1SNZA

Crystal structure of apo human galactose mutarotase
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
344
structure length
344
Chain Sequence
GHMASVTRAVFGELPSGGGTVEKFQLQSDLLRVDIISWGCTITALEVKDRQGRASDVVLGFAELEGYLQKQPYFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTPRVLSNGVQFSRISPDGEEGYPGELKVWVTYTLDGGELIVNYRAQASQATPVNLTNHSYFNLAGQASPNINDHEVTIEADTYLPVDETLIPTGEVAPVQGTAFDLRKPVELGKHLQDFHLNGFDHNFCLKGSKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFPPVLLRPGEEYDHTTWFKFSVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords aldose 1-epimerase
publication title Molecular structure of human galactose mutarotase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 92
structure length 344
sequence length 344
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2004-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1snzA00
3T2PA 4RNLA 1F9GA 2JKPA 3MWXA 1JYXA 1RWAA 3E1F1 3T09A 3MV01 1NS8A 2ZQ0A 1X1HA 3IAPA 1LF6A 1K1YA 3VD7A 1Z45A 3I3EA 3T0BA 1RWGA 1RWFA 3I3DA 4DUXA 2WVYA 1JZ2A 5E1QA 3VD9A 2JKEA 1ULVA 1OJOA 2D73A 1L7KA 2XHNA 4BZHA 2E24A 1CB8A 3NJXA 4DUVA 1N7RA 1TXKA 2WW1A 3WFAA 2BRWA 1K1WA 1N7OA 4DUWA 2HTBA 3MV11 1F4AA 1UG9A 2BRPA 2WVZA 3MUY1 1MMYA 1NS0A 3OS7A 3BGAA 3VDBA 1PX3A 1F4HA 2CISA 1NSSA 1N7NA 3A24A 3VDAA 1JZ6A 1NS2A 4AQ0A 1EGUA 2CIRA 4BZEA 1JYNA 3VDCA 3VD3A 1F1SA 1HN0A 1SNZA 4BZFA 1MMXA 2X03A 1JYVA 3IAQA 3J7HA 2CIQA 1NSZA 2XSGA 2ZXQA 3DECA 1NS4A 1X1IA 3T2QA 1HMUA 1MN0A 1HM2A 1W3YA 2BRVX 1HN1A 3NREA 1NSUA 3K25A 3T08A 1JOVA 1JZ8A 1MMZA 3OB8A 1L7JA 1NSMA 3T0DA 1NS7A 1PX4A 1OJPA 2Q1FA 1JYWA 1NSXA 1JZ3A 3DYOA 1YQ2A 1X1JA 4BZGA 1NKGA 1OJMA 2JKAA 1J0MA 1RWCA 5A1AA 1C82A 1RW9A 1SO0A 3T0AA 1OJNA 1LOHA 2WCOA 2WVXA 3ECQA 1I8QA 2WW2A 1JZ7A 3DYPA 1LXKA 3OBAA 1DP0A 1K1XA 3SEPA 2WZSA 4TTGA 1HMWA 1MMUA 1JZ5A 3VD5A 3Q1NA 3NJVA 2HTAA 3IMHA 3MUZ1 1N7PA 3CZJA 1LURA 1JZ4A 3DCDA 1LXMA 3VD4A 2WW0A 1NSVA 3I3BA 1HM3A 1YGAA 1N7QA 3DYMA 1LF9A 1J0NA 1NSRA 2WDAA 2WW3A 2E22A 3T2OA 1RWHA 2WVXB
chains in the Genus database with same CATH superfamily
3BUIA 2F1AA 1RWAA 4OJZA 1QX1A 3E7JA 4FNUA 3MV01 3IAPA 3AMOA 1Z45A 3I3EA 3D51A 3T0BA 3S4DA 2WVYA 4BTYA 2D73A 1L7KA 2CG0A 1SPUA 2WW1A 2BRWA 3CZSA 1HXKA 1N7OA 3HIGA 3BUBA 2WOFA 3W7XA 1PX3A 3VDAA 2RDYA 3W7SA 3RSYA 3D4YA 1TU5A 4BZFA 2X03A 4BTXA 1UI7A 3QFYA 3VSNA 2XSGA 3BVTA 3W7UA 3BS6A 4EV2A 3CZNA 3EJQA 4KFEA 2OOVC 2CFWA 1HWWA 2C10A 2WYHA 1HN1A 1NSUA 3K5TA 3K25A 1JOVA 2CG1A 3BLBA 1NSMA 4KTRA 1N9EA 2Q1FA 1NSXA 1JZ3A 1TQSA 2JKAA 1RWCA 1SO0A 3T0AA 1QWNA 4BTWA 1I8QA 2WW2A 1JZ7A 1LXKA 2OQEA 1AVLA 3BLCA 3KN4A 2FYVA 2EABA 1JZ5A 3Q1NA 2CQTA 1IVWA 3CV5A 1LVNA 3IMHA 1PU4A 3W7TA 1WMOA 1LURA 1IVXA 1LF9A 2WDAA 2PNCA 1H54A 3AFLA 3T2PA 3TY1A 4RNLA 1F9GA 1JYXA 1DYUA 2WO0A 1US1A 1O7DD 3DX4A 3BVUA 1LF6A 3VD7A 2F1BA 3SX1A 1R34A 1RWFA 4DUXA 1JZ2A 1IQYA 1ULVA 4FNTA 4BZHA 4MMHA 1K1WA 1RJOA 3DX2A 4DUWA 1SIIA 2HTBA 3KIIA 3MV11 2F7OA 2WYIA 1NS0A 1PS3A 3D3IA 3BUQA 1N7NA 3BUPA 2CFGA 1OACA 1EGUA 2CIRA 2Y74A 1IQXA 4BZEA 3E80A 2W0QA 4KFDA 1QAKA 3X41A 2ZXQA 2CWUA 3DECA 1IVUA 1QALA 1TQVA 3SXXA 3X3YA 3X40A 2BRVX 2XN1A 3T0DA 3BVWA 2ALWA 3S4AA 3DYOA 3EJRA 1YQ2A 2EADA 2WOHA 4K3AA 5KBPA 1J0MA 4FNVA 1RW9A 1LOHA 3ECQA 4EV5A 3HIIA 4MMIA 1DP0A 3SEPA 1HMWA 3NJVA 4OK4A 3DX3A 3EJUA 2F18A 1JZ4A 3VD4A 3HI7A 4K35A 1J0NA 2E22A 5CA3A 2WVXB 2XN0A 1D6ZA 2OQEC 1R33A 2XN2A 2JKPA 3MWXA 1UI8A 1NS8A 2ZQ0A 3D4ZA 4KTPA 1K1YA 4FNPA 3X3XA 2JKEA 2F7QA 2XHNA 3ACSA 3NJXA 3ALAA 4DUVA 2C11A 1TXKA 3WFAA 3QG0A 3BVVA 1F4AA 1TQTA 3LVTA 1UG9A 2BRPA 2WVZA 2F7RA 1MMYA 2Y73A 3BGAA 3VDBA 2CISA 3A24A 3D50A 2E2VA 3QDEA 5GW7A 3AMOB 1JRQA 2D1WA 3RRSA 3DDGA 3X42A 1QWUA 3VDCA 3D52A 3MI6A 3WVFA 1F1SA 1RKYA 1IU7A 2OW6A 3IAQA 3J7HA 3DX1A 3X3ZA 4FNSA 2CIQA 1NSZA 1W7CA 2WGQA 1V7VA 1X1IA 1HMUA 1MN0A 1W3YA 3T08A 1JZ8A 4J5TA 1L7JA 1W2ZA 3BUDA 3ACTA 1PX4A 1OJPA 1HTYA 1JYWA 2YFNA 5JMDA 2YFOA 3DX0A 1X1JA 1NKGA 3EJSA 1OJMA 5A1AA 1C82A 3AFJA 2CQSA 1OJNA 1EKMA 3DYPA 1IVVA 2E2TA 1K1XA 4TTGA 2CFKA 2WZSA 3WIQA 3W7WA 3VD5A 2EAEA 2HTAA 1W5ZA 1TQWA 1SIHA 1N7PA 3NBJA 3CZJA 2EACA 1KSIA 3DCDA 3WA2X 1NSVA 3BVXA 1YGAA 4UFCA 2BT3A 3T2OA 1RWHA 3MPHA 2OW7A 4FNQA 5JMFA 2CFDA 3E1F1 3T09A 2FUTA 1V7WA 1X1HA 2FUQA 1QAFA 3LOYA 1RWGA 3I3DA 1W6CA 5E1QA 3VD9A 1AVKA 1OJOA 1D6YA 1WMNA 1CB8A 2E24A 1N7RA 3WA3A 4OK2A 3EJTA 2CWTA 3MUY1 2OOVA 3OS7A 1F4HA 1NSSA 1JZ6A 1NS2A 4AQ0A 1JYNA 3VD3A 1HN0A 1SNZA 1MMXA 1W6GA 1JYVA 3S4CA 2CFLA 1V7XA 1NS4A 3T2QA 4KFFA 3T0UA 2E2UA 2CWVA 3A0OA 3NREA 1HM2A 1TQUA 2YX9A 3PGBA 1MMZA 3OB8A 1NS7A 4FNRA 3S4BA 3EJPA 4BZGA 3N9HA 4NEIA 1D6UA 1A2VA 2WCOA 2WVXA 3WIRA 3OBAA 2ZL8A 1MMUA 3NBBA 3DDFA 1WMPA 3MUZ1 1AV4A 1LXMA 3I3BA 2WW0A 1HM3A 1W4NA 1N7QA 3DYMA 1NSRA 2F7PA 3QFZA 2WW3A 3VSMA
chains in the Genus database with same CATH topology
3T2PA 3TY1A 5JMFA 4RNLA 1F9GA 2JKPA 3MWXA 1JYXA 1RWAA 3E1F1 4OJZA 3E7JA 3T09A 3MV01 2FUTA 1NS8A 2ZQ0A 1X1HA 3IAPA 1LF6A 1K1YA 2FUQA 3VD7A 1Z45A 3I3EA 3T0BA 1RWGA 1RWFA 3I3DA 4DUXA 2WVYA 1JZ2A 5E1QA 3VD9A 2JKEA 1ULVA 1OJOA 2D73A 1L7KA 2XHNA 4BZHA 2E24A 1CB8A 3NJXA 4MMHA 4DUVA 1N7RA 1TXKA 2WW1A 3WFAA 2BRWA 1K1WA 1N7OA 4DUWA 2HTBA 3MV11 1F4AA 4OK2A 1UG9A 2BRPA 2WVZA 3MUY1 1MMYA 1NS0A 3OS7A 3BGAA 3VDBA 1PX3A 1F4HA 2CISA 1NSSA 1N7NA 3A24A 3VDAA 1JZ6A 1NS2A 4AQ0A 1EGUA 2CIRA 4BZEA 1JYNA 3VDCA 3E80A 3VD3A 3WVFA 1F1SA 1HN0A 1SNZA 4BZFA 1MMXA 2X03A 1JYVA 3IAQA 3J7HA 2CIQA 3VSNA 1NSZA 2XSGA 2ZXQA 3DECA 3BS6A 1NS4A 1X1IA 3T2QA 3A0OA 1HMUA 1MN0A 1HM2A 1W3YA 2BRVX 1HN1A 3NREA 1NSUA 3K25A 3T08A 1JOVA 1JZ8A 1MMZA 4J5TA 3OB8A 1L7JA 1NSMA 3T0DA 1NS7A 1PX4A 1OJPA 2Q1FA 1JYWA 1NSXA 1JZ3A 3DYOA 5JMDA 1YQ2A 1X1JA 4BZGA 1NKGA 1OJMA 2JKAA 4NEIA 1J0MA 1RWCA 4FNVA 1C82A 1RW9A 1SO0A 5A1AA 3T0AA 1OJNA 1LOHA 2WCOA 2WVXA 3ECQA 1I8QA 2WW2A 4MMIA 3DYPA 1JZ7A 1LXKA 3OBAA 1DP0A 1K1XA 3BLCA 2WZSA 3SEPA 4TTGA 1HMWA 1MMUA 1JZ5A 3VD5A 3Q1NA 3NJVA 2HTAA 4OK4A 3IMHA 3MUZ1 1N7PA 3CZJA 1LURA 1JZ4A 3DCDA 1LXMA 3VD4A 2WW0A 1NSVA 3I3BA 1HM3A 1YGAA 1N7QA 3DYMA 1LF9A 1J0NA 1NSRA 2WDAA 2WW3A 2E22A 3T2OA 1RWHA 2WVXB 3AFLA 3VSMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T2P A;  4RNL A;  1F9G A;  2JKP A;  3MWX A;  1JYX A;  1RWA A;  3E1F 1;  3T09 A;  3MV0 1;  1NS8 A;  2ZQ0 A;  1X1H A;  3IAP A;  1LF6 A;  1K1Y A;  3VD7 A;  1Z45 A;  3I3E A;  3T0B A;  1RWG A;  1RWF A;  3I3D A;  4DUX A;  2WVY A;  1JZ2 A;  5E1Q A;  3VD9 A;  2JKE A;  1ULV A;  1OJO A;  2D73 A;  1L7K A;  2XHN A;  4BZH A;  2E24 A;  1CB8 A;  3NJX A;  4DUV A;  1N7R A;  1TXK A;  2WW1 A;  3WFA A;  2BRW A;  1K1W A;  1N7O A;  4DUW A;  2HTB A;  3MV1 1;  1F4A A;  1UG9 A;  2BRP A;  2WVZ A;  3MUY 1;  1MMY A;  1NS0 A;  3OS7 A;  3BGA A;  3VDB A;  1PX3 A;  1F4H A;  2CIS A;  1NSS A;  1N7N A;  3A24 A;  3VDA A;  1JZ6 A;  1NS2 A;  4AQ0 A;  1EGU A;  2CIR A;  4BZE A;  1JYN A;  3VDC A;  3VD3 A;  1F1S A;  1HN0 A;  1SNZ A;  4BZF A;  1MMX A;  2X03 A;  1JYV A;  3IAQ A;  3J7H A;  2CIQ A;  1NSZ A;  2XSG A;  2ZXQ A;  3DEC A;  1NS4 A;  1X1I A;  3T2Q A;  1HMU A;  1MN0 A;  1HM2 A;  1W3Y A;  2BRV X;  1HN1 A;  3NRE A;  1NSU A;  3K25 A;  3T08 A;  1JOV A;  1JZ8 A;  1MMZ A;  3OB8 A;  1L7J A;  1NSM A;  3T0D A;  1NS7 A;  1PX4 A;  1OJP A;  2Q1F A;  1JYW A;  1NSX A;  1JZ3 A;  3DYO A;  1YQ2 A;  1X1J A;  4BZG A;  1NKG A;  1OJM A;  2JKA A;  1J0M A;  1RWC A;  5A1A A;  1C82 A;  1RW9 A;  1SO0 A;  3T0A A;  1OJN A;  1LOH A;  2WCO A;  2WVX A;  3ECQ A;  1I8Q A;  2WW2 A;  1JZ7 A;  3DYP A;  1LXK A;  3OBA A;  1DP0 A;  1K1X A;  3SEP A;  2WZS A;  4TTG A;  1HMW A;  1MMU A;  1JZ5 A;  3VD5 A;  3Q1N A;  3NJV A;  2HTA A;  3IMH A;  3MUZ 1;  1N7P A;  3CZJ A;  1LUR A;  1JZ4 A;  3DCD A;  1LXM A;  3VD4 A;  2WW0 A;  1NSV A;  3I3B A;  1HM3 A;  1YGA A;  1N7Q A;  3DYM A;  1LF9 A;  1J0N A;  1NSR A;  2WDA A;  2WW3 A;  2E22 A;  3T2O A;  1RWH A;  2WVX B; 
#chains in the Genus database with same CATH topology
 3BUI A;  2F1A A;  1RWA A;  4OJZ A;  1QX1 A;  3E7J A;  4FNU A;  3MV0 1;  3IAP A;  3AMO A;  1Z45 A;  3I3E A;  3D51 A;  3T0B A;  3S4D A;  2WVY A;  4BTY A;  2D73 A;  1L7K A;  2CG0 A;  1SPU A;  2WW1 A;  2BRW A;  3CZS A;  1HXK A;  1N7O A;  3HIG A;  3BUB A;  2WOF A;  3W7X A;  1PX3 A;  3VDA A;  2RDY A;  3W7S A;  3RSY A;  3D4Y A;  1TU5 A;  4BZF A;  2X03 A;  4BTX A;  1UI7 A;  3QFY A;  3VSN A;  2XSG A;  3BVT A;  3W7U A;  3BS6 A;  4EV2 A;  3CZN A;  3EJQ A;  4KFE A;  2OOV C;  2CFW A;  1HWW A;  2C10 A;  2WYH A;  1HN1 A;  1NSU A;  3K5T A;  3K25 A;  1JOV A;  2CG1 A;  3BLB A;  1NSM A;  4KTR A;  1N9E A;  2Q1F A;  1NSX A;  1JZ3 A;  1TQS A;  2JKA A;  1RWC A;  1SO0 A;  3T0A A;  1QWN A;  4BTW A;  1I8Q A;  2WW2 A;  1JZ7 A;  1LXK A;  2OQE A;  1AVL A;  3BLC A;  3KN4 A;  2FYV A;  2EAB A;  1JZ5 A;  3Q1N A;  2CQT A;  1IVW A;  3CV5 A;  1LVN A;  3IMH A;  1PU4 A;  3W7T A;  1WMO A;  1LUR A;  1IVX A;  1LF9 A;  2WDA A;  2PNC A;  1H54 A;  3AFL A;  3T2P A;  3TY1 A;  4RNL A;  1F9G A;  1JYX A;  1DYU A;  2WO0 A;  1US1 A;  1O7D D;  3DX4 A;  3BVU A;  1LF6 A;  3VD7 A;  2F1B A;  3SX1 A;  1R34 A;  1RWF A;  4DUX A;  1JZ2 A;  1IQY A;  1ULV A;  4FNT A;  4BZH A;  4MMH A;  1K1W A;  1RJO A;  3DX2 A;  4DUW A;  1SII A;  2HTB A;  3KII A;  3MV1 1;  2F7O A;  2WYI A;  1NS0 A;  1PS3 A;  3D3I A;  3BUQ A;  1N7N A;  3BUP A;  2CFG A;  1OAC A;  1EGU A;  2CIR A;  2Y74 A;  1IQX A;  4BZE A;  3E80 A;  2W0Q A;  4KFD A;  1QAK A;  3X41 A;  2ZXQ A;  2CWU A;  3DEC A;  1IVU A;  1QAL A;  1TQV A;  3SXX A;  3X3Y A;  3X40 A;  2BRV X;  2XN1 A;  3T0D A;  3BVW A;  2ALW A;  3S4A A;  3DYO A;  3EJR A;  1YQ2 A;  2EAD A;  2WOH A;  4K3A A;  5KBP A;  1J0M A;  4FNV A;  1RW9 A;  1LOH A;  3ECQ A;  4EV5 A;  3HII A;  4MMI A;  1DP0 A;  3SEP A;  1HMW A;  3NJV A;  4OK4 A;  3DX3 A;  3EJU A;  2F18 A;  1JZ4 A;  3VD4 A;  3HI7 A;  4K35 A;  1J0N A;  2E22 A;  5CA3 A;  2WVX B;  2XN0 A;  1D6Z A;  2OQE C;  1R33 A;  2XN2 A;  2JKP A;  3MWX A;  1UI8 A;  1NS8 A;  2ZQ0 A;  3D4Z A;  4KTP A;  1K1Y A;  4FNP A;  3X3X A;  2JKE A;  2F7Q A;  2XHN A;  3ACS A;  3NJX A;  3ALA A;  4DUV A;  2C11 A;  1TXK A;  3WFA A;  3QG0 A;  3BVV A;  1F4A A;  1TQT A;  3LVT A;  1UG9 A;  2BRP A;  2WVZ A;  2F7R A;  1MMY A;  2Y73 A;  3BGA A;  3VDB A;  2CIS A;  3A24 A;  3D50 A;  2E2V A;  3QDE A;  5GW7 A;  3AMO B;  1JRQ A;  2D1W A;  3RRS A;  3DDG A;  3X42 A;  1QWU A;  3VDC A;  3D52 A;  3MI6 A;  3WVF A;  1F1S A;  1RKY A;  1IU7 A;  2OW6 A;  3IAQ A;  3J7H A;  3DX1 A;  3X3Z A;  4FNS A;  2CIQ A;  1NSZ A;  1W7C A;  2WGQ A;  1V7V A;  1X1I A;  1HMU A;  1MN0 A;  1W3Y A;  3T08 A;  1JZ8 A;  4J5T A;  1L7J A;  1W2Z A;  3BUD A;  3ACT A;  1PX4 A;  1OJP A;  1HTY A;  1JYW A;  2YFN A;  5JMD A;  2YFO A;  3DX0 A;  1X1J A;  1NKG A;  3EJS A;  1OJM A;  5A1A A;  1C82 A;  3AFJ A;  2CQS A;  1OJN A;  1EKM A;  3DYP A;  1IVV A;  2E2T A;  1K1X A;  4TTG A;  2CFK A;  2WZS A;  3WIQ A;  3W7W A;  3VD5 A;  2EAE A;  2HTA A;  1W5Z A;  1TQW A;  1SIH A;  1N7P A;  3NBJ A;  3CZJ A;  2EAC A;  1KSI A;  3DCD A;  3WA2 X;  1NSV A;  3BVX A;  1YGA A;  4UFC A;  2BT3 A;  3T2O A;  1RWH A;  3MPH A;  2OW7 A;  4FNQ A;  5JMF A;  2CFD A;  3E1F 1;  3T09 A;  2FUT A;  1V7W A;  1X1H A;  2FUQ A;  1QAF A;  3LOY A;  1RWG A;  3I3D A;  1W6C A;  5E1Q A;  3VD9 A;  1AVK A;  1OJO A;  1D6Y A;  1WMN A;  1CB8 A;  2E24 A;  1N7R A;  3WA3 A;  4OK2 A;  3EJT A;  2CWT A;  3MUY 1;  2OOV A;  3OS7 A;  1F4H A;  1NSS A;  1JZ6 A;  1NS2 A;  4AQ0 A;  1JYN A;  3VD3 A;  1HN0 A;  1SNZ A;  1MMX A;  1W6G A;  1JYV A;  3S4C A;  2CFL A;  1V7X A;  1NS4 A;  3T2Q A;  4KFF A;  3T0U A;  2E2U A;  2CWV A;  3A0O A;  3NRE A;  1HM2 A;  1TQU A;  2YX9 A;  3PGB A;  1MMZ A;  3OB8 A;  1NS7 A;  4FNR A;  3S4B A;  3EJP A;  4BZG A;  3N9H A;  4NEI A;  1D6U A;  1A2V A;  2WCO A;  2WVX A;  3WIR A;  3OBA A;  2ZL8 A;  1MMU A;  3NBB A;  3DDF A;  1WMP A;  3MUZ 1;  1AV4 A;  1LXM A;  3I3B A;  2WW0 A;  1HM3 A;  1W4N A;  1N7Q A;  3DYM A;  1NSR A;  2F7P A;  3QFZ A;  2WW3 A;  3VSM A; 
#chains in the Genus database with same CATH homology
 3T2P A;  3TY1 A;  5JMF A;  4RNL A;  1F9G A;  2JKP A;  3MWX A;  1JYX A;  1RWA A;  3E1F 1;  4OJZ A;  3E7J A;  3T09 A;  3MV0 1;  2FUT A;  1NS8 A;  2ZQ0 A;  1X1H A;  3IAP A;  1LF6 A;  1K1Y A;  2FUQ A;  3VD7 A;  1Z45 A;  3I3E A;  3T0B A;  1RWG A;  1RWF A;  3I3D A;  4DUX A;  2WVY A;  1JZ2 A;  5E1Q A;  3VD9 A;  2JKE A;  1ULV A;  1OJO A;  2D73 A;  1L7K A;  2XHN A;  4BZH A;  2E24 A;  1CB8 A;  3NJX A;  4MMH A;  4DUV A;  1N7R A;  1TXK A;  2WW1 A;  3WFA A;  2BRW A;  1K1W A;  1N7O A;  4DUW A;  2HTB A;  3MV1 1;  1F4A A;  4OK2 A;  1UG9 A;  2BRP A;  2WVZ A;  3MUY 1;  1MMY A;  1NS0 A;  3OS7 A;  3BGA A;  3VDB A;  1PX3 A;  1F4H A;  2CIS A;  1NSS A;  1N7N A;  3A24 A;  3VDA A;  1JZ6 A;  1NS2 A;  4AQ0 A;  1EGU A;  2CIR A;  4BZE A;  1JYN A;  3VDC A;  3E80 A;  3VD3 A;  3WVF A;  1F1S A;  1HN0 A;  1SNZ A;  4BZF A;  1MMX A;  2X03 A;  1JYV A;  3IAQ A;  3J7H A;  2CIQ A;  3VSN A;  1NSZ A;  2XSG A;  2ZXQ A;  3DEC A;  3BS6 A;  1NS4 A;  1X1I A;  3T2Q A;  3A0O A;  1HMU A;  1MN0 A;  1HM2 A;  1W3Y A;  2BRV X;  1HN1 A;  3NRE A;  1NSU A;  3K25 A;  3T08 A;  1JOV A;  1JZ8 A;  1MMZ A;  4J5T A;  3OB8 A;  1L7J A;  1NSM A;  3T0D A;  1NS7 A;  1PX4 A;  1OJP A;  2Q1F A;  1JYW A;  1NSX A;  1JZ3 A;  3DYO A;  5JMD A;  1YQ2 A;  1X1J A;  4BZG A;  1NKG A;  1OJM A;  2JKA A;  4NEI A;  1J0M A;  1RWC A;  4FNV A;  1C82 A;  1RW9 A;  1SO0 A;  5A1A A;  3T0A A;  1OJN A;  1LOH A;  2WCO A;  2WVX A;  3ECQ A;  1I8Q A;  2WW2 A;  4MMI A;  3DYP A;  1JZ7 A;  1LXK A;  3OBA A;  1DP0 A;  1K1X A;  3BLC A;  2WZS A;  3SEP A;  4TTG A;  1HMW A;  1MMU A;  1JZ5 A;  3VD5 A;  3Q1N A;  3NJV A;  2HTA A;  4OK4 A;  3IMH A;  3MUZ 1;  1N7P A;  3CZJ A;  1LUR A;  1JZ4 A;  3DCD A;  1LXM A;  3VD4 A;  2WW0 A;  1NSV A;  3I3B A;  1HM3 A;  1YGA A;  1N7Q A;  3DYM A;  1LF9 A;  1J0N A;  1NSR A;  2WDA A;  2WW3 A;  2E22 A;  3T2O A;  1RWH A;  2WVX B;  3AFL A;  3VSM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...