1SNZA

Crystal structure of apo human galactose mutarotase
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
344
structure length
344
Chain Sequence
b'GHMASVTRAVFGELPSGGGTVEKFQLQSDLLRVDIISWGCTITALEVKDRQGRASDVVLGFAELEGYLQKQPYFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTPRVLSNGVQFSRISPDGEEGYPGELKVWVTYTLDGGELIVNYRAQASQATPVNLTNHSYFNLAGQASPNINDHEVTIEADTYLPVDETLIPTGEVAPVQGTAFDLRKPVELGKHLQDFHLNGFDHNFCLKGSKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFPPVLLRPGEEYDHTTWFKFSVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords aldose 1-epimerase
publication title Molecular structure of human galactose mutarotase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 92
structure length 344
sequence length 344
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2004-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1snzA00
1NS0A 1PX3A 3E1F1 1F4AA 1OJNA 1X1IA 1OJPA 3T0BA 1JZ7A 1F1SA 4BZHA 1OJMA 1F9GA 2ZXQA 1L7JA 2ZQ0A 4DUWA 3MWXA 1SNZA 3MV01 3DECA 4BZFA 1NKGA 1N7RA 2X03A 2WVZA 4TTGA 1W3YA 3T2PA 1JZ5A 4RNLA 3OB8A 1HN1A 1NS7A 2JKEA 1SO0A 5A1AA 3A24A 1NSZA 1J0MA 2WDAA 1NS8A 2WW1A 1K1WA 1MMUA 1CB8A 1K1XA 1NS4A 1NSSA 2WZSA 3NJXA 2WW0A 1RWAA 1MMYA 1MMXA 2WW2A 1LOHA 3MV11 1NSXA 1YGAA 1HM3A 1YQ2A 3DYMA 1F4HA 3BGAA 1C82A 1PX4A 3NJVA 3DCDA 4AQ0A 2HTBA 1RW9A 1N7QA 1LXMA 2WVXA 3IMHA 2CIQA 1ULVA 3VD7A 2WVXB 1K1YA 2JKAA 3T2QA 3K25A 1X1JA 1LF9A 1JYNA 1JZ2A 1EGUA 1NSUA 2WCOA 3DYPA 3I3DA 1Z45A 2WW3A 3IAQA 3MUY1 3VDAA 2JKPA 2CISA 3DYOA 1JYVA 3OBAA 3OS7A 1N7NA 2BRVX 1JZ4A 1N7PA 3ECQA 1NSVA 1JZ6A 2BRWA 2HTAA 4DUXA 3WFAA 2Q1FA 1I8QA 1RWFA 2BRPA 1RWGA 3T09A 1RWCA 2XSGA 3I3EA 1LURA 1NSMA 1L7KA 3VDCA 3I3BA 1JYWA 3VD3A 3VD9A 1NSRA 1DP0A 3T2OA 3NREA 1JYXA 1MMZA 1HMUA 1HN0A 2CIRA 2E22A 1NS2A 3MUZ1 4BZEA 5E1QA 2WVYA 2D73A 1JZ3A 1JZ8A 3VD4A 3VD5A 3CZJA 3T0DA 1RWHA 3J7HA 2XHNA 2E24A 3IAPA 4DUVA 1LF6A 1LXKA 1HMWA 1N7OA 1HM2A 3T0AA 1TXKA 1UG9A 3Q1NA 1X1HA 4BZGA 3SEPA 1J0NA 3VDBA 1MN0A 1OJOA 1JOVA 3T08A
chains in the Genus database with same CATH superfamily
3DX1A 3E1F1 3S4AA 1F4AA 3WA2X 5GW7A 4KFFA 3LVTA 2ZXQA 2FYVA 3MWXA 1SNZA 3A0OA 2CG1A 1NKGA 2X03A 3VSMA 1JZ5A 3ACSA 3BLBA 2OQEA 3OB8A 1HN1A 2JKEA 1LVNA 1SO0A 3MI6A 1NS8A 1OACA 2WZSA 1NS4A 1K1XA 1NSSA 2CQTA 1RWAA 4K35A 2WW2A 1YQ2A 1PX4A 3NJVA 3SX1A 2E2TA 3D4YA 3DX3A 1N7QA 2WVXA 2Y74A 4KFDA 3KIIA 3VD7A 4J5TA 1X1JA 1LF9A 3QFZA 2CQSA 4FNQA 3BLCA 1QWUA 1Z45A 2EAEA 3VDAA 1JYVA 3OBAA 1IVVA 1NSVA 1JZ6A 2BRWA 2HTAA 1TQVA 3BUPA 1RWFA 3X3ZA 2BRPA 3W7UA 2XN0A 1NSMA 2E2VA 3VDCA 3I3BA 1DP0A 3T2OA 2F18A 1MMZA 2CFGA 1QWNA 3DDGA 3MUZ1 1NS2A 1WMPA 2F1AA 4KFEA 5E1QA 4FNPA 2FUTA 3E80A 3VD4A 3MPHA 1RWHA 3BUDA 3W7XA 1SIHA 1AV4A 2D1WA 1LF6A 3WIQA 4FNSA 1TU5A 1AVKA 3BUIA 1UG9A 1HWWA 3DDFA 2PNCA 2OOVC 2CFLA 4BZGA 4MMIA 3SEPA 2E2UA 1J0NA 1WMNA 3DCDA 1JOVA 3T08A 3EJSA 3RSYA 1F1SA 2CG0A 3DX4A 1L7JA 2ZQ0A 3MV01 2WVZA 1W3YA 2WGQA 4RNLA 1QAFA 3QG0A 2WYIA 2WDAA 1PS3A 3NBBA 1UI7A 3X3YA 1CB8A 2OW7A 2EACA 1MMYA 4FNUA 1LOHA 3MV11 1NSXA 3DYMA 1PU4A 1A2VA 1RW9A 3D4ZA 1IVWA 1QAKA 1RJOA 1ULVA 2JKAA 3BVVA 1W2ZA 2CFWA 1EGUA 1NSUA 2WCOA 2CWVA 3IAQA 3MUY1 4OJZA 2JKPA 2CISA 4UFCA 3ECQA 1TQTA 4DUXA 2YX9A 2Q1FA 2ZL8A 1I8QA 2F1BA 1R33A 4K3AA 3EJQA 2CFDA 3VD3A 1TQSA 1NSRA 2E22A 1W6CA 1DYUA 4BZEA 2D73A 3HIIA 1JZ3A 2YFNA 2WOFA 3J7HA 1H54A 1IQYA 1LXKA 1N7OA 1HM2A 1D6UA 1X1HA 3AMOA 3D52A 2F7QA 2CWUA 1W7CA 3D51A 3EJUA 3EJTA 4MMHA 1TQUA 4EV5A 4BZHA 3K5TA 3BS6A 1R34A 4DUWA 2WO0A 3DECA 4BZFA 2OOVA 4TTGA 4EV2A 1HXKA 2BT3A 3W7TA 2YFOA 1SPUA 1W4NA 1KSIA 3BUBA 3TY1A 3A24A 3HIGA 1J0MA 2F7PA 2WW1A 3ACTA 1K1WA 2C10A 3CZSA 1MMXA 3X42A 1HM3A 3BGAA 1C82A 2XN2A 4AQ0A 2HTBA 3VSNA 1AVLA 1IVUA 3IMHA 2CIQA 2W0QA 3X41A 1W6GA 1K1YA 3W7SA 3NBJA 2F7RA 3K25A 1JYNA 4OK4A 2XN1A 4BTXA 3QFYA 1W5ZA 3DYPA 3I3DA 2WW3A 3DYOA 3CV5A 1IQXA 3DX2A 1JZ4A 1N7PA 1D6ZA 1UI8A 4BTYA 3WFAA 1EKMA 1RWGA 1LURA 1JYWA 3X40A 3D50A 3BVTA 3NREA 1HMUA 1HN0A 2CIRA 4BTWA 2WVYA 1JZ8A 1SIIA 2WYHA 2OW6A 1QX1A 3LOYA 4KTRA 3Q1NA 3CZNA 2C11A 3KN4A 5KBPA 2ALWA 2OQEC 4OK2A 2CFKA 4FNRA 4NEIA 4FNVA 1NS0A 1PX3A 1X1IA 1OJNA 2RDYA 1OJPA 3T0BA 1JZ7A 3EJRA 3DX0A 1OJMA 1F9GA 1V7WA 1IVXA 1N7RA 3T2PA 1NS7A 2Y73A 3HI7A 5JMFA 2EADA 5A1AA 1NSZA 1MMUA 3NJXA 3WA3A 3D3IA 2WW0A 5CA3A 3W7WA 1YGAA 1O7DD 3S4CA 1F4HA 1V7XA 1D6YA 3BVWA 1LXMA 3E7JA 2WVXB 3T0UA 3WIRA 3T2QA 3S4DA 3BVUA 3S4BA 1JZ2A 2WOHA 1N9EA 1JRQA 4KTPA 3RRSA 3ALAA 2F7OA 3BVXA 3OS7A 1IU7A 4FNTA 1N7NA 3EJPA 2BRVX 5JMDA 3SXXA 3BUQA 1HTYA 3N9HA 3AMOB 3T09A 1RWCA 2XSGA 3I3EA 3WVFA 1L7KA 1US1A 3VD9A 3QDEA 1JYXA 1V7VA 3VD5A 3CZJA 3AFJA 3T0DA 3PGBA 2XHNA 2E24A 3IAPA 4DUVA 2CWTA 1HMWA 3T0AA 1TXKA 2EABA 1RKYA 1TQWA 1WMOA 3X3XA 3VDBA 1MN0A 1OJOA 1QALA 2FUQA 3AFLA
chains in the Genus database with same CATH topology
1NS0A 1PX3A 3E1F1 1F4AA 1OJNA 1X1IA 1OJPA 3T0BA 1JZ7A 4NEIA 1F1SA 4BZHA 1OJMA 1F9GA 2ZXQA 3BS6A 1L7JA 2ZQ0A 4DUWA 3MWXA 1SNZA 3MV01 3DECA 4BZFA 3A0OA 1NKGA 1N7RA 2X03A 2WVZA 3VSMA 4TTGA 1W3YA 3T2PA 1JZ5A 4RNLA 3OB8A 1HN1A 1NS7A 2JKEA 1SO0A 5JMFA 3TY1A 5A1AA 3A24A 1NSZA 1J0MA 2WDAA 3T08A 1NS8A 2WW1A 1K1WA 1MMUA 1CB8A 1K1XA 1NS4A 1NSSA 2WZSA 3NJXA 2WW0A 1RWAA 1MMYA 1MMXA 2WW2A 1LOHA 3MV11 1NSXA 1YGAA 1HM3A 1YQ2A 3DYMA 1F4HA 3BGAA 1C82A 1PX4A 3NJVA 3DCDA 4AQ0A 2HTBA 1RW9A 3VSNA 1N7QA 1LXMA 2WVXA 3E7JA 3IMHA 2CIQA 1ULVA 3VD7A 2WVXB 1K1YA 2JKAA 3T2QA 3K25A 4J5TA 1X1JA 1LF9A 1JYNA 4OK4A 1JZ2A 1EGUA 1NSUA 2WCOA 3DYPA 3BLCA 3I3DA 1Z45A 2WW3A 3IAQA 3MUY1 4OJZA 3VDAA 2JKPA 2CISA 3DYOA 1JYVA 3OBAA 3OS7A 1N7NA 2BRVX 1JZ4A 1N7PA 3ECQA 5JMDA 1NSVA 1JZ6A 2BRWA 2HTAA 4DUXA 3WFAA 2Q1FA 1I8QA 1RWFA 2BRPA 1RWGA 3T09A 1RWCA 2XSGA 3I3EA 1LURA 3WVFA 1NSMA 1L7KA 3VDCA 3I3BA 1JYWA 3VD3A 3VD9A 1NSRA 1DP0A 3T2OA 3NREA 1JYXA 1MMZA 1HMUA 1HN0A 2CIRA 2E22A 1NS2A 3MUZ1 4BZEA 5E1QA 2WVYA 2D73A 1JZ3A 2FUTA 3E80A 1JZ8A 3VD4A 3VD5A 3CZJA 3T0DA 1RWHA 3J7HA 2XHNA 2E24A 3IAPA 4DUVA 1LF6A 1LXKA 1HMWA 1N7OA 1HM2A 3T0AA 1TXKA 1UG9A 3Q1NA 1X1HA 4BZGA 4MMIA 3SEPA 1J0NA 3VDBA 1MN0A 1OJOA 4MMHA 4OK2A 1JOVA 2FUQA 4FNVA 3AFLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NS0 A;  1PX3 A;  3E1F 1;  1F4A A;  1OJN A;  1X1I A;  1OJP A;  3T0B A;  1JZ7 A;  1F1S A;  4BZH A;  1OJM A;  1F9G A;  2ZXQ A;  1L7J A;  2ZQ0 A;  4DUW A;  3MWX A;  1SNZ A;  3MV0 1;  3DEC A;  4BZF A;  1NKG A;  1N7R A;  2X03 A;  2WVZ A;  4TTG A;  1W3Y A;  3T2P A;  1JZ5 A;  4RNL A;  3OB8 A;  1HN1 A;  1NS7 A;  2JKE A;  1SO0 A;  5A1A A;  3A24 A;  1NSZ A;  1J0M A;  2WDA A;  1NS8 A;  2WW1 A;  1K1W A;  1MMU A;  1CB8 A;  1K1X A;  1NS4 A;  1NSS A;  2WZS A;  3NJX A;  2WW0 A;  1RWA A;  1MMY A;  1MMX A;  2WW2 A;  1LOH A;  3MV1 1;  1NSX A;  1YGA A;  1HM3 A;  1YQ2 A;  3DYM A;  1F4H A;  3BGA A;  1C82 A;  1PX4 A;  3NJV A;  3DCD A;  4AQ0 A;  2HTB A;  1RW9 A;  1N7Q A;  1LXM A;  2WVX A;  3IMH A;  2CIQ A;  1ULV A;  3VD7 A;  2WVX B;  1K1Y A;  2JKA A;  3T2Q A;  3K25 A;  1X1J A;  1LF9 A;  1JYN A;  1JZ2 A;  1EGU A;  1NSU A;  2WCO A;  3DYP A;  3I3D A;  1Z45 A;  2WW3 A;  3IAQ A;  3MUY 1;  3VDA A;  2JKP A;  2CIS A;  3DYO A;  1JYV A;  3OBA A;  3OS7 A;  1N7N A;  2BRV X;  1JZ4 A;  1N7P A;  3ECQ A;  1NSV A;  1JZ6 A;  2BRW A;  2HTA A;  4DUX A;  3WFA A;  2Q1F A;  1I8Q A;  1RWF A;  2BRP A;  1RWG A;  3T09 A;  1RWC A;  2XSG A;  3I3E A;  1LUR A;  1NSM A;  1L7K A;  3VDC A;  3I3B A;  1JYW A;  3VD3 A;  3VD9 A;  1NSR A;  1DP0 A;  3T2O A;  3NRE A;  1JYX A;  1MMZ A;  1HMU A;  1HN0 A;  2CIR A;  2E22 A;  1NS2 A;  3MUZ 1;  4BZE A;  5E1Q A;  2WVY A;  2D73 A;  1JZ3 A;  1JZ8 A;  3VD4 A;  3VD5 A;  3CZJ A;  3T0D A;  1RWH A;  3J7H A;  2XHN A;  2E24 A;  3IAP A;  4DUV A;  1LF6 A;  1LXK A;  1HMW A;  1N7O A;  1HM2 A;  3T0A A;  1TXK A;  1UG9 A;  3Q1N A;  1X1H A;  4BZG A;  3SEP A;  1J0N A;  3VDB A;  1MN0 A;  1OJO A;  1JOV A;  3T08 A; 
#chains in the Genus database with same CATH topology
 3DX1 A;  3E1F 1;  3S4A A;  1F4A A;  3WA2 X;  5GW7 A;  4KFF A;  3LVT A;  2ZXQ A;  2FYV A;  3MWX A;  1SNZ A;  3A0O A;  2CG1 A;  1NKG A;  2X03 A;  3VSM A;  1JZ5 A;  3ACS A;  3BLB A;  2OQE A;  3OB8 A;  1HN1 A;  2JKE A;  1LVN A;  1SO0 A;  3MI6 A;  1NS8 A;  1OAC A;  2WZS A;  1NS4 A;  1K1X A;  1NSS A;  2CQT A;  1RWA A;  4K35 A;  2WW2 A;  1YQ2 A;  1PX4 A;  3NJV A;  3SX1 A;  2E2T A;  3D4Y A;  3DX3 A;  1N7Q A;  2WVX A;  2Y74 A;  4KFD A;  3KII A;  3VD7 A;  4J5T A;  1X1J A;  1LF9 A;  3QFZ A;  2CQS A;  4FNQ A;  3BLC A;  1QWU A;  1Z45 A;  2EAE A;  3VDA A;  1JYV A;  3OBA A;  1IVV A;  1NSV A;  1JZ6 A;  2BRW A;  2HTA A;  1TQV A;  3BUP A;  1RWF A;  3X3Z A;  2BRP A;  3W7U A;  2XN0 A;  1NSM A;  2E2V A;  3VDC A;  3I3B A;  1DP0 A;  3T2O A;  2F18 A;  1MMZ A;  2CFG A;  1QWN A;  3DDG A;  3MUZ 1;  1NS2 A;  1WMP A;  2F1A A;  4KFE A;  5E1Q A;  4FNP A;  2FUT A;  3E80 A;  3VD4 A;  3MPH A;  1RWH A;  3BUD A;  3W7X A;  1SIH A;  1AV4 A;  2D1W A;  1LF6 A;  3WIQ A;  4FNS A;  1TU5 A;  1AVK A;  3BUI A;  1UG9 A;  1HWW A;  3DDF A;  2PNC A;  2OOV C;  2CFL A;  4BZG A;  4MMI A;  3SEP A;  2E2U A;  1J0N A;  1WMN A;  3DCD A;  1JOV A;  3T08 A;  3EJS A;  3RSY A;  1F1S A;  2CG0 A;  3DX4 A;  1L7J A;  2ZQ0 A;  3MV0 1;  2WVZ A;  1W3Y A;  2WGQ A;  4RNL A;  1QAF A;  3QG0 A;  2WYI A;  2WDA A;  1PS3 A;  3NBB A;  1UI7 A;  3X3Y A;  1CB8 A;  2OW7 A;  2EAC A;  1MMY A;  4FNU A;  1LOH A;  3MV1 1;  1NSX A;  3DYM A;  1PU4 A;  1A2V A;  1RW9 A;  3D4Z A;  1IVW A;  1QAK A;  1RJO A;  1ULV A;  2JKA A;  3BVV A;  1W2Z A;  2CFW A;  1EGU A;  1NSU A;  2WCO A;  2CWV A;  3IAQ A;  3MUY 1;  4OJZ A;  2JKP A;  2CIS A;  4UFC A;  3ECQ A;  1TQT A;  4DUX A;  2YX9 A;  2Q1F A;  2ZL8 A;  1I8Q A;  2F1B A;  1R33 A;  4K3A A;  3EJQ A;  2CFD A;  3VD3 A;  1TQS A;  1NSR A;  2E22 A;  1W6C A;  1DYU A;  4BZE A;  2D73 A;  3HII A;  1JZ3 A;  2YFN A;  2WOF A;  3J7H A;  1H54 A;  1IQY A;  1LXK A;  1N7O A;  1HM2 A;  1D6U A;  1X1H A;  3AMO A;  3D52 A;  2F7Q A;  2CWU A;  1W7C A;  3D51 A;  3EJU A;  3EJT A;  4MMH A;  1TQU A;  4EV5 A;  4BZH A;  3K5T A;  3BS6 A;  1R34 A;  4DUW A;  2WO0 A;  3DEC A;  4BZF A;  2OOV A;  4TTG A;  4EV2 A;  1HXK A;  2BT3 A;  3W7T A;  2YFO A;  1SPU A;  1W4N A;  1KSI A;  3BUB A;  3TY1 A;  3A24 A;  3HIG A;  1J0M A;  2F7P A;  2WW1 A;  3ACT A;  1K1W A;  2C10 A;  3CZS A;  1MMX A;  3X42 A;  1HM3 A;  3BGA A;  1C82 A;  2XN2 A;  4AQ0 A;  2HTB A;  3VSN A;  1AVL A;  1IVU A;  3IMH A;  2CIQ A;  2W0Q A;  3X41 A;  1W6G A;  1K1Y A;  3W7S A;  3NBJ A;  2F7R A;  3K25 A;  1JYN A;  4OK4 A;  2XN1 A;  4BTX A;  3QFY A;  1W5Z A;  3DYP A;  3I3D A;  2WW3 A;  3DYO A;  3CV5 A;  1IQX A;  3DX2 A;  1JZ4 A;  1N7P A;  1D6Z A;  1UI8 A;  4BTY A;  3WFA A;  1EKM A;  1RWG A;  1LUR A;  1JYW A;  3X40 A;  3D50 A;  3BVT A;  3NRE A;  1HMU A;  1HN0 A;  2CIR A;  4BTW A;  2WVY A;  1JZ8 A;  1SII A;  2WYH A;  2OW6 A;  1QX1 A;  3LOY A;  4KTR A;  3Q1N A;  3CZN A;  2C11 A;  3KN4 A;  5KBP A;  2ALW A;  2OQE C;  4OK2 A;  2CFK A;  4FNR A;  4NEI A;  4FNV A;  1NS0 A;  1PX3 A;  1X1I A;  1OJN A;  2RDY A;  1OJP A;  3T0B A;  1JZ7 A;  3EJR A;  3DX0 A;  1OJM A;  1F9G A;  1V7W A;  1IVX A;  1N7R A;  3T2P A;  1NS7 A;  2Y73 A;  3HI7 A;  5JMF A;  2EAD A;  5A1A A;  1NSZ A;  1MMU A;  3NJX A;  3WA3 A;  3D3I A;  2WW0 A;  5CA3 A;  3W7W A;  1YGA A;  1O7D D;  3S4C A;  1F4H A;  1V7X A;  1D6Y A;  3BVW A;  1LXM A;  3E7J A;  2WVX B;  3T0U A;  3WIR A;  3T2Q A;  3S4D A;  3BVU A;  3S4B A;  1JZ2 A;  2WOH A;  1N9E A;  1JRQ A;  4KTP A;  3RRS A;  3ALA A;  2F7O A;  3BVX A;  3OS7 A;  1IU7 A;  4FNT A;  1N7N A;  3EJP A;  2BRV X;  5JMD A;  3SXX A;  3BUQ A;  1HTY A;  3N9H A;  3AMO B;  3T09 A;  1RWC A;  2XSG A;  3I3E A;  3WVF A;  1L7K A;  1US1 A;  3VD9 A;  3QDE A;  1JYX A;  1V7V A;  3VD5 A;  3CZJ A;  3AFJ A;  3T0D A;  3PGB A;  2XHN A;  2E24 A;  3IAP A;  4DUV A;  2CWT A;  1HMW A;  3T0A A;  1TXK A;  2EAB A;  1RKY A;  1TQW A;  1WMO A;  3X3X A;  3VDB A;  1MN0 A;  1OJO A;  1QAL A;  2FUQ A;  3AFL A; 
#chains in the Genus database with same CATH homology
 1NS0 A;  1PX3 A;  3E1F 1;  1F4A A;  1OJN A;  1X1I A;  1OJP A;  3T0B A;  1JZ7 A;  4NEI A;  1F1S A;  4BZH A;  1OJM A;  1F9G A;  2ZXQ A;  3BS6 A;  1L7J A;  2ZQ0 A;  4DUW A;  3MWX A;  1SNZ A;  3MV0 1;  3DEC A;  4BZF A;  3A0O A;  1NKG A;  1N7R A;  2X03 A;  2WVZ A;  3VSM A;  4TTG A;  1W3Y A;  3T2P A;  1JZ5 A;  4RNL A;  3OB8 A;  1HN1 A;  1NS7 A;  2JKE A;  1SO0 A;  5JMF A;  3TY1 A;  5A1A A;  3A24 A;  1NSZ A;  1J0M A;  2WDA A;  3T08 A;  1NS8 A;  2WW1 A;  1K1W A;  1MMU A;  1CB8 A;  1K1X A;  1NS4 A;  1NSS A;  2WZS A;  3NJX A;  2WW0 A;  1RWA A;  1MMY A;  1MMX A;  2WW2 A;  1LOH A;  3MV1 1;  1NSX A;  1YGA A;  1HM3 A;  1YQ2 A;  3DYM A;  1F4H A;  3BGA A;  1C82 A;  1PX4 A;  3NJV A;  3DCD A;  4AQ0 A;  2HTB A;  1RW9 A;  3VSN A;  1N7Q A;  1LXM A;  2WVX A;  3E7J A;  3IMH A;  2CIQ A;  1ULV A;  3VD7 A;  2WVX B;  1K1Y A;  2JKA A;  3T2Q A;  3K25 A;  4J5T A;  1X1J A;  1LF9 A;  1JYN A;  4OK4 A;  1JZ2 A;  1EGU A;  1NSU A;  2WCO A;  3DYP A;  3BLC A;  3I3D A;  1Z45 A;  2WW3 A;  3IAQ A;  3MUY 1;  4OJZ A;  3VDA A;  2JKP A;  2CIS A;  3DYO A;  1JYV A;  3OBA A;  3OS7 A;  1N7N A;  2BRV X;  1JZ4 A;  1N7P A;  3ECQ A;  5JMD A;  1NSV A;  1JZ6 A;  2BRW A;  2HTA A;  4DUX A;  3WFA A;  2Q1F A;  1I8Q A;  1RWF A;  2BRP A;  1RWG A;  3T09 A;  1RWC A;  2XSG A;  3I3E A;  1LUR A;  3WVF A;  1NSM A;  1L7K A;  3VDC A;  3I3B A;  1JYW A;  3VD3 A;  3VD9 A;  1NSR A;  1DP0 A;  3T2O A;  3NRE A;  1JYX A;  1MMZ A;  1HMU A;  1HN0 A;  2CIR A;  2E22 A;  1NS2 A;  3MUZ 1;  4BZE A;  5E1Q A;  2WVY A;  2D73 A;  1JZ3 A;  2FUT A;  3E80 A;  1JZ8 A;  3VD4 A;  3VD5 A;  3CZJ A;  3T0D A;  1RWH A;  3J7H A;  2XHN A;  2E24 A;  3IAP A;  4DUV A;  1LF6 A;  1LXK A;  1HMW A;  1N7O A;  1HM2 A;  3T0A A;  1TXK A;  1UG9 A;  3Q1N A;  1X1H A;  4BZG A;  4MMI A;  3SEP A;  1J0N A;  3VDB A;  1MN0 A;  1OJO A;  4MMH A;  4OK2 A;  1JOV A;  2FUQ A;  4FNV A;  3AFL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...