1SO0A

Crystal structure of human galactose mutarotase complexed with galactose
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
344
structure length
344
Chain Sequence
b'GHMASVTRAVFGELPSGGGTVEKFQLQSDLLRVDIISWGCTITALEVKDRQGRASDVVLGFAELEGYLQKQPYFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTPRVLSNGVQFSRISPDGEEGYPGELKVWVTYTLDGGELIVNYRAQASQATPVNLTNHSYFNLAGQASPNINDHEVTIEADTYLPVDETLIPTGEVAPVQGTAFDLRKPVELGKHLQDFHLNGFDHNFCLKGSKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFPPVLLRPGEEYDHTTWFKFSVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords aldose 1-epimerase
publication title Molecular structure of human galactose mutarotase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 94
structure length 344
sequence length 344
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2004-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1so0A00
2WW3A 3T2PA 3VD7A 1N7OA 1N7QA 1I8QA 1YGAA 1NS7A 1NSRA 1JYNA 4BZFA 1N7NA 1HMUA 2WCOA 2WW2A 2JKEA 1RWAA 1PX3A 3VD3A 3DECA 2HTBA 4AQ0A 1N7PA 1SO0A 1W3YA 1JZ5A 4BZGA 1F9GA 1CB8A 1K1WA 1L7KA 3SEPA 2CIQA 3T08A 1JZ7A 1YQ2A 1JZ6A 1RWGA 3WFAA 3IMHA 4DUXA 2JKPA 3DYMA 1LF6A 2BRWA 2WVZA 3I3DA 1NS2A 1NSMA 1F4HA 1HN1A 3DYPA 3MUY1 3VDBA 1HMWA 1JYWA 1NS0A 3DCDA 3T2OA 2XHNA 1X1HA 1EGUA 2ZQ0A 3T0BA 1ULVA 1NKGA 3DYOA 3OBAA 1HN0A 1K1XA 1MMUA 2WW0A 3ECQA 1Z45A 3T0DA 2D73A 3MUZ1 1NSSA 3T2QA 1MMYA 2X03A 1HM3A 1X1JA 3CZJA 1F1SA 3OB8A 1NS8A 1N7RA 1F4AA 3VD5A 3NJVA 2WZSA 3MV11 1K1YA 2ZXQA 3J7HA 3IAPA 1JOVA 2WDAA 3BGAA 4BZHA 4RNLA 2WVXB 1NSXA 4DUVA 1JYXA 3VD4A 1UG9A 2XSGA 1C82A 1SNZA 4DUWA 1RWHA 1NSZA 2WVXA 1MMZA 3IAQA 1LXMA 3VD9A 1HM2A 1L7JA 1LURA 3I3BA 2WW1A 1JZ2A 1JYVA 1OJMA 1JZ3A 5E1QA 1OJPA 1NSUA 2CIRA 2HTAA 2WVYA 1J0NA 3K25A 1OJNA 1RWCA 3NREA 1OJOA 1JZ4A 1MMXA 1J0MA 1X1IA 2JKAA 3E1F1 1NS4A 2BRVX 1DP0A 2E22A 1LOHA 3T09A 4BZEA 3VDAA 1LXKA 4TTGA 5A1AA 1TXKA 3MWXA 3OS7A 2CISA 3T0AA 3MV01 1PX4A 3I3EA 2E24A 3Q1NA 1RWFA 3VDCA 2BRPA 3NJXA 3A24A 1JZ8A 1NSVA 1LF9A 1MN0A 2Q1FA 1RW9A
chains in the Genus database with same CATH superfamily
2WW3A 3VD7A 2F7PA 2E2VA 1YGAA 1JYNA 3BVXA 1N7NA 1HMUA 1TQTA 4EV2A 4K3AA 2HTBA 4AQ0A 2CWTA 1W3YA 4BZGA 1CB8A 4FNTA 3SX1A 2CIQA 1PU4A 3BVVA 3VSMA 3CZNA 3DX4A 3W7SA 3DX1A 4KTPA 2WVZA 3HI7A 2OOVC 3BUPA 1NSMA 2BT3A 3DYPA 3AMOB 3VDBA 1US1A 2XHNA 1EGUA 1WMOA 1ULVA 1H54A 1AV4A 2F7OA 3D3IA 2CFKA 1K1XA 1MMUA 3E80A 3T0DA 1NSSA 3RSYA 3T2QA 1WMPA 3CZJA 1X1JA 3DDFA 1F1SA 3OB8A 1F4AA 2WOHA 3EJUA 2WZSA 1R34A 1RJOA 2Y74A 2ZXQA 3J7HA 3IAPA 3BGAA 3S4AA 1TU5A 4K35A 3ALAA 1A2VA 1NSXA 3D51A 2CG0A 1JYXA 3VD4A 2XSGA 3NBJA 1RWHA 3BVWA 2F7RA 2YFOA 2F1AA 3QFYA 3WIRA 1HM2A 1OJMA 5E1QA 2HTAA 1QAKA 2Y73A 3NREA 1OJOA 2WOFA 1MMXA 1JZ4A 4OK2A 4J5TA 3S4CA 3ACTA 3RRSA 4BTYA 2BRVX 2E22A 3MI6A 1LOHA 3T09A 3LOYA 4BZEA 3VDAA 3T0AA 3MV01 4FNUA 3S4BA 3EJRA 1F9GA 1WMNA 1N7QA 1I8QA 4FNSA 1NSRA 2WW2A 2JKEA 3QDEA 3DECA 1SO0A 3AMOA 2WGQA 1L7KA 2E2UA 3K5TA 1D6UA 1D6YA 1W5ZA 3T08A 1JZ6A 1RWGA 3WFAA 3IMHA 4KTRA 4DUXA 3DYMA 1NS2A 1SPUA 3DX3A 1HMWA 3D4ZA 4MMHA 3KN4A 2ZQ0A 3KIIA 2WYHA 4KFDA 1IVXA 3DYOA 3OBAA 4UFCA 3ECQA 3X3YA 3MUZ1 1MMYA 2X03A 1HM3A 3EJPA 1IVWA 1PS3A 4FNVA 4EV5A 1JOVA 1SIIA 2WDAA 3W7TA 4RNLA 2WVXB 2OQEA 1OACA 1UG9A 1KSIA 2XN1A 4FNQA 1MMZA 1IVUA 3IAQA 1TQVA 3I3BA 3BS6A 2WW1A 1JZ2A 2CFLA 1JZ3A 3X41A 2WVYA 4BTXA 2CQSA 1QWNA 1V7VA 1QWUA 1J0MA 3CV5A 3E1F1 3ACSA 4NEIA 2F1BA 1IU7A 3WA3A 3BLBA 3X40A 3X42A 3OS7A 1PX4A 2E24A 1IQYA 1HTYA 3BUQA 2BRPA 1NSVA 3D4YA 2Q1FA 3X3ZA 1N7OA 1RKYA 1NS7A 1W6CA 2C10A 5GW7A 1TQSA 1PX3A 2XN2A 2WO0A 1TQWA 4FNRA 1N7PA 2CFWA 3EJTA 3SEPA 3BUBA 2JKPA 1LF6A 2FUQA 1F4HA 1HN1A 1AVKA 5CA3A 3QG0A 4KFFA 3DCDA 3T2OA 1X1HA 1NKGA 1N9EA 3SXXA 2D73A 3N9HA 3WIQA 1NS8A 2CFDA 1UI8A 3VD5A 3NJVA 3T0UA 3BVUA 2RDYA 2CWVA 2D1WA 1UI7A 3WVFA 2C11A 1C82A 1SNZA 1NSZA 2OQEC 1LXMA 2F18A 1DYUA 1LURA 3HIIA 4OK4A 1JYVA 2ZL8A 3AFJA 1NSUA 3W7UA 3K25A 3W7WA 1OJNA 2YX9A 1X1IA 1NS4A 1DP0A 3E7JA 1HXKA 1SIHA 1W7CA 3DDGA 1TXKA 3MWXA 3D52A 2CISA 2OW7A 3EJSA 3Q1NA 1RWFA 4KFEA 3CZSA 1JZ8A 1JRQA 1TQUA 1MN0A 3HIGA 1RW9A 3W7XA 2CQTA 4BTWA 3T2PA 2WYIA 3BUIA 3X3XA 4BZFA 2WCOA 1AVLA 1RWAA 3VD3A 3NBBA 1O7DD 1V7WA 3MPHA 2CG1A 1JZ5A 1R33A 1K1WA 2OOVA 3WA2X 1JZ7A 1YQ2A 1W6GA 3VSNA 1QX1A 2BRWA 3I3DA 5JMDA 3S4DA 3MUY1 1JYWA 1NS0A 2CWUA 4OJZA 3T0BA 3AFLA 2FYVA 1HWWA 2W0QA 3DX2A 1W2ZA 1QAFA 2EAEA 1HN0A 2WW0A 1Z45A 2EADA 2CFGA 2EACA 1LVNA 1N7RA 3D50A 3PGBA 3MV11 1K1YA 3QFZA 3BVTA 3BUDA 4FNPA 4BZHA 2EABA 1QALA 3BLCA 4DUVA 2FUTA 4DUWA 5JMFA 2WVXA 1V7XA 3VD9A 1L7JA 2OW6A 2ALWA 3LVTA 1OJPA 2CIRA 3EJQA 4MMIA 1J0NA 3TY1A 2XN0A 1RWCA 5KBPA 2JKAA 1EKMA 3DX0A 4TTGA 1LXKA 5A1AA 2F7QA 1W4NA 3I3EA 3VDCA 2YFNA 3NJXA 3A24A 3A0OA 1D6ZA 1LF9A 1IQXA 1IVVA 2PNCA 2E2TA
chains in the Genus database with same CATH topology
2WW3A 3T2PA 3VD7A 1N7OA 1N7QA 1I8QA 1YGAA 1NS7A 1NSRA 1JYNA 4BZFA 1N7NA 1HMUA 2WCOA 2WW2A 2JKEA 1RWAA 1PX3A 3VD3A 3DECA 2HTBA 4AQ0A 1N7PA 1SO0A 1W3YA 1JZ5A 4BZGA 1F9GA 1CB8A 1K1WA 1L7KA 3SEPA 2CIQA 3T08A 1JZ7A 3VSMA 1YQ2A 1JZ6A 1RWGA 3VSNA 3IMHA 3WFAA 4DUXA 2JKPA 3DYMA 1LF6A 2BRWA 2WVZA 3I3DA 2FUQA 5JMDA 1NS2A 1NSMA 1F4HA 1HN1A 3DYPA 3MUY1 3VDBA 1HMWA 1JYWA 1NS0A 3DCDA 4MMHA 3T2OA 2XHNA 1X1HA 1EGUA 2ZQ0A 4OJZA 3T0BA 1ULVA 3AFLA 1NKGA 3DYOA 3OBAA 1HN0A 1K1XA 1MMUA 2WW0A 3E80A 3ECQA 1Z45A 3T0DA 2D73A 3MUZ1 1NSSA 3T2QA 1MMYA 2X03A 1HM3A 1X1JA 3CZJA 1F1SA 3OB8A 1NS8A 1N7RA 1F4AA 3VD5A 3NJVA 2WZSA 3MV11 1K1YA 2ZXQA 3J7HA 4FNVA 3IAPA 1JOVA 2WDAA 3BGAA 4BZHA 4RNLA 2WVXB 3BLCA 1NSXA 4DUVA 3WVFA 1JYXA 3VD4A 1UG9A 2FUTA 2XSGA 1C82A 1SNZA 4DUWA 1RWHA 5JMFA 1NSZA 2WVXA 1MMZA 3IAQA 1LXMA 3VD9A 1HM2A 1L7JA 1LURA 3I3BA 3BS6A 4OK4A 2WW1A 1JZ2A 1JYVA 1OJMA 1JZ3A 5E1QA 1OJPA 1NSUA 2CIRA 2HTAA 2WVYA 1J0NA 4MMIA 3K25A 3TY1A 1OJNA 1RWCA 3NREA 1OJOA 1JZ4A 1MMXA 1J0MA 4OK2A 4J5TA 1X1IA 2JKAA 3E1F1 1NS4A 2BRVX 1DP0A 2E22A 1LOHA 4NEIA 3E7JA 3T09A 4BZEA 3VDAA 1LXKA 4TTGA 5A1AA 1TXKA 3MWXA 3OS7A 2CISA 3T0AA 3MV01 1PX4A 3I3EA 2E24A 3Q1NA 1RWFA 3VDCA 2BRPA 3NJXA 3A24A 1JZ8A 1NSVA 3A0OA 1LF9A 1MN0A 2Q1FA 1RW9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WW3 A;  3T2P A;  3VD7 A;  1N7O A;  1N7Q A;  1I8Q A;  1YGA A;  1NS7 A;  1NSR A;  1JYN A;  4BZF A;  1N7N A;  1HMU A;  2WCO A;  2WW2 A;  2JKE A;  1RWA A;  1PX3 A;  3VD3 A;  3DEC A;  2HTB A;  4AQ0 A;  1N7P A;  1SO0 A;  1W3Y A;  1JZ5 A;  4BZG A;  1F9G A;  1CB8 A;  1K1W A;  1L7K A;  3SEP A;  2CIQ A;  3T08 A;  1JZ7 A;  1YQ2 A;  1JZ6 A;  1RWG A;  3WFA A;  3IMH A;  4DUX A;  2JKP A;  3DYM A;  1LF6 A;  2BRW A;  2WVZ A;  3I3D A;  1NS2 A;  1NSM A;  1F4H A;  1HN1 A;  3DYP A;  3MUY 1;  3VDB A;  1HMW A;  1JYW A;  1NS0 A;  3DCD A;  3T2O A;  2XHN A;  1X1H A;  1EGU A;  2ZQ0 A;  3T0B A;  1ULV A;  1NKG A;  3DYO A;  3OBA A;  1HN0 A;  1K1X A;  1MMU A;  2WW0 A;  3ECQ A;  1Z45 A;  3T0D A;  2D73 A;  3MUZ 1;  1NSS A;  3T2Q A;  1MMY A;  2X03 A;  1HM3 A;  1X1J A;  3CZJ A;  1F1S A;  3OB8 A;  1NS8 A;  1N7R A;  1F4A A;  3VD5 A;  3NJV A;  2WZS A;  3MV1 1;  1K1Y A;  2ZXQ A;  3J7H A;  3IAP A;  1JOV A;  2WDA A;  3BGA A;  4BZH A;  4RNL A;  2WVX B;  1NSX A;  4DUV A;  1JYX A;  3VD4 A;  1UG9 A;  2XSG A;  1C82 A;  1SNZ A;  4DUW A;  1RWH A;  1NSZ A;  2WVX A;  1MMZ A;  3IAQ A;  1LXM A;  3VD9 A;  1HM2 A;  1L7J A;  1LUR A;  3I3B A;  2WW1 A;  1JZ2 A;  1JYV A;  1OJM A;  1JZ3 A;  5E1Q A;  1OJP A;  1NSU A;  2CIR A;  2HTA A;  2WVY A;  1J0N A;  3K25 A;  1OJN A;  1RWC A;  3NRE A;  1OJO A;  1JZ4 A;  1MMX A;  1J0M A;  1X1I A;  2JKA A;  3E1F 1;  1NS4 A;  2BRV X;  1DP0 A;  2E22 A;  1LOH A;  3T09 A;  4BZE A;  3VDA A;  1LXK A;  4TTG A;  5A1A A;  1TXK A;  3MWX A;  3OS7 A;  2CIS A;  3T0A A;  3MV0 1;  1PX4 A;  3I3E A;  2E24 A;  3Q1N A;  1RWF A;  3VDC A;  2BRP A;  3NJX A;  3A24 A;  1JZ8 A;  1NSV A;  1LF9 A;  1MN0 A;  2Q1F A;  1RW9 A; 
#chains in the Genus database with same CATH topology
 2WW3 A;  3VD7 A;  2F7P A;  2E2V A;  1YGA A;  1JYN A;  3BVX A;  1N7N A;  1HMU A;  1TQT A;  4EV2 A;  4K3A A;  2HTB A;  4AQ0 A;  2CWT A;  1W3Y A;  4BZG A;  1CB8 A;  4FNT A;  3SX1 A;  2CIQ A;  1PU4 A;  3BVV A;  3VSM A;  3CZN A;  3DX4 A;  3W7S A;  3DX1 A;  4KTP A;  2WVZ A;  3HI7 A;  2OOV C;  3BUP A;  1NSM A;  2BT3 A;  3DYP A;  3AMO B;  3VDB A;  1US1 A;  2XHN A;  1EGU A;  1WMO A;  1ULV A;  1H54 A;  1AV4 A;  2F7O A;  3D3I A;  2CFK A;  1K1X A;  1MMU A;  3E80 A;  3T0D A;  1NSS A;  3RSY A;  3T2Q A;  1WMP A;  3CZJ A;  1X1J A;  3DDF A;  1F1S A;  3OB8 A;  1F4A A;  2WOH A;  3EJU A;  2WZS A;  1R34 A;  1RJO A;  2Y74 A;  2ZXQ A;  3J7H A;  3IAP A;  3BGA A;  3S4A A;  1TU5 A;  4K35 A;  3ALA A;  1A2V A;  1NSX A;  3D51 A;  2CG0 A;  1JYX A;  3VD4 A;  2XSG A;  3NBJ A;  1RWH A;  3BVW A;  2F7R A;  2YFO A;  2F1A A;  3QFY A;  3WIR A;  1HM2 A;  1OJM A;  5E1Q A;  2HTA A;  1QAK A;  2Y73 A;  3NRE A;  1OJO A;  2WOF A;  1MMX A;  1JZ4 A;  4OK2 A;  4J5T A;  3S4C A;  3ACT A;  3RRS A;  4BTY A;  2BRV X;  2E22 A;  3MI6 A;  1LOH A;  3T09 A;  3LOY A;  4BZE A;  3VDA A;  3T0A A;  3MV0 1;  4FNU A;  3S4B A;  3EJR A;  1F9G A;  1WMN A;  1N7Q A;  1I8Q A;  4FNS A;  1NSR A;  2WW2 A;  2JKE A;  3QDE A;  3DEC A;  1SO0 A;  3AMO A;  2WGQ A;  1L7K A;  2E2U A;  3K5T A;  1D6U A;  1D6Y A;  1W5Z A;  3T08 A;  1JZ6 A;  1RWG A;  3WFA A;  3IMH A;  4KTR A;  4DUX A;  3DYM A;  1NS2 A;  1SPU A;  3DX3 A;  1HMW A;  3D4Z A;  4MMH A;  3KN4 A;  2ZQ0 A;  3KII A;  2WYH A;  4KFD A;  1IVX A;  3DYO A;  3OBA A;  4UFC A;  3ECQ A;  3X3Y A;  3MUZ 1;  1MMY A;  2X03 A;  1HM3 A;  3EJP A;  1IVW A;  1PS3 A;  4FNV A;  4EV5 A;  1JOV A;  1SII A;  2WDA A;  3W7T A;  4RNL A;  2WVX B;  2OQE A;  1OAC A;  1UG9 A;  1KSI A;  2XN1 A;  4FNQ A;  1MMZ A;  1IVU A;  3IAQ A;  1TQV A;  3I3B A;  3BS6 A;  2WW1 A;  1JZ2 A;  2CFL A;  1JZ3 A;  3X41 A;  2WVY A;  4BTX A;  2CQS A;  1QWN A;  1V7V A;  1QWU A;  1J0M A;  3CV5 A;  3E1F 1;  3ACS A;  4NEI A;  2F1B A;  1IU7 A;  3WA3 A;  3BLB A;  3X40 A;  3X42 A;  3OS7 A;  1PX4 A;  2E24 A;  1IQY A;  1HTY A;  3BUQ A;  2BRP A;  1NSV A;  3D4Y A;  2Q1F A;  3X3Z A;  1N7O A;  1RKY A;  1NS7 A;  1W6C A;  2C10 A;  5GW7 A;  1TQS A;  1PX3 A;  2XN2 A;  2WO0 A;  1TQW A;  4FNR A;  1N7P A;  2CFW A;  3EJT A;  3SEP A;  3BUB A;  2JKP A;  1LF6 A;  2FUQ A;  1F4H A;  1HN1 A;  1AVK A;  5CA3 A;  3QG0 A;  4KFF A;  3DCD A;  3T2O A;  1X1H A;  1NKG A;  1N9E A;  3SXX A;  2D73 A;  3N9H A;  3WIQ A;  1NS8 A;  2CFD A;  1UI8 A;  3VD5 A;  3NJV A;  3T0U A;  3BVU A;  2RDY A;  2CWV A;  2D1W A;  1UI7 A;  3WVF A;  2C11 A;  1C82 A;  1SNZ A;  1NSZ A;  2OQE C;  1LXM A;  2F18 A;  1DYU A;  1LUR A;  3HII A;  4OK4 A;  1JYV A;  2ZL8 A;  3AFJ A;  1NSU A;  3W7U A;  3K25 A;  3W7W A;  1OJN A;  2YX9 A;  1X1I A;  1NS4 A;  1DP0 A;  3E7J A;  1HXK A;  1SIH A;  1W7C A;  3DDG A;  1TXK A;  3MWX A;  3D52 A;  2CIS A;  2OW7 A;  3EJS A;  3Q1N A;  1RWF A;  4KFE A;  3CZS A;  1JZ8 A;  1JRQ A;  1TQU A;  1MN0 A;  3HIG A;  1RW9 A;  3W7X A;  2CQT A;  4BTW A;  3T2P A;  2WYI A;  3BUI A;  3X3X A;  4BZF A;  2WCO A;  1AVL A;  1RWA A;  3VD3 A;  3NBB A;  1O7D D;  1V7W A;  3MPH A;  2CG1 A;  1JZ5 A;  1R33 A;  1K1W A;  2OOV A;  3WA2 X;  1JZ7 A;  1YQ2 A;  1W6G A;  3VSN A;  1QX1 A;  2BRW A;  3I3D A;  5JMD A;  3S4D A;  3MUY 1;  1JYW A;  1NS0 A;  2CWU A;  4OJZ A;  3T0B A;  3AFL A;  2FYV A;  1HWW A;  2W0Q A;  3DX2 A;  1W2Z A;  1QAF A;  2EAE A;  1HN0 A;  2WW0 A;  1Z45 A;  2EAD A;  2CFG A;  2EAC A;  1LVN A;  1N7R A;  3D50 A;  3PGB A;  3MV1 1;  1K1Y A;  3QFZ A;  3BVT A;  3BUD A;  4FNP A;  4BZH A;  2EAB A;  1QAL A;  3BLC A;  4DUV A;  2FUT A;  4DUW A;  5JMF A;  2WVX A;  1V7X A;  3VD9 A;  1L7J A;  2OW6 A;  2ALW A;  3LVT A;  1OJP A;  2CIR A;  3EJQ A;  4MMI A;  1J0N A;  3TY1 A;  2XN0 A;  1RWC A;  5KBP A;  2JKA A;  1EKM A;  3DX0 A;  4TTG A;  1LXK A;  5A1A A;  2F7Q A;  1W4N A;  3I3E A;  3VDC A;  2YFN A;  3NJX A;  3A24 A;  3A0O A;  1D6Z A;  1LF9 A;  1IQX A;  1IVV A;  2PNC A;  2E2T A; 
#chains in the Genus database with same CATH homology
 2WW3 A;  3T2P A;  3VD7 A;  1N7O A;  1N7Q A;  1I8Q A;  1YGA A;  1NS7 A;  1NSR A;  1JYN A;  4BZF A;  1N7N A;  1HMU A;  2WCO A;  2WW2 A;  2JKE A;  1RWA A;  1PX3 A;  3VD3 A;  3DEC A;  2HTB A;  4AQ0 A;  1N7P A;  1SO0 A;  1W3Y A;  1JZ5 A;  4BZG A;  1F9G A;  1CB8 A;  1K1W A;  1L7K A;  3SEP A;  2CIQ A;  3T08 A;  1JZ7 A;  3VSM A;  1YQ2 A;  1JZ6 A;  1RWG A;  3VSN A;  3IMH A;  3WFA A;  4DUX A;  2JKP A;  3DYM A;  1LF6 A;  2BRW A;  2WVZ A;  3I3D A;  2FUQ A;  5JMD A;  1NS2 A;  1NSM A;  1F4H A;  1HN1 A;  3DYP A;  3MUY 1;  3VDB A;  1HMW A;  1JYW A;  1NS0 A;  3DCD A;  4MMH A;  3T2O A;  2XHN A;  1X1H A;  1EGU A;  2ZQ0 A;  4OJZ A;  3T0B A;  1ULV A;  3AFL A;  1NKG A;  3DYO A;  3OBA A;  1HN0 A;  1K1X A;  1MMU A;  2WW0 A;  3E80 A;  3ECQ A;  1Z45 A;  3T0D A;  2D73 A;  3MUZ 1;  1NSS A;  3T2Q A;  1MMY A;  2X03 A;  1HM3 A;  1X1J A;  3CZJ A;  1F1S A;  3OB8 A;  1NS8 A;  1N7R A;  1F4A A;  3VD5 A;  3NJV A;  2WZS A;  3MV1 1;  1K1Y A;  2ZXQ A;  3J7H A;  4FNV A;  3IAP A;  1JOV A;  2WDA A;  3BGA A;  4BZH A;  4RNL A;  2WVX B;  3BLC A;  1NSX A;  4DUV A;  3WVF A;  1JYX A;  3VD4 A;  1UG9 A;  2FUT A;  2XSG A;  1C82 A;  1SNZ A;  4DUW A;  1RWH A;  5JMF A;  1NSZ A;  2WVX A;  1MMZ A;  3IAQ A;  1LXM A;  3VD9 A;  1HM2 A;  1L7J A;  1LUR A;  3I3B A;  3BS6 A;  4OK4 A;  2WW1 A;  1JZ2 A;  1JYV A;  1OJM A;  1JZ3 A;  5E1Q A;  1OJP A;  1NSU A;  2CIR A;  2HTA A;  2WVY A;  1J0N A;  4MMI A;  3K25 A;  3TY1 A;  1OJN A;  1RWC A;  3NRE A;  1OJO A;  1JZ4 A;  1MMX A;  1J0M A;  4OK2 A;  4J5T A;  1X1I A;  2JKA A;  3E1F 1;  1NS4 A;  2BRV X;  1DP0 A;  2E22 A;  1LOH A;  4NEI A;  3E7J A;  3T09 A;  4BZE A;  3VDA A;  1LXK A;  4TTG A;  5A1A A;  1TXK A;  3MWX A;  3OS7 A;  2CIS A;  3T0A A;  3MV0 1;  1PX4 A;  3I3E A;  2E24 A;  3Q1N A;  1RWF A;  3VDC A;  2BRP A;  3NJX A;  3A24 A;  1JZ8 A;  1NSV A;  3A0O A;  1LF9 A;  1MN0 A;  2Q1F A;  1RW9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...