3L3HB 4HWZA 3L3JA 3TFKC 4YSTA 3PWLB 3BFWA 5D1ZB 3NQIA 3HI1A 4YSSA 3P11H 4NNPL 3EFDL 1A6VL 2R1WA 3FTSA 4MCZA 4Z78A 5JXED 5DRZA 2A7BA 1RUPH 4DUVA 5IQLA 3P0GB 2WBJD 3HHSA 3DUSA 3WKML 4U6HB 4F24A 1WT5C 1UZ6F 3NGBC 1H0DB 3C60D 5E23A 1HHGA 2HRGA 4X6FB 2ZXGA 3VI3B 1NCCL 2DJMA 4JZJB 4ISVB 4LLYB 5ANHA 3SGKC 4U1KB 4HEME 3ETBJ 5JOFA 3KEHA 2DAVA 1WICA 4GSUA 3B8YA 3SDDC 1QLEB 3CH1A 4LSUH 43CAA 3HE6A 1K85A 4NQTA 2ZYRA 4MYWB 4P23B 3HNVH 2NSXA 3QWOA 1ZLVH 4AK2A 3T6QC 1L7IH 5FA3B 2E59A 2VLME 2WANA 3C6EA 5IEKA 4FGMA 5FYLH 4XO9A 1MJ7H 1PZ5B 3N5AA 3PWPA 4OCNC 1G7PA 1ASQA 2P8LB 2J1KA 4FERA 1MHEA 3K74B 2X89A 3HS9A 1N7ML 5D2NA 3HMWL 2AJUL 3HA0A 1XGUA 5DZ9A 3ILDA 1Z9SA 4IW4C 5DYOB 5L8LB 1RK1A 5GSVA 3VFNB 1P6FA 2HWZL 1GH7A 4TPRL 2OSWA 3TBYA 4CGTA 1AKJA 4KKBC 2VLRD 3AXLB 1EK3A 3PYCA 4FG4A 4PP1D 2O93L 4GO6B 4Y5YB 3SGEI 5E99L 3CIQA 5ID0B 5C07D 4Q0XL 1HHKA 3CLEL 4BQ9A 4DK6A 5T3ZD 2NUTB 4DN4H 1KCRL 1IKFH 3SO3C 3QG6A 3MNVA 1DQKA 2YA0A 4U1MA 2WKOA 5D7LE 3V5HB 3J27A 4KKLC 1NEZG 4BE6A 5LNDA 2VDLH 5LVEA 4PVMA 5B22A 3ROLA 3ZKSD 3LAFA 3WNJA 1S7VB 3VRLE 3O3AA 3LRMA 2NY1C 3G04B 4WEUD 1KXQE 3ZO0A 3LN9A 3I2CL 2Z4TA 4YH6A 2ENPA 4JANA 1B0RA 2Y1YA 1EJOL 3HC3H 1MUJB 3QI9D 4W6WB 1AY1H 2VUKA 3VGGA 1A2YA 5EFIB 3W11C 1SLVA 4O2CA 4M5YH 5EO0A 5I66A 2VQ4A 3O3DB 5C70A 1D5MB 1MI5E 3SBQA 4G59C 1IC5H 5C0DB 5IB1B 3FRPB 5ITBL 3NAAL 2VKWA 1L6ZA 4DERA 4YHPB 1SJXA 1FVDA 5IB3B 1ZA3B 2YZ8A 3GI9L 1BXXA 3QPKA 4P2OD 4PHXA 3FTVA 5GRWA 1LP9F 3MX0B 2NDFA 5G4OA 1N5AA 2NY0D 4P9MH 5DMGD 5GZND 2Q7AA 3VQMA 4AYDC 4HC1A 2XICA 4G82A 3MRDA 3RWCA 1BBDL 2VXTL 3I75B 5IY5B 3AXIA 3IGAB 2AJ3A 2R0LL 3O41A 1S7XB 1JBJA 2ADGB 3ISWA 5DYOA 4TVSa 5FM5M 5GSVB 1PJ9A 2DIEA 5B1BB 3W1ZA 1NLBH 2BHUA 4RGOL 1XF2B 3L3GB 4ZMVA 1NIFA 4UM9A 1MFEL 4O2EA 1BJ1J 1DEDA 1R3JB 1NPUA 3MV8A 2YPVL 4RX4D 1T1ZB 5HDLA 3ZE1F 5GS2D 4IEFB 3FCUB 1QX1A 3HE6D 5F6IC 2BOCB 4ETQA 2GY7B 5EU6E 2EINB 4Q4IA 2B0SH 3NFPB 3S3CB 4CADB 2KYIA 2GYSA 5HI4C 4LPXA 3P30H 1WBXA 3ROLB 1Q94A 1XBDA 2D2OA 3G08A 4WNSA 3QISA 3MJ6A 4X6BB 1PG7X 3C6LA 2QZQA 1T1XA 4E42B 3K2KA 4L1TA 1LILA 3QH3B 3POCA 4JM2F 3N06B 3RVUD 4MASA 1CT8A 4N2EA 4PYHA 1UM6H 3ZMRA 3C5SA 2VDRB 2LU4A 2X28A 3KPRE 1AG0A 1ETA1 3TBTA 2VDMH 1BD2B 4UTBH 3T2LA 1UQSA 1YO4A 5CZXD 3B6SA 3B7RL 3RJOA 3K5RA 4F80A 4HGWA 4JPKH 1IL1B 3APNA 1Q0YL 4UQ3B 4PWHA 5LKNA 3ULUL 1S7UA 3VD7A 4D9RE 1KPVB 4KO5A 1KIRB 2P24A 2GAZB 4F2ME 4Y7MA 3A67H 1LD9B 4FTVB 2GHZA 4CW1B 3DX2A 4AKQA 5GRJL 4GT7A 2QT6A 5HYQB 5C0GA 4JG1H 4YSUA 3OMAB 1K5NB 4JQXA 5JW4N 2DM2A 1EO8H 3OAZK 4JO3L 5C6PB 5CHNB 1YEHH 3CUPB 1IC7H 1GCYA 1M2VA 1OE2A 3P02A 4NAMA 2DTSA 4BZ1H 1AYRA 2FEEL 3ZZQA 2QSVA 1YNLL 4HIHA 2ZUQB 1THCA 1TQCC 3BP6B 3GMLA 1L5GA 3BZEB 4XRCB 5IMLA 3L5WA 1R0AH 3RGVA 3T4AB 3UCQA 2BY0A 4XVTL 3MC0A 4XNXH 2OR7A 4KFZC 1OD7A 4AGOA 3L3IB 1TEYA 4RH4A 4WHYH 4G6JL 2AF2A 2FK9A 5KAQG 2FECL 5DF0A 3HG5A 4CN1A 4LDCA 3SQRA 4OZHB 2VLKA 3SYCA 2DQTH 2Z92B 3M1OA 3ME0A 4G80A 4ICWA 1WBXB 4PGEB 2EVHA 5DO2C 3PV6B 5ID1A 4WO4B 2RR3A 1GKEA 3CFCH 4HX1B 2AQRA 1B6UA 5D7HA 5GGUB 4FTDA 1PY9A 4K07A 4KNTA 1NBCA 3QNZA 1AR1C 5AVQB 4JFSA 1WWCA 4KUZL 3HTLX 3LY6A 3H0TB 4KK9D 4F9PA 1KOAA 2HTKC 4FFVD 1GGUA 1I7RA 4PJIB 1DBAL 3BLPX 1OW0C 1P7QD 3OKOB 4XVUD 4DPBX 4QRRD 4X98B 1D5ZA 3RVVC 3D0AA 4H25B 2DWEB 4PJGB 4NZTH 1BWWA 1U9KA 5DJZA 2BY1A 5F7NC 1J87A 1DQLH 2YMXL 3VMPA 2H32A 2X4TB 4Q56A 1KIRA 3L5XH 2AXGB 2EYTB 2HVKB 5KJ4A 4YX2H 3WTXA 3NIGF 2FD6H 4ONGH 4YHLL 3TT1H 1A66A 2E9WA 3OX8A 3SDDB 2R23A 4YGVA 4D0DB 1FE8L 5L6YH 1S5HB 5LN4A 4OFIA 1IGJA 3CZLA 5D93B 5JQ6H 3HFFA 1BQSA 1GHFL 3TCXA 1AGEA 4BXSV 3C60B 2VN7A 3IDYB 3VXQB 5C09E 3QCUL 4O9HL 1KN2H 2MCMA 1XR8A 5L2KD 4FNQA 2WMPB 2EIJB 4MXQC 4P2CG 2PCYA 1S7RB 2IALB 2F53E 1KBWA 1SGKA 5AVVB 1O7VA 4P4RB 4QOKD 1RUML 4LCYA 1HI6A 4WWKA 3RA7L 3ZDZE 4TYUA 2C7UB 3RGVD 4FNLL 5ITFB 4ZXBA 2CXGA 4IBUA 3S5YA 4G8IA 3VG9B 1DE4B 3EYSL 2VRAA 5C07A 2PR4L 1MFDH 3EH5B 3FQUA 3OWRA 3X11B 3N1MC 4NHCL 1U8NB 4HLZG 3PP3K 4Z7QE 4PVLA 5JNYA 43C9A 5LXVA 1KGCD 4URTB 5DVMA 3U1SL 3AU0A 3HLAA 1K72A 4G1MB 1E9PB 4V2CB 4YQXL 1FGNL 3FT2B 4YHKH 5FYJE 3QNZB 4NFCA 4ORZC 1NMCB 1U8OB 4U6TA 4W9EC 3R06A 5BRZB 1N5YH 2VH5H 4IKLA 3ARFA 4PRDA 5AYTA 1O6VA 4OLEA 3PNRB 3QQXA 4TTGA 2H26B 2XHNA 1NL0H 1T20A 2J3SA 4N68A 4N20A 5D1XB 4BQ8A 2ZSVB 1YY8A 4MQXD 4YLBA 5EZOH 3C6SA 4XCEA 5EDXA 3WFEH 4MB3A 5C0RH 5GJSH 1HIML 2QLYA 3UTZB 2NNAB 1GY2A 4F7KA 4ESKA 5DA4A 1UATA 4KRLB 5D96B 1UM4L 3BWAA 1QR4A 2WLKA 3N50A 5D4JA 2HPOA 1C5CH 5EIIG 5DYFA 2R7EA 3TYGH 5EUOA 1A7RL 1QFWI 4YGVB 5D6DA 4D0DA 1MWOA 3DX6B 2QGEA 3RE0A 2GB2A 3O9WB 3EKCA 4WKXA 3QEUB 3LXAA 1GOFA 3QUXC 3QRGL 3ARSA 2QGDA 1OT4A 1TO5A 1TO4A 4MJ5A 2QHLA 4PRHB 1Q0EA 2Z8VC 3X13B 4OGZA 4OF7A 1EEZB 4RAVA 4M93B 4HOZA 3VI4A 4ONOA 2EAEA 3ZTJH 3MJWA 2FJHA 1XZ0A 3HC0A 3D30A 2DLIA 3MUY1 4KI5D 1C7TA 4N0UE 3UO1L 5IBLD 3A4EA 2XQYG 3MRCA 4HXBL 2E4TA 1SYVA 1ZAGA 2JKJA 2HLFD 2O6EA 4P4KC 3GKZA 4S2SA 4U49A 5ICXB 2AJUH 5I73C 1QEWB 1Q9LB 3F12A 3QORA 3UZQA 3E8UL 1BOYA 1AR2A 2NY4D 5ICUA 3SYAA 3TOPA 1SF3A 4Y0GA 4HH8A 2OR9H 3S7GA 1JGVH 3PABB 1U8NA 4E41E 5JNYB 1K8IA 3CH8A 2JB5L 3A4DA 1WZLA 3LNIA 3LB6C 4CSPA 2ITCB 4L8CA 2FQFA 3E0GA 5DUML 5K1JA 1LGVA 3TJHD 4OF8A 4DQAA 3KYMB 4CC4A 3BWUF 4IMLB 1KCRH 1SXNA 2WKOF 3IJ9A 2K7QA 4J3VA 4X6DB 2VDMB 2X4UA 4G8AC 4IEFA 4LSRL 2B59B 2EXTA 3AS1A 4U6XB 3S6CA 3FN0L 1VLXA 4LVOB 2EIKB 3RBSA 4J3UA 2AK4A 4KZ0A 1M6OB 5DA0B 1TQSA 2Y7OA 1CF8L 1FJ1B 1L9TA 4HJTA 2G4GA 3QAZB 4WU5B 2PW2A 1FBIL 3V4LA 4BFJA 3HOGA 4OI7A 1D5BA 1MF2H 2APSA 1ROCA 2O1AA 3EUUA 5I5MA 4F7CA 4FA6A 3MAWA 4J27A 5IB2B 2C9QA 2Z91B 5D55A 2OL3L 4M7LH 3DPBB 12E8H 1CI3M 3B2UD 2NNXA 3GJFH 1S9XB 3EG9A 4X6FA 3MRRB 5FM5O 1HEZB 4BQBA 4E9YA 3R8QA 5IQNA 2WQXA 1MCSA 2WSKA 3NAAH 2DQJH 4QKXB 3T1WA 4G9FB 2XTJC 4FNSA 1JWSA 3ZX1A 3SOTA 5SX5K 3V5KB 4J3BA 4HS6A 3U6RA 3ULVF 4NWTL 3WXWH 4JM4L 4Y2LA 1OM3H 3T1FB 3RWFA 3CDZA 1ZV9A 4AENB 1K2DA 4S2SB 4BA0A 3WTUA 4OD3L 2HXAA 5ICXA 5D7IE 2R0LH 3QHTC 5DMJB 3L4UA 4F33A 1MHEB 3MSPA 4GKNB 3PDGA 4YSCA 2WXIA 3KXFD 4ZT1A 2E76C 4KV5E 5E1HB 4DKTA 3Q1SL 3TWCL 4GUOA 3O9WC 4IU3B 1XCWA 1J8HD 4LOUC 3HVNA 2DM3A 3DIDA 5I1EH 3GBLA 5FO7B 3VD0A 2IBZX 5MERA 1JL8A 4BH8A 1U3HA 1NCIA 4WSGA 4HJGB 4ZO8A 1AO7B 1T5XA 3C8HA 1M1SA 4X6CF 1K6QH 2H41A 5L8JB 4U1MB 4ZX4A 2IANB 3D1MC 1M6OA 4QYOA 1FUNA 1A9VA 3UZEA 1WFUA 3IETA 3P77B 1EAPA 3PHQB 1LP9B 3A24A 2CLRA 4JHWH 5ESVB 5D1QD 1Z5HA 1JXFA 2P46B 5H35B 3HS8A 4X7SH 5IROC 1JPSH 2NW2B 1L9OA 2ATPA 3T65A 1NCBH 2DWEA 2ZOTA 5SX5H 4A6YH 4ZNCD 1RJLA 4L8BB 4MJ6B 3A6BH 3IDJB 3VWKD 1EMTH 1M7IB 2CKBA 3L5JA 4GIPD 5E08H 4UBDD 3QARA 1VCBC 1KB5H 3FB5A 3BDXA 4XNQA 3RNQB 1UZGA 1YC7A 3TVMA 2UX7A 2IFFH 3QJTB 4PJAF 3CQPA 3NCWA 4WCYH 1O9ZA 1JWMA 4L3CA 1G7MB 2F0CA 1P0SE 1KDIA 4DNLA 3IRPX 3B2VL 3V7MA 2VLJE 1XT5A 5CF3A 1JZ4A 2VDKB 2MPAL 1YQ2A 4MMXC 3NPSB 4JPWH 2XJLA 1WFTA 2AJXH 4GKOA 5AW9B 4YJZL 2DQUL 2JIXA 3PDOA 1RV6X 3MRKA 1KPUB 1MIMH 1YMHB 5I18H 1U8JA 2VITA 2YXFA 1R3IL 4M8UA 1M4KA 2GIYA 2LABA 2V2TB 2Q8AH 5IFHL 3GLAA 1HZKA 1XFPA 1T5XB 2XY1A 2IC2A 4OJEH 3RZCC 4OGXL 3ZO9A 4RMUA 3X12A 1WBYB 1PFCA 1OQOA 4ZFGL 3QFDA 4PBDA 3L4VA 5F96H 5KOVC 1IFGA 4MMXA 3SQBA 1AR1D 5I6MA 2PTVA 1GKOA 3S37H 3X11A 3GMOB 2Q3ZA 5AKRA 2UYLB 1UM5L 4YR6A 3IETB 2IG2H 3T0EB 3MRPB 2VC2B 3CC1A 3IF1A 4OIIL 1HHIA 3TN0C 3C5SB 3QC6X 2M8XA 4J5VA 1P7KA 5DMKB 3TH4T 2PYFA 2NZ1A 1W15A 3K2UH 5JMOC 3B6SB 4M00A 1U8HA 2EACA 1NCAL 1NC4D 4L1SA 4X8XA 3D0VB 3L3KB 1HN1A 3FUJA 5E5MA 1RP9A 1N6QH 3PUUA 2L8AA 4ZUTA 3ECUA 4PY8I 3EJUA 5E9DD 2C9XA 3K71A 5E7FA 1U8KB 4UV4L 1I8IB 1MVUA 1NM9A 4FL4B 1S7QA 1I8KB 2W60A 3KBFA 5T3ZL 5J9PB 4ZAKA 5CCHE 2PYEA 4PJ8C 2IQ9L 4ZUVA 3ARFD 3RL2B 3CHOA 4E9LA 4XBEL 5FPIA 1R3HA 4L29A 1EERB 4NQDA 1CWVA 2BX5A 3NZSA 5E51A 4ANUA 2Y2TA 4HIEA 1JXKA 4XI5C 5JW3H 1OGTA 3K46A 3RA7H 1QO3B 4J28A 3WJJA 3QUZC 5HHVL 4DUXA 1Q72L 4YXKH 2Q5BA 2FJHB 3HC4H 4XE0A 1CQYA 5IW3A 5JZ7C 3EBHA 5DEGB 3SY6A 2IXQB 2J56A 2B20A 4JO1H 1HHJA 4U1HB 2VGLM 5TF0A 3QORB 3UZQB 3D4ZA 3IDUA 4Y7OC 4YC2C 2H5UA 4JFTA 3W39B 1R3LB 3LRGA 4H8HA 4MMZB 1FLTX 3KVQA 4N2AA 4CU8A 4X6EB 4G11A 3UYRL 2BIMA 1CD1A 5EU4B 2OTUB 5T3XD 4PJXE 3WN5A 4F1SA 1YEKL 5DI8B 4IU2A 4BFFA 3H42L 3VI3A 3B2DC 4WFHD 1KT2B 2NYKA 1BOGB 1MLBA 2H9GB 5EZOL 1E9QB 4ZZKA 1A7NL 1SQMA 3N85L 5F21B 1D3CA 1OP5K 4TQEH 1KCBA 3S5LB 3CH1B 43CAB 4W9HC 4POZD 2D31B 7PAZA 4JFFA 1L9MA 2BIQA 3ARDC 4LIQH 4P2OA 5E6YA 4CAGA 4P23A 5FHAL 5MENA 1LEIB 3P3SA 3G3LA 3BZ4B 1KB9K 4G9DA 5T1JA 2X4SB 5CEXA 2VSKB 3LKQA 4H44C 2UY7B 5B1JA 1JCVA 3N1PC 4GH7B 3DGGB 2IJ0C 1FA4A 3WSQL 2KPWA 4KKAC 1XIWB 3TYGL 1BAFH 3UGXA 1Y6NR 3TFKD 4KX9A 4Z6AT 1HWHB 5EZLB 4KKCD 1F0LA 5LBSA 5FWQA 4BDVA 2ADFL 5LGHH 4L4TE 2F58H 5DHMC 3PAYA 3FFOA 3FN3A 1QFPA 4XVJL 1IGJB 2FHCA 3MREA 3UTSD 1OWWA 3EXLA 3I85A 3VFNA 3VXQA 4A04A 3P4MA 2I9LA 3Q2CA 1U8QA 4DQOL 1CB4A 1TQBB 3MUUA 3ZT7A 2QADD 2W0FA 2Z31B 3ARPA 1R5WB 3DROB 2VTFA 3VSTA 3MI6A 4ADGA 2RQ8A 4B9YA 4BCYA 1DTUA 5F7DB 1T22B 1BFVH 3D39B 3OKNA 4P5MA 1G6RA 5HGGS 5IG7B 3SGEH 3T1FA 1H3WM 3LXCA 2NYYD 5D1QC 1FL3B 3GNML 1E4HA 5AW1B 5FYJL 5KVDH 4UQ9A 4YUEL 3TZVA 1XSKA 1F4AA 4P46C 3V6OA 3HRPA 1I53A 4NKDA 2P8MB 3AUWB 3H2WA 4H26B 5CU9A 3WEBA 1FRGL 3MUGA 5F8QC 3S98A 2HX9A 3TTYA 5GRUL 1E5YA 4ABWA 5EF3A 4GG6E 4RSVA 1GS7A 3DNKA 4YN3A 1WFIA 1AJ7L 2Z3FA 1HHHA 4N2FA 1LMIA 2BNQE 3VQ2C 1FFNB 5EC2A 5CEZE 1JHTA 5MERB 1A2YB 2ZX7A 2L04A 3PPSA 4PHZA 5EFIA 3ROOA 5C7XH 4JCLA 3F05A 3H4HA 1WV7T 3ULVD 4DVBB 5I23A 2O5YH 4EI6B 5FYLD 3WAKA 1YN6B 2GC4C 3KD4A 3WG7B 1FO0L 1W8EA 3D8MA 1FBIH 1T89C 2Q3XA 1DANT 1MHPH 4JDEA 1NC4A 4YXHL 3R0NA 1EGJL 4FQXD 5BUPA 3OPUA 1WWBX 4QRSB 1QHPA 3VNYA 2NUPB 5A6MA 1BAGA 3MLWH 5BQDA 3HHSB 4PCTA 3NZ8A 5F93C 3L5HA 5CAYB 1I8LA 3NIDE 2KZBA 3VM5A 1LO5B 5I19H 3S4SA 1BQHG 2AC0A 1B6DA 1J8SA 2C3XA 5HGBB 4AYEC 1XF1A 3WL9B 3SGKA 4KV5F 5EO1A 2JI2A 2VLJD 2XTJD 1VPOH 4MAZA 1NIDA 2VJ8A 2C4FU 3O6FB 2AQPA 3T08A 1ZHNA 4Y9CA 5CLWA 4G8FA 4F15C 3EAKA 4JGJA 3Q5OA 4J2QA 4QWWD 5HYJD 1JNHA 1PG7H 5ENWB 2XVKA 5K5YA 3N41B 3FCSA 2EXYD 1X7QB 1A4BA 3PWUB 1QACA 2F19H 2NY2B 3B37A 4XMPH 5E2VH 1OGPA 5KANG 4NKDB 3TWCH 2CHZA 1TSRA 1B88A 2B1OA 1UG9A 3LSOB 4R2GC 3V0AC 4U1IA 4KY1H 3ZKXC 2EE6A 5I1EL 3LOWA 2Q1EA 1DVXA 2Z7UA 3ISYA 3NCJH 2R83A 5BJTB 1KXVC 4JZJC 2CDEB 1HHHB 3ARED 4RRPG 3DBXB 5AZ2L 3VU2A 3G5XB 4IMLA 2V7NA 3BEVA 2FZ3A 5J1SC 5IVXF 4BKLB 1E4XL 2HKAA 1BX2B 1HHKB 3V4PA 1TQCB 3SE3A 2XKNB 3DMMC 2UVFA 2WYZA 2HB0A 3WMQA 1YNKH 2Z8SA 4M1GL 5FB8B 1P1VA 1S7WA 1Z9PA 3EYVB 1JGUH 2JJWA 4PJEE 2P24B 2FL5B 3NH7H 1LD9A 2DY2A 1FDLH 5D1QB 1U4FA 2UV3A 1J1OH 1E4XI 3JTTB 5TQ0L 3T3MF 4HUMB 2K8MA 2J8UA 2V9RA 4E5XB 5LCVH 4G7YH 3EDKA 4DPCX 2HTLD 3MJ9A 4K7PL 1H3GA 4WHCA 3VXMA 2EIZB 1QUNB 4DN3H 1H3UA 3MLRH 3KLHC 1CGTA 1HEZA 1RZKL 1J5IA 3WTYA 3RIKA 4LLMA 2XG4B 4KKCC 1JZEA 1P2CA 1JD9A 3DV4A 2O26U 3D4YA 2C9VA 4DFIA 1CFVL 5I8CA 4Q8BA 4KXBA 3K2MC 2PWFA 4PRPE 4C56B 1QQDA 5EEUA 4N1EA 1X9RA 3KHQA 4OCRL 4IHOB 3S3DB 1MVUB 1KIUB 2GTQA 3ZGIA 5GRVK 3B2VH 2J1YA 3D9AH 5JDSA 3GSNH 1VZIA 5CINH 1KLUB 4LSTH 2VCOA 4NZRH 2AHIA 3MZGB 3WHXA 5L0QC 3Q48A 1JFQH 4XCCL 3LXUX 3ZKNC 4X4XB 1NMCC 4ZODA 4PJDF 3HG3A 4CMHB 1MIML 3B4NA 3FSOA 2DQCL 2E75C 1U30A 3KWWA 3SDCA 2GEQA 2QQLL 5B7FA 3BUDA 4FQ1H 5FDYA 1ZLWH 1GZHC 4J3SA 5HGHA 1LE9B 3IDNA 4X42A 2ZWZA 4H25A 5F88B 4YPJA 1LLAA 4TLKA 1MJUH 4UTAH 3S5ZA 4JRXE 3ARBD 3KL0A 3S2CA 1G7QA 1PX4A 1OM9A 4UWQB 2F5BH 4P3WA 2G2PA 5I8KH 4QAMB 3HCVB 3HBPA 4OIIH 3VD5A 5EU4A 2L7UA 3BPLC 4KVCH 3CLFH 3U36B 1MCFA 4JR9H 4FADA 4YDNA 4H20H 3IMSA 5CZXC 4XR8C 1EBAA 1EEYB 3LVTA 2PPEA 4XO5A 1KLGB 2BH0A 2E46A 1ZT1A 1SM3H 2IO5A 1IM9B 5DDHB 3F65A 4F2EA 4PGJA 4GRLB 3T8XB 1XR8B 7CGTA 4Y4KA 1QRNA 2WMPA 5DVNA 4YHZH 2XG4A 4KTEL 5T3XH 2OCJA 4GP5B 3QHZL 5JHBA 4FE9A 2J4WL 3MV8D 3LKQB 1RZKC 4NO3B 5LQBL 2GJ6A 1QQDB 1OGAA 5CN3A 4BINA 3HZ3A 3NA9L 4FULA 2B8OT 1KIUA 2R2CA 4NN6B 4OKVB 2X7LB 5D71H 5DVKA 3TVMB 1N8OE 1FL5B 4FQQA 4XBEH 4DZ8B 3VRJA 2IWFA 3ZW3A 4EIGB 1E2VA 1OAQH 2NY4B 4XBGB 1OF2A 2A0LC 43C9B 5ABDE 2B7DT 3TP4A 4KJQC 1KF9B 1GC1L 3GSRB 4RWYH 4ACTA 1ZLDA 2D4DA 5KZCB 2DZEA 5HHVH 2XQYA 4YAQA 5LG1A 5DR5H 1QATA 3DROA 2OXGA 1JIBA 4AGMA 2AITA 5HGHB 5EA0L 4R8WL 3QDMD 3OKNB 5D1XA 2YD7A 4IDJH 4LVOC 5TDPB 1E50A 4ODSL 2WVUA 4MNHA 3DXAD 5D2LB 4LSVL 5I74B 2Q76A 3MGTA 3UROR 2WW8A 4M93C 1DN0A 1G43A 4EKJA 4GFXA 1WH0A 1BA9A 2MNWA 4AQ8C 4KPHL 3UPAA 1RD6A 3H42H 3VWJD 5AAMA 3W11D 1UOVA 4D94A 1BQLL 1LK2A 5I6PA 4F7TA 1NUGA 4TUJA 3VYOA 3PL6A 4LGSB 1AO7E 4PRIB 5TF1H 4XBMA 3TTSA 4K94C 3F3HA 2KHAA 1IQDB 3WE1A 3OLEA 5I28A 2AK4D 3TYFB 4OLVH 4FA7B 4JN2B 4JY4B 4WW1A 1S6NA 3ASWA 5DS1A 3H9SB 3T04D 4EI6A 4YSOA 1T4KA 3ZRFC 5BO1L 4MWFA 3S36X 1EFXA 2LQRA 3TN0B 3WSQH 4WUUB 1BAFL 2WLHA 4C4KO 1NGPH 1U3HC 2X2UA 3JV5A 1BF2A 4ZUTB 5BRZD 1DN2A 5TK2A 4BRJA 2VB5A 1OLLA 4NM8L 5IMKB 2F7IA 1L9SA 2IAMB 3OKDA 2AXGA 3KPSB 5CGMA 3RY5A 3H3KA 3QXAB 2GPZA 4W70A 5AVSB 1Q9LA 1W0YT 2QLVB 3OVUB 4UU9A 4XVJH 5EIVA 5E6SB 2XWCA 1QLRA 3CDCA 1MRFH 2QPUA 5IOPA 2WUCL 3O4OB 5C2BL 3WS6C 1FF5A 2HT3C 4MVBC 3U4EA 3VB8A 3QHFL 1X5GA 3S4SB 2J1XA 4L1HA 1JG9A 4DPRA 3MLVH 2QMKA 3EYUL 1IAII 2A99A 5ICZB 2HKFL 3L4CA 2D7PA 3FB8B 5GRXG 5LHDA 1A6TA 2CUIA 3K8MA 1B3IA 2E86A 3EF4A 4YDKL 2IALA 3HRZA 4K7PY 2VW6A 3MBWA 5F7LB 2YJQA 1A4AA 3OKMA 3TC9A 5FYJH 5KVDL 4DZBB 2OV0A 4X99A 1TFPA 2Q7YB 4BBWA 3P3TA 2XG5B 4JDZA 4ZXBB 5JIKA 5ITFA 1ZHKB 4P07A 5C08A 4WFFE 1NUNB 5I8OH 1I7ZA 3FCSB 1NANH 2D3LA 2WLMA 1HINH 4Q2ZA 3T3ME 1CF1A 5GS1A 1H9VA 2XIDA 1TTGA 1MCCA 1S78D 3G04A 4PRHD 4KZEL 3FTUA 1RAMA 3P4OB 1NAKL 1OEZW 1NAMH 1OP4A 3EYFA 3B2PA 1B0RB 5DSCB 4U05A 3COOA 1MREH 1YEJL 3ETSA 1AE6H 1N0LA 3JWNH 2RBLA 4X6DE 2BWQA 4DAGH 4KRNA 2HG5B 1F1AA 1PLGH 4S10A 1YYCA 5L88H 2H26A 2WBJC 1BVNT 5SWSA 2Z65C 3RP1A 3TYFA 5IQMA 1ITCA 2OI9C 4LSDA 4O58L 4OFVA 4QRRB 5B3JE 2ALAA 3GXNA 1QBAA 4R9HA 3P3UA 3Q01A 2NQCA 3DUUB 3BAXA 4FTVE 4FG0A 1NUFA 4XP1L 3IAPA 3MV7D 1AIFB 4TULL 5E5LA 3D50A 4UILL 4X5PA 3ZIYA 3HZMA 1K8DA 4XNZC 1NCUA 3RWEB 3TBVA 5ACMA 4GKNA 2BOLA 3TZVD 2WTOA 3WFBL 2AXFA 2DEYX 3BUBA 1F02I 3GMRA 3QZWB 1KV3A 3O41B 2K9UA 5D7JC 4X7EC 4Z7UA 5HDBF 2CLZA 2IQAB 3J8F7 4HFWB 3WIIH 4BHUI 4LRNH 1MI5B 3QYNA 3Q44A 3BW9A 3H9SE 4NNYA 5DJCA 1JGDA 5CMAA 4HHGA 2FB4H 3QIBD 3LN4A 4FYRA 2IAAC 1UWXH 5DT1H 4NENB 3ZKMD 3MOBH 4IHOA 2D7MA 4M6MH 3ZDXB 3UTSA 1NINA 3ULSB 1G87A 4JKNA 1VFAA 2EKSA 3ELQA 4NZFA 2F19L 3D6GA 1ZHKA 3TLRA 2J25A 3L3OC 5G4MA 5CWSA 3LQMA 4AITA 1XGZA 4N2NA 4YL4A 4ODTH 3PHOA 4XXWC 3VGDA 5KZCD 5I6KA 3GSVA 3WEOA 3TIEB 3EUDA 1SFDA 3M45A 1LXMA 3T6XA 3FB7B 2G75B 4X8JA 4X9YA 2XV2A 4YZFF 4PSPA 1AOHA 2L7QA 1JVKA 4QF1B 1CIUA 3MNDA 5KYXB 4L2LA 2G9KA 3Q6FA 5LG6A 3SPJA 1OTUC 1TUPA 2DQIH 1ITBB 3TVMD 5BRZE 1IL1A 2X4UB 1LEKB 2MCG1 3H8NA 3JTBA 4HUUB 3GPSA 2GBUA 3FPYA 3Q43A 4KKBD 4AQEA 1CZ8H 4CA4A 1FDLL 1OHZA 2VUOA 5BUAA 3DUUA 1BIIA 2GAZA 3P0VL 5C0BE 4JDEB 3EDJA 3K72A 1JN6A 4OM0H 4MS8C 2B9AA 3E9TA 1C08B 4KK5D 5IGXH 1AFVH 3OB8A 1F1GA 1P7QB 3PXHA 4GMTH 2EH7H 1K8DB 4DN3L 4Q9CA 1NICA 4FZ8L 1IM9D 2B1HL 3MV01 4NAQA 5C3IA 4OD1L 3N1GC 1KCUL 7FABL 3MXVH 4Y19B 4PUBL 5H2BA 3V7AG 4RMVA 3VH8A 2WXNA 2QQNH 3H3PH 3JWNE 3MV9A 4TLUA 4RLDA 2FATL 2WLZA 3ZYZA 3EDDA 4L8SB 3DJ9A 4LHUA 1ASPA 5L4FA 8FABA 4OCRH 1JOIA 5EPMB 1JZ7A 2WWOA 3KLKA 1INEL 2ZF9A 4NQCD 1CD8A 2HLAA 5GS0C 4Y5XC 5KYYA 3N0PB 5CINL 1DQJA 2Z35B 4I18C 1A47A 3U7WL 3QDAA 1XL6A 4BUQA 4M8VA 1O7DC 2ZE0A 2BERA 1F58H 4QXUL 4A7SA 4AMWA 1ND0A 4G7SB 1I9JH 4NM4H 1DLFH 2F1AA 3ZLQC 5BQ7B 1GYUA 3D25B 5D8JH 5I24A 1VSCA 1PKQA 2KZWA 2QQLH 3U0TA 2X4NB 4PREB 1HDMA 2CO2A 2R9HD 3AM8C 4WO0A 3AB0C 1P7KB 1Q0XH 5DMKA 3RX5A 3SHSA 3T0AA 4DEPC 5CZKA 2DIAA 4HEPG 2WTPA 5BZZA 3RWDB 2KKQA 5FW7A 3SCMC 2YSTA 4FTVD 1DQMH 4JJ5B 1SUJA 5TDPA 4HJGA 1BX2A 2FX7H 1P5UA 2XKNA 1KFAH 4ETYA 1BZ7B 5JPMB 2CQVA 2F5BL 5AW0B 4IIQB 2OK0L 2QEJA 3PJLA 2VQTA 2VDOH 1X3DA 1CLVA 3WS3A 4Z8FL 1TKWB 1SY6H 2QVMA 1F3JA 4C4UA 2ZAIA 2XWTB 3M88A 5J9PA 1FZKB 4I0PB 1RIHH 5CSGA 4A63A 2V8LA 1OAYL 2R69H 1SM3L 5D1XC 4FFZL 5DZOA 2CKNA 2HH0L 3EJTA 2QKSA 3N9GH 4PRIA 2E7HA 3RPKA 4Z3EA 1CK0L 1UXMA 3CXHK 1E6OL 3GJFA 1LWJA 1XXDC 3ESMA 5MP6H 4NQCB 3U6XS 4HULB 1EZVY 1URZA 1NBVL 1MAKA 1H15B 1FNGA 5A3ID 2G3MA 4OFYA 1HJBC 4XP9H 4IRSA 3EJRA 2CRYA 3O0RL 5B8CC 4LNRB 3Q2WA 3IM1A 3Q3GB 4BIKA 5EF2A 1QHOA 5EEVA 4DGYL 3E80A 5JUEL 3U9UB 1DVUA 1OPGL 1KJ3H 4OFPA 3PPEA 4RWYL 2XBZA 5HHQB 3ARYA 3ZZLA 1CD1B 1IQWL 2HLFC 1TJHH 2H1PL 2DM7A 2EEFA 1FFRA 5BW7A 3HLAB 4Y4KC 4NB7A 3VXOB 5EA0H 3GM8A 2FWUA 2WCGA 5D5MF 2UXVA 3FC8A 4F91B 5IJCC 2NY0B 2YWZA 1OGAD 3ILPB 4M3JA 1JERA 2K6ZA 3DRQA 5FDWB 4P2OB 2Z4QA 5TE7H 1U41A 5FF6B 2DN7A 1YRKA 5JZ7D 3I9GH 4OCXH 5CCKH 4NBXB 5DJ6A 2A6KA 4G9DB 5C1MB 4JW3A 1MCWW 3O6FD 4JPIB 3S3SA 4L05A 4AKPA 3STLB 1T2QL 3OJVC 5HYSA 4I3SH 2VLJB 3K1DA 3SGJC 1HL5A 5IK3B 2F7OA 5E95B 4Z0BL 2W0PA 3HCVA 4TVPL 1E8ZA 2UY6B 3LMJH 3DUSB 3S96A 4EZMA 1Z9MA 4I3GA 4BFNA 1JF6A 2PWEA 4W6XB 4BDVB 3BRDA 3QI9B 3GIZH 4BSVA 2F8VA 4EUPG 2OI9B 4P59H 4DP8X 4N8CL 2H8PB 2VIRA 2CBOA 4OCYH 2H0FA 5CJXC 2JCCA 1YEEH 5DDHA 2D9QB 4MJJA 2BOBA 2CGRH 2E8ZA 1A3RL 2W0FB 2Z31A 3ML8A 3TEYA 2RD0A 3N44F 4NM8H 3FZUD 4KMQA 5F7DA 2CNYA 4WY7H 3S0PA 1MI5D 1EBPA 4HCIA 5D6CA 2JJUA 4HWEH 3LKNA 2X0WA 1AIFA 4K8RD 3RDJA 3MACH 3VFMA 4JJHA 3D85D 4HPHA 4XMWA 1LO0L 3CZFA 3PWPB 2YAQA 3GHBH 4I0KA 2P8LA 2X87A 4QRUA 2X12A 4BK5A 1V3MA 5HHNA 4H2CA 3O11B 3KYNA 1CGSH 3BEWA 5F1SA 3W9EA 4JPVL 5FO2A 5A2KH 3IJSA 3NUKA 4NAJA 5FIEA 1GZQA 2D7QA 4NKOA 4A66A 2O6FA 4K55A 1Q9KA 4NJAL 1BBJA 1VKXA 2W1NA 1IGYB 4H0LC 5J5EA 2DTML 1A3ZA 2VJXA 4BH7B 4MXVF 1LNUB 2RALA 4DVBA 4GQPH 4TMPA 4XN2A 1CXFA 3MNVB 4JFZL 1GYAA 5SWQA 1VFAB 1HINL 4M6NH 2CG9X 4GQ9H 1CFBA 4MJIE 5HHOE 3EZ8A 1VKXB 1QZNA 1CTNA 2QPEB 3EH4B 4W9CC 1TZIB 4AIEA 1NAKH 4BZ2A 1HQ4B 2BCKA 4RRPA 1JTTA 4OZGE 4ES8A 4MDIA 1R1CA 3GRWL 4QRQA 3D34A 3L9YA 4WFGD 4MA8L 4J3TA 1OL0A 3IJYB 4GS7B 3E7JA 5KG9A 4ODUB 5I6OA 1G6RH 3WN5B 3DXAA 1F4YH 2W65A 2BNRB 2FLBT 3WKNA 5I1AA 4PJ7F 3OBAA 4QF1A 3IWVA 1NCWH 3JSSA 5KJRH 1QR1A 2YAHA 4PIBA 3NEXA 1A3QA 3D3VE 1KBKA 3BAKA 4EMZA 1MQ8A 2K1MA 2B4CL 3FBQA 4LU5H 3HR5B 3BN9D 3QNYB 4PLKC 5DVOA 4QHKI 3ZK0A 1H3PH 1CXKA 4KO9A 1DHKA 4HZLA 4OLYH 4UILH 1JCKA 4JKPL 4YDLB 2YD0A 4NZJA 5I1JH 4OBRA 2Y0SA 4JB9H 2F68X 2NLJB 4L4VA 5E8PB 3WFBH 3WXVH 4N0UB 2R9HC 4XTRC 1I1YA 4DGVH 5DRXA 5IJVA 4WHTA 3TO4C 4DJMA 2RFXB 4X6CA 4Z7QF 4GINA 2DD8L 1UWGH 3GZKA 2WN3A 3MRHB 4R96A 1A9BB 2YQBA 1DYZA 1YEFL 4JQXC 2XPGA 5KVEH 4JHAH 2FYVA 3QB7C 4M5ZL 2IAMC 1S3KH 3WIAA 2IAMD 4HV8A 3KZ8A 3S48A 1B4JH 4JFOB 4Y9EA 5T5FL 1U8IB 4I18B 5HHMB 3L1FA 1WGOA 5DT1L 3TL5A 3S5LG 2CK2A 4XH2A 1SN0A 4E9VA 3QQDA 3U4BH 3QUGA 3QORD 1SPDA 1ML0A 1JV2B 1T83C 1DCLA 2FHBA 3RGHA 2BOCA 2J72A 4TUOA 2XG5A 4OH2A 1IILE 2ZKHH 1XAKA 3MR9B 1BVKB 3O2WH 2BZ7A 5JIPA 1L9QA 3GBEA 1INQB 4ENED 3NFSH 4G43A 4UUJB 5IQ7L 1NGYB 1G9NH 2HVBA 4EBQH 4UZUA 2EDNA 4JFUA 2HX7A 1AD9A 1LP9A 2VZVA 4LO9A 3C6LC 3UYOD 4YLCA 1PYWA 3GS7A 3NIGE 5HHXH 1QUNA 5IBUB 3DXAB 3AWFA 3QFJA 4M1CD 1A3LL 4PD4K 4IBWA 1FGVL 2H2SD 2ETWA 2DWTA 3SE3C 1E9OB 3IDMA 1CZ8L 5EF1A 4NNXB 2YUZA 2ZUUA 4H1LA 1LM8V 2XTJE 1F1DA 1MCKA 3BKJL 4WKZB 1LQBC 2DWSA 5KVFH 3D09A 4PGBB 5I76B 1NC4B 3FH5A 3H6JA 3N40P 4FMFA 3BSGA 4TQIA 4YBQC 3P9MB 5J1AA 4GMSH 1VZGA 1T6BX 3LNEA 3VSQA 3JYCA 5E5RB 2CA3A 1HVXA 3FRUB 4U4BA 3EFFA 4PG2A 3HR6A 1J86A 1EHKB 1OAZL 2HRPH 4G5ZH 3HMXH 4ZMLA 2F54E 2EO7A 4I9WE 3OF6A 4HV8B 2DQEL 4LF3A 5SV3A 3NN8B 2V5YA 4P05A 3VQ1C 3U7AA 4JFED 3G6JE 3DX7B 1KYDA 1INEH 3L5WB 3BLBA 1JZGA 1NIAA 4HG4J 3NJKA 3EOTH 3KWUA 2EUVA 2YEQA 3NJIA 2ILLA 3T4YA 5L2KA 3GWJA 5KS9A 1NKGA 3PWPE 5F1KC 2O30A 5CSZB 1EO7A 3BWSA 1AQKL 2X88A 3Q3GA 1IAIH 1RCYA 3QPXL 4QMEA 4X80H 4M9OA 5JYLA 1G7QB 5D2NE 5FGBA 4QOKA 2JI3A 1PY4A 3MFGB 3D18A 3HI6L 3NTCH 4FG6D 2R29A 4NN6C 1HFUA 2P5WB 3PWNA 4NLHA 3QDHA 5EOQH 4C58B 1SY6A 4S1RL 2C1OB 4UBDC 5T3ZE 4NO5B 4MA7L 3GSNB 3M8OH 3AMLA 4NRXB 2YC1A 4PJAE 2CDEA 5DGQA 1J1XL 4P2RB 5CGYC 5PAZA 1BFOB 2FQDA 3EYQC 3MLUL 4L48A 4PJCF 4MJIB 4WUUE 5IBLC 2VDOL 2WINB 4P2RD 3L95A 4Z8FH 2PWDA 1UUSA 1EFXD 1M05A 2ZWKA 3HUJA 5D7EA 1O7SA 2SEBA 1HXYA 1QASA 2PLTA 4FQLL 4ZUUA 3VGAB 3S2AA 2YPLA 4QEGA 4AXWA 5I1IL 1FV1A 2VZUA 2R0KH 3WKQA 3CIAA 3U7YL 4XO3A 3GI8L 3D07A 5I1HL 4C47A 2VDOB 2G2RB 3N9GL 4M7ZC 1CDJA 1YNTA 3QUYC 4P46A 3V6OC 4LARL 4I85A 1QBBA 2EJ1A 1AGEB 2ZXBA 1UH2A 2EIZA 1QAWA 5J56B 3B43A 4OTXL 5F7FA 2MSPA 5FK9A 4HIXH 3IXTA 4QPEA 4YAQB 2XV6B 1R3KB 3UC2A 1G7JB 2CA4A 3L81A 5DURB 4XP9L 2WKLA 4PV8A 4BGLA 2W92A 5C0AE 3SN6N 3F00A 4AYMC 2FE0A 4DKEH 1RVFH 1CICC 2WP3T 5F6IB 3SDYH 1YJDC 3ZOAA 2GUOB 1IM3A 1HHJB 1NGWB 5JUEH 2Z35A 4B9CA 3L1GA 3CDFA 4ZO9A 1CDIA 3FQTA 5AB1A 2JE8A 5B8CA 4F93B 1WF5A 4ANXA 4DP4X 3UYPA 5IW6A 2OMTB 4K5PA 3JVGA 4I48A 1LDPH 5F71A 2CSPA 5ICYA 3L3DA 3MV7A 3MFFB 2E27L 1PKQB 2XC8A 3CSPA 4ZS7L 5FXCH 5TPWL 1SJHA 1ZANH 4MSWB 3V0DA 3WLWC 3RTQD 1AACA 4PB9L 1SUHA 3S9DB 3O4OC 4UCFA 3UAFA 4FEIA 1X6LA 3CBKB 3HZVA 1NCNA 5LWYH 1ZGLM 3EJCA 4E0RB 3EGSB 4M1DL 3CVIH 3O2VL 5GISL 4ZFZB 4Y5VC 4LPVA 3QZMA 1T2QH 4K5LA 1LVEA 1NDGA 5CLXA 5T1DL 4NRYB 1SVZA 3ZE2B 5FYKL 3FF7A 1RZ7L 3WY2A 5AW4B 4KDVA 2OX5B 3K6SB 3GIZL 1KB5B 4NO2B 2WLNA 1I3GL 5KBLA 4P59L 4IQHA 1RPUA 1QNZH 3DJRA 2CBQA 4OCYL 2R7EB 2Y5TA 5A2IH 1YEEL 6FABL 1MFUA 4Y1AA 1VGEL 3UERA 1RUKL 1A3RH 3OHMB 4WIQA 4WENB 5KVGL 2VN6A 2O6CA 3F85A 3FZUC 2CLVB 5E4IA 2I9LB 3UO8B 1KV7A 1D5IL 4GRLA 4WY7L 3TA3D 3ELAT 1WIUA 5L2KE 5DEFB 1A22B 1PS3A 1A65A 3CFJB 1HXKA 1NCDH 1Z5LA 5BZDA 1TQWA 5A43C 1B0IA 3QDME 3ECQA 4P3DA 5TE6L 5FHBL 5IHLB 4K5NA 3DJZA 4J3OH 3T6WA 2AZUA 3S8WA 1I7ZB 2BCMA 2YD1A 2OMUA 4XOEA 5H37H 1EHLH 1J8HE 4P4KA 2VW7A 3AAZB 1WE5A 1NCOA 4N2LA 4CRPA 2GSIB 1JFHA 1RIVL 2BSEA 2ADJB 3CFUA 5DSCA 2DTMH 3IRZA 4JGUA 4OZ4A 2PW1A 4N0RA 3QQDB 4WGVB 3ZE1B 3ETBF 2VDKL 2AKRB 4L2YA 4QGTA 3KNBB 5FGCB 4JRFA 2UUDK 4GQ9L 4XPAL 1DBBH 1U3ZA 3P0YL 1HL4A 1MFCH 2Z4QB 1PZDA 1URIA 5LBGA 3V5HA 2BNUA 4RZKA 4DW2H 1NAMA 2I27N 5TK4A 2KLSA 3LS4L 3RUGB 3CSFA 4G43B 4UUJA 2HFGH 4MKTA 3P2BA 32C2B 2NUPA 2XU9A 3NMEA 2WAHA 4OQTA 1JMZA 4XPBH 4YHOL 5B39A 3IE9A 4FRWA 5GS0L 1BXAA 1RU9L 1LO2L 1N26A 4NXSA 4YSEA 1OK8A 2M2DA 4X5WA 4NPYA 3UPRA 1IT9H 4D9LL 3W5MA 1UCBH 1NC2D 2YAFA 1TEGA 2DBLL 4U7MA 4JRXB 3FFDB 5C0AA 2AQTA 5C86A 2XWZA 3FJTA 4HHWA 3O3DA 5F7YC 3BE1L 3H56A 4JM2A 4AQOA 4KK8C 5CBAA 3VU1A 1QVOA 2VMJA 4MWFB 3P69A 1K4CA 2C9UA 5I75B 4LGRB 4XP5H 3X3FH 5EC1A 5C9JB 1MWAL 4AT6B 4J3OC 3UTSB 1ZDSA 2YR3A 3QULB 2R2EB 1PDKB 3I84A 4MXWH 4JY5L 5EIIB 4K8RL 5ENWA 1MVYA 1T6VN 3L4YA 1ZMYA 4JHAL 4M5ZH 3OGOE 1F13A 4F33B 1T7XA 5C3TA 4D0BB 4TS6A 3PWPD 2DKUA 1T04A 3KDPB 1TJMA 5HHPB 3SDAD 3VO0A 3AU1B 3MNWB 4WQOA 1LL1A 4DEPB 1OP3K 1TJIH 1OTSC 3BH8A 4QXGH 5I8EB 3LIZL 3QXWA 2DQDL 4FS0A 2VDQL 4LQFH 1GGBL 2EO1A 4X9FA 3IJHB 2FO8A 3SKJH 3O2WL 4NIYE 3QA3A 4MDJA 3OV6A 3KLLA 2W9DH 4QOKB 4XOBA 3RFZA 4KBPA 2DDQL 4AQ1C 5FO8B 4QLWA 2FL5A 2WUBL 5AAPA 1BF8A 1YDPB 2CK0L 4AEHL 2JH2A 1JN6B 4HEPA 2WZPD 3WCYA 5INDB 5HHXL 2PO6A 4KH2A 4OJDH 1IEAB 4N0CD 4WJ5B 4ZW6A 5T1MA 5E6IB 1RUQH 3A3YB 4B9IA 1ZT7B 4UI2A 1NPJA 2D3VA 1YCSA 4FXKC 5GIRB 3FQYA 3ZDZB 4PJBE 1HYSC 4AW4A 5I1AB 4FZEL 3WNLA 3B7YA 1NM4A 5LGJB 3ECWA 4IRZA 2HUHA 4UMGA 1RK0A 2VKXA 5GS0H 4F5CE 2LLNA 4HXAL 2NY5C 2RAMA 4B9PA 2SEBB 4ZUUB 3QUYD 4OLZH 1OAKL 2DWDB 5KYYB 2BK8A 5H37A 4ODHH 3B3IA 1A7PH 4AEFA 5BO0D 3T8MA 3C5ZC 3Q1EA 4D7BA 1CU4H 2G60L 4GKLA 3V4PL 2YS4A 3CN0A 3FQNB 4AL8H 2G2RA 5I71B 3KE0A 1ZS8A 1KJMB 3QIUA 1OAZH 1K5WA 3AADB 1SBSL 4G5ZL 4YBLB 1FFQA 4GG6B 5F9AC 2MNJB 4AK1A 3NJFA 1OP3H 2QSQA 2R2BA 4O02L 1HAUA 2GVYA 3O4LE 3GBMH 3OSVA 2Z93A 5E9DB 4OV5A 3EOTL 3ZE2F 2EILB 2YGPA 4XTRD 2IGFH 2XWBA 4YLQT 1F4WL 1ZVSA 4LLUA 2WXHA 4QWWC 2A9ML 3QCVL 1CVRA 1DJIA 4R7VA 2X3BA 3S8FB 5IBTL 4B5ZA 4OF0A 3QO0B 4U3HA 3T3PB 5F7KC 1SXZA 1QHQA 4FG6C 3L9RA 4QIRA 3KPMA 1A7OH 1MHHB 4UDUA 1WWWX 4XXCA 4GSDH 5GZOD 3T0ED 4LCWE 1UEYA 4DGIH 4HZAA 4AH2B 4YSRA 3EBGA 3BVUA 2Q20A 4MJ2A 1ZVHA 3REWB 4JNXA 5CXPA 2OAAA 1DJXA 5BZXA 4TSAH 3IU3A 1WGVA 3BVVA 4HAKA 1SJEB 4G7VL 4J3WA 4X8JB 3WI9A 2NOYA 1C1EL 2EDHA 2RTTA 3GZQA 5HDQH 5HYSG 3W2DH 2JKIS 2EUWA 4HG4K 1UKTA 3DRTB 1NLDL 1T80A 2E7MA 3HEIB 5FKAB 2HFTA 3UX9B 5GSRA 3UTTD 1CL7L 3LQAH 2FX8H 5F9JA 1KJVB 1OTTD 3QDJA 3W82A 3M6DA 4KK6D 5AQ0A 5JIHA 5EZIH 4HIJA 3KYKL 2VL5B 4MQTB 3KLQA 5E4AA 3GM0A 3N43B 3GMNB 2G5BB 2B16A 3HAEH 1IAMA 4LARH 1RMFH 4L5FE 1HXMB 4HF5H 2MCPL 1WLHA 1FHGA 1V3JA 4TV3A 2FGZA 3KYOA 1MLCA 2ZKYA 3DX8B 4NJ9L 1AXSB 4TNGA 1OY3B 5KSBE 3GHEH 3VH8B 3WDHA 1H8OA 1SXBA 4XWOC 1N18A 2N7SA 1ETZB 5CBEA 4ZPTA 3VWKB 1RVFL 5LCVA 1YYML 5F9OL 2HVJA 1D6VL 2GABA 3LDBC 1N0XH 5KS9B 4N26A 3B5GA 2VRQA 5D4HA 5KOMC 1TQTA 4PJ9D 4EN2A 3ZRSA 4JPIA 5IT2H 3JWNC 4HBCH 2APFA 4ANKA 5HJ3A 4Y16A 1ND0B 3N1QC 5TPWH 4NNPH 4UOZA 2X10A 3D3VD 2NXZC 2HYMA 3R1GH 4KRPC 4NFDA 5J1TC 3DJSA 2OYLA 4NS0A 1JHLL 1KTBA 5FCUH 3T9WA 1BYOA 2O5XL 2IAND 3EDEA 3SYOA 4OGYL 2VXQA 4EOWH 3GSNA 3MOAH 1MLBB 2H9GA 3OR7B 4B7LA 5K9QI 5E24E 1JDCA 4JBSA 1AO7D 1AZZC 4L8SC 1QI4A 3T2QA 1KBVA 2WWMD 5EOCJ 3TO2A 2R0ZH 1CLZL 5J13C 2VW4A 2M83A 4KZDH 5K9OB 3J2PA 5FYKH 1D5RA 3TBCA 1P5UB 1J8HB 1VEMA 3KAAA 4LSUL 3U9WA 3W56A 5JHLL 2C26A 3NZHH 2QKIC 4HLEA 1U3YA 1FNEA 1Y07A 4G6MH 3WS3B 2ENSA 3MRMB 1VERA 3SBWC 4NQXB 1L7IL 5DJ8A 5FYLL 2R2HA 4MAYC 1QFUH 4F9LA 4ONFH 2NTSP 5KBNC 5GS3A 1XX9C 2QR0B 3U4EB 1UXWB 3HHRB 3MLYH 2YA1A 2WJ7A 3HZYA 1J9CT 1D2PA 1JZHA 3DHMA 2YD3A 4NP9A 5K33A 2FO4A 3SO5A 2JQMA 2BS71 3E2HB 2F7RA 3A6OA 4XB8A 3DVNB 1PGRB 1H15A 1N4XL 3UADA 4FL4C 3WU1A 4HUKB 4OZHF 3SGDH 1WTLA 4IS6A 4KVNL 3B7UX 2D7NA 1PNDA 1Q9OB 1S8DB 2ZIDA 3ZZSA 1DVSA 3SO3B 1O6TA 4DP7X 1IKFL 5IVXE 1B0GB 2XQ0A 3CVDA 3TZVB 4HVBA 2V5TA 3V55A 2X1QA 3INOA 4CDGC 5D7KD 3F8UB 3HG0A 2VNCA 1KJ2H 2BVTA 2TAAA 1ZLVK 1SHMA 1A6AA 2JCWA 4J1UB 5CM1A 5DJXB 3C08L 1DO6A 3IFPB 3I6LD 1JZFA 3L3DB 3MV7B 1DFBH 5DQDL 3NRFA 3HN8A 1QWNA