1SO5A

Crystal structure of e112q mutant of 3-keto-l-gulonate 6-phosphate decarboxylase with bound l-threonohydroxamate 4-phosphate
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
213
structure length
213
Chain Sequence
b'LPMLQVALDNQTMDSAYETTRLIAEEVDIIEVGTILCVGEGVRAVRDLKALYPHKIVLADAKIADAGKILSRMCFEANADWVTVICCADINTAKGALDVAKEFNGDVQIQLTGYWTWEQAQQWRDAGIGQVVYHRSRDAQAAGVAWGEADITAIKRLSDMGFKVTVTGGLALEDLPLFKGIPIHVFIAGRSIRDAASPVEAARQFKRSIAELW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evolution of Enzymatic Activities in the Orotidine 5'-Monophosphate Decarboxylase Suprafamily: Crystallographic Evidence for a Proton Relay System in the Active Site of 3-Keto-l-gulonate 6-Phosphate Decarboxylase(,)
pubmed doi rcsb
molecule keywords 3-keto-L-gulonate 6-phosphate decarboxylase
source organism Escherichia coli
molecule tags Lyase
total genus 84
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature ec 4.1.1.85: 3-dehydro-L-gulonate-6-phosphate decarboxylase.
pdb deposition date 2004-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1so5A00
1G4PA 2A6NA 4X22A 3W7JA 1ICQA 2B0MA 4AWTA 1TV7A 2QCMA 4HT3A 5FF4A 1TIMA 3BLFA 3TQKA 2FPTA 1GWJA 1NSJA 3KRUA 4FXSA 4ML9A 5D05A 4RJEA 4O19A 3W2JA 4FXRA 1PCKA 1C8VA 1S5WA 1IIHA 3T55A 3EXSA 2E77A 1K8YA 1ZALA 4ZQNA 3B06A 3T44A 3A9IA 3CEUA 5KZEA 4GRSA 3UWUA 2E6FA 1T0OA 1ZAJA 1LP6A 1WAUA 3TW7A 4UMCA 4FNRA 3DI0A 4O12A 3SY5A 4MPQA 3V1PA 4JIQA 4MY9A 1QDSA 2A1YA 4CNOA 3W7MA 1S5TA 4IGHA 5BOOA 4OBTA 3P84A 2Y89A 2QUUA 2TSYA 3B03A 2A6LA 3LV6A 1TPWA 3ABOA 1AL8A 3SR7A 1TPUA 3IIOA 2Y62A 3MMTA 3W1LA 1KW1A 1YXCA 5HJLA 2WJZA 2R94A 1FDJA 3GNDA 2V0TA 4RZ5A 3OVQA 3UPBA 3CQ0A 3W9ZA 5AHMA 3Q37A 1W1ZA 2EGZA 4IX0A 3NPWA 1NAL1 2VEIA 3O06A 3MI6A 2WKJA 3W7RA 4WY0F 1DJNA 1QFEA 3N2MA 2CZDA 3DBPA 1B57A 4PL2A 4MKNA 1JCXA 3BPWA 2JGQA 3PB2A 5D2XA 1OVDA 4IMEA 1GVFA 1X1ZA 4FX7A 3G8RA 2X2GA 4LVBA 4OHQA 3K30A 2Q3RA 1TPVA 5J5RA 3IGSA 4Q4KA 5F2MA 4S1FA 4NJHA 4RCXA 3NEVA 3L5MA 3LCFA 1G67A 1TQJA 4JX6A 3VE7A 1E51A 4LS0A 1VYPX 3NQFA 2W0UA 4FNQA 2H6RA 3HB9A 3UWQA 5E93A 1SSGA 3TFXA 4O50A 4QM1A 1ML1A 1WXJA 5G2HA 2NXGA 1W5NA 4K38A 1ICSA 3LCIA 4LW7A 3IRDA 4YLWA 4I7VA 3GXNA 5CKSA 4HNTA 2VFEA 4MJZA 4JTTA 3GNNA 4OU1A 3LCLA 4LVAA 3S1WA 1YDNA 5LGXA 1IF2A 1KTNA 4E2BA 4DF2A 3ATYA 3PBVA 3LI0A 3MHUA 1YXYA 3QYQA 4O1AA 2CZEA 2HSAA 3UXDA 2JBMA 3E96A 5CZSA 1EP2A 3A21A 2ZRYA 5F1UA 1KFEA 1KV8A 5K4ZA 3BW2A 4MVAA 3G1AA 1HUVA 3QH2A 1AG1O 3G1VA 3QW3A 4JDYA 3INPA 2WNZA 3UY8A 5C54A 1H51A 4ONVA 3W7OA 4NNCA 4OV9A 2Z6IA 1O60A 3PG9A 1H7WA 2XFWA 2DORA 3TJLA 1WV2A 1H1YA 5G2WA 2ZA3A 4ORIA 4XZ9A 5D2YA 3B0VC 3NZ1A 4U28A 4I7WA 4RKAA 5AHFA 2WO5A 5HMSA 1TMHA 4O1CA 2J9YA 1XM3A 3LTYA 2YFNA 3S8HA 1EP3A 4QISA 1LOLA 3THQA 5LHFA 4NUWA 3G1XA 1DQWA 4CQ9A 2A85A 4UFLA 2C15A 4KWVA 1WA3A 4JTKA 1SZFA 3BW3A 3STGA 4Z0SA 3HBLA 2O7QA 4ORMA 3BG5A 1FWNA 4K6AA 1KBIA 5I3JA 1U5JA 3S5OA 4UR7A 4TMBA 3CHVA 2NLIA 4Q33A 3RMJA 2WSRA 3GZ3A 1HG3A 1H7RA 3GX9A 6ALDA 3N34A 1CX9A 2VFHA 1ZAIA 1OFAA 2ZRVA 1GVQA 3BLEA 2CLFA 3P82A 4KWWA 2G5WA 3PF3A 5G5IA 3W88A 4HNUA 1MEHA 1YTKA 4DPQA 2XN2A 3GLCA 3L67A 3NQGA 2QCDB 2QF7A 4I9AA 3W83A 3C6CA 1K3UA 4O1BA 3TXVA 2OMAA 3ANYA 3OVRA 4BI6A 5D32A 2H3BA 1MSSA 1SO6A 4RR4A 3TX9A 5T26A 3G8EA 1VLIA 1PHWA 3STCA 3BK0A 2G95A 2BLEA 5AHIA 4EF9A 2ATMA 1HO4A 3G18A 1JUBA 2QDGA 3W86A 2WSYA 4OQVA 2ZZ1A 4E0CA 3TDFA 3EWYA 2VEPA 1XC4A 2V2CA 3NQ2A 4AMAA 2NV2A 2QJGA 1QCWA 4O11A 1HTIA 1I2RA 3W1RA 4JTLA 3EWWA 1SSDA 3IIVA 4XQ6A 1LORA 1Q6RA 1P4CA 4JEQA 2VFGA 4JNMA 2C0AA 1DJQA 3R89A 3BGJA 5CPLA 3PY2A 3SSJA 3VCRA 1VHNA 2TRSA 2X1TA 2E09A 3TMQA 3G1DA 3WK1A 3G0UA 4BFAA 3UPWA 4EVZA 3KAOA 1TPFA 3T78A 3PB0A 3TW6A 1XFBA 1S3HA 3NXFA 3RK8A 2ISVA 3NPVA 2GQ9A 4FB7A 5DY3A 3TU9A 3W22A 1LBLA 4WXZA 4NNAA 1RPXA 5A8GA 4IMGA 3S1XA 2J24A 1F73A 1Y0EA 2YXGA 3W1MA 3LX9A 3OHIA 3E02A 1TB3A 4FF7A 1ZJIA 4QSHA 3KXQA 5H91A 3QSRA 2A4AA 3CWOX 3MYPA 4AB4A 3MBFA 2EAWA 4DO6A 5DY2A 1XXXA 2Y88A 4LT9A 4PA8A 5ABTA 2AAMA 3NQCA 2NWRA 1W54A 2TPSA 2OCZA 2F7FA 1MZHA 3PVFA 2VEMA 4JYEA 3WJZA 3L21A 5EY5A 2C1HA 5HQEA 3BVJA 3L0KA 3SJ3A 3W7IA 3UNDA 3HGSA 4WQ6A 5DELA 4P61A 5C2XA 2AQWA 2E6DA 5KITA 4ZQCA 3RNDA 3DU0A 1VYRA 3HGRA 4FIQA 5D2WA 1DHPA 3WK0A 3W7EA 4FHAA 2DZWA 3M5YA 1IXPA 2X1UA 4CNNA 4UUIA 3TUUA 1QOQA 1D3GA 4O18A 4A2SA 4K37A 2FFCA 1P1XA 5CSSA 3DFTA 4PEKA 3TC6A 3BO9A 4JN6A 3WJWA 1GPWA 2HS8A 5BRBA 1WX0A 1IXNA 5LNVA 2V2HA 1YPIA 1QPOA 3HO8A 5I3GA 3C2VA 2RDUA 4UTKA 2PC4A 1VR6A 1ZHAA 3IGUA 1W5PA 3C61A 4IX2A 4D2JA 1WDWA 3W7LA 4NVTA 3W7CA 5D02A 3VNDA 3T4CA 3QQ1A 2YW3A 4DF1A 1UUOA 3NYZA 2C13A 1YXDA 3MYOA 1OHLA 3TAKA 5LKYA 4A2RA 3S42A 4Y8FA 5D09A 3M1ZA 4JX4A 4JICA 1C9DA 7TIMA 3F03K 1O4UA 2YYUA 4JTHA 4HPJA 3LOTA 1R46A 3O6YX 4E2DA 4DO4A 1LOQA 4DXVA 4H6KA 4LWWA 4GJ1A 4QQ3A 1PHQA 3ABSA 4LRTA 1OX4B 3F4NA 2ABAA 3KVJA 2A7PA 5DCDA 4GUHA 5A5WA 4IMCA 3OG3A 5G1YA 3SECA 3SGUA 2NXIA 1SPQA 4MFEA 5EYWA 5D04C 4AWSA 1TPDA 4WOQA 3N14A 3LTSA 1JCJA 2GJLA 3G0SA 2Y7EA 3EWXA 5E0KA 3G24A 2ZTJA 4NZFA 2LLEA 4R7JA 5D2VA 1XDMA 2PRHA 4MUZA 1PIIA 3NQDA 1F76A 3C2OA 5KZMA 3F4WA 4CCDA 4C1KA 1W37A 4GUJA 1XBZA 4UTUA 3L66A 4EWND 1W0MA 3WJYA 1YDVA 2JKPA 3HG2A 1GTEA 1SO5A 1SW7A 1EWEA 3QFEA 1Q45A 3IIPA 4Y90A 1LLZA 2OT1A 2P0OA 1VQTA 1H61A 2CLLA 1TRDA 1MXSA 3W2LA 3EWBX 2FPYA 4FO4A 1ADOA 1KA9F 1EEPA 4IQLA 1F74A 3W70A 4MFDA 3EB2A 4NQ1A 1VCFA 3ELFA 3E12A 2GQ8A 1FXQA 5F1VA 3M5XA 4NZJA 3FA5A 3FIGA 3G3MA 5KSWA 3STEA 1Q6OA 3OA3A 2GQAA 1FCVA 1VGAA 3UXAA 3DHFA 2W6RA 1PS9A 2V9DA 3O07A 1EX5A 1TPEA 2BSLA 4QAIA 3W7QA 3FS2A 4RZ4A 3GDLA 2NUXA 5K9CA 3W74A 4DELA 3GXTA 1G4SA 1M7OA 3NZRA 3EXRA 1DVJA 4AAJA 4GBUA 3GVGA 5CG7A 3PAJA 1LBMA 4O4WA 3GKAA 3LXBA 1ME8A 3C2FA 2C18A 5LSMA 1JRCA 2TYSA 5LNWA 4HSOA 3QMSA 4LRSA 1SO4A 4O0KA 4PL1A 4NJKA 3MW7A 2A7RA 2FTPA 3HG4A 2Z1BA 5EPDA 3LBCA 2XN0A 4KFPA 1LLWA 3I7QA 4OGZA 3W84A 3EX2A 4MY1A 4IOTA 5K9XA 3HGJA 1BWLA 4TO8A 1I2OA 3UWVA 3CLMA 1Z48A 3DKJA 4MZ1A 3TFCA 1UCWA 1YDOA 2DZTA 3ZR4A 2Z6JA 2EPHA 5I3HA 3E49A 1KM0A 1VRDA 3G1YA 4LOCA 3L5LA 4MZ8A 3B04A 1VC4A 1FCQA 4GUIA 1OFEA 3O05A 4XWUA 5C6MA 1FDZA 3O16A 2RFGA 5DBTA 2NX1A 3CIXA 3GK0A 3NQ6A 1XBYA 3S5NA 4AXKA 4O1DA 3P5YA 4L4MA 1FWSA 1ICPA 3KHJA 5LNSA 3H54A 4TIMA 2QJIA 3S0CA 3LXCA 4KFNA 4O14A 4RK8A 1M6JA 2Y6ZA 1TREA 1EB3A 1KTBA 2VFDA 2Y70A 2OZ0A 3MWAA 3NVTA 3IVSA 3QPZA 5G1TA 4N02A 1FBAA 3NM3A 1MO0A 1TTQA 2C19A 2E5CA 4NT0A 3NL3A 2CZFA 4QNWA 3DI1A 1KTCA 1EP1A 5F2LA 3HPZA 4Y9AA 5DBUA 4O10A 3W07A 3TMLA 3HMJG 3DENA 4N9EA 1GOXA 1C29A 2TMDA 3S1VA 1GVOA 8TIMA 3ABQA 3FJLA 1MEWA 3FOKA 3L0GA 3DFOA 4LS2A 3I6RA 4LS1A 1A5CA 3B8DA 4IMDA 2A5HA 5BMWA 1TTJA 5AN7A 3U2OA 5K7JA 3W2UA 1K03A 2GVLA 2Y63A 3BW4A 4K7YA 4AF0B 4NJJA 3S5ZA 2X30A 4O52A 3QEZA 2H3DA 2Q8ZA 4MIMA 2QCFA 3PBYA 3C56A 4FIRA 4UCGA 1OFBA 2NZLA 4X3ZA 4BF9A 1NF7A 3UD6A 1OJXA 1WQ5A 1B3OA 2NV1A 2ZZ3A 3CT7A 1LBFA 3RLVA 2P1FA 3I68A 4OWGA 3NA8A 2QKFA 1VHCA 1XDLA 3NM1A 1G4TA 5K4XA 1V5XA 1N7KA 3C2EA 4BK9A 3RF9A 3R5EA 4OT7A 2W79A 1LRNA 2VFIA 5HR6A 3O1NA 3WK3A 5DCEA 1JCLA 1VCVA 4Z1DA 3N3MA 4N2YA 1N8FA 3B4UA 2BWGA 1H7XA 5TIMA 3C52A 4KKXA 1JRBA 5LGZA 3IVUA 3NQ7A 1EIXA 1EWDA 3LCHA 4AEOA 3QPYA 5DXYA 2VXNA 3PBWA 1OABA 2Y7GA 1YPFA 3AJXA 1WBJA 2B7OA 3A5FA 1OX5A 1ZNNA 3PBUA 5HWJA 2ABBA 4NJGA 1XI3A 2Y85A 3NGJA 3P8IA 1D3HA 1XBXA 4Z0JA 4IPJA 5TQLA 4XUGA 1JUKA 4GC4A 3CB8A 1QNVA 3GB6A 3ZS4A 4JTIA 1SR9A 1X1OA 4YXGA 4EOUA 4W9TA 1VS1A 1H50A 3Q94A 2QUVA 4EIVA 5BMXA 1I2NA 2BXVA 5AC8A 1GYNA 3LI1A 5BW6A 1Q6QA 2E6AA 1NF0A 3L0NA 1OFDA 3KRSA 1OX6A 3QW4B 4JR5A 4JTEA 5U7SA 4UTJA 1FWWA 1DBTA 3G22A 3KVMA 2GVJA 4J9JA 2UV8G 3NQMA 1HL2A 4IPIA 1W5MA 2QDHA 5AYZA 4I7UA 4YL2A 4UXDA 4XKYA 4XTDA 3MP5A 2DP3A 3IIZA 4CQAA 1X8FA 3P67A 1GTHA 3UZ5A 3WJXA 5D2TA 3IVTA 1H63A 2YFOA 3O6DA 2DU2A 3GYEA 1ME9A 4JIPA 3H55A 2NX3A 3C4UA 1LTDA 3HIJA 4RLIA 1TJPA 2YW4A 2RHGA 2I9EA 5FF3A 1YTDA 2DZPA 5L6UA 1G69A 4UTTC 3ZFHA 1A5SA 1DORA 1FCBA 5F4XA 3GAYA 1SZNA 1WOBA 1TRIA 1UUMA 2OT0A 3IEBA 3SW6A 3TSDA 5AB3A 4ALDA 4MZYA 2EKCA 4JYFA 2FB2A 1J2WA 2CLOA 3NPUA 1OFOA 6TIMA 2R14A 3OVPA 2ZZ4A 4A22A 4O28A 3C8FA 1H7PA 1XBVA 3W76A 1A5BA 3QZEA 4JX5A 4N4PA 5FEPA 2VFFA 3G1FA 3HPXA 1PV8A 3UQNA 3H53A 2QCLA 4K8HA 3QJAA 3W1NA 1LOSA 3BG9A 3S5YA 4HSNA 2PE4A 3EX4A 3NQAA 4K7VA 5EA9A 3DFQA 2AGKA 3TK7A 2YDAA 1JQVA 3P61A 3W1QA 3W7HA 4L4LA 2R91A 3D0CA 3TSMA 3P60A 5I3FA 3LCXA 4LNYA 5CPMA 3GDTA 1YADA 2O7SA 4IXHA 1V7YA 1BWKA 3KRZA 4UTTA 1FUYA 1TTIA 4AWUA 2I1OA 4M5PA 4ZQRA 4CLMA 3QC3A 3EKLA 1TJRA 4HKPA 3TR2A 4MLRA 1QPQA 3W7GA 2DZSA 4IUOA 1K8ZA 4JTGA 3EX1A 2FDSA 5FF2A 2CLMA 5E1QA 4KFOA 3NL6A 3KVKA 1LRQA 4M19A 5D33A 1M5WA 3HF3A 5EBUA 3FYOA 3LXAA 2Q8LA 2JGYA 4K39A 4LUIA 3OEXA 4TR9A 2ALDA 1H7NA 1WYIA 5HUOA 1G4EA 2CLHA 1FWRA 2VELA 5FEZA 4JXCA 4UFMA 1GVSA 4R33A 2A0NA 4PCFA 4CCCA 1NEYA 4WXYA 4FEZA 3MP3A 1BEUA 1QOPA 3B05A 4NXSA 1VH7A 2V30A 3PSWA 4PTNA 4GE8A 4M6PA 2B4GA 1RQEA 3PUEA 4FX6M 5G4EA 2CWNA 3TSBA 1AW2A 2R8WA 2WQPA 2CU0A 3GAKA 3VKJA 1ZY9A 4UR8A 3BLIA 1OK4A 2YGYA 3W2MA 3JR2A 3LRLA 1TO3A 3HQ1A 4UTMA 4O13A 1KLYA 4IJBA 4DEFA 3M43A 4TU1A 4NX0A 3TV8A 3PR2A 2VOMA 1W3NA 3NQ8A 4U4MA 1LDCA 2PRLA 1Z41A 2YZRA 3SGZA 3HG5A 3OBKA 1I4NA 3TAOA 1H60A 2J6XA 5K2ZA 4DBDA 1ME7A 1SW0A 3O15A 3VE9A 1LM1A 2ZRWA 3EWUA 3M44A 3P5ZA 5AHEA 4O17A 2NUYA 3GXPA 2FQIA 2ZA2A 1CI1A 1OYCA 4NX5A 3DZ1A 1FWTA 1F7BA 4HPXA 2QEZA 4RZ6A 4WY0B 3LHVA 2V8ZA 1PE1A 4ADTA 1EPXA 2QR6A 4HNVA 5DCBA 2H8ZA 1RD5A 1RV8A 1W3TA 4H3DA 1KM6A 3O6CA 3M6YA 4JY9A 4E38A 3CTLA 1KFKA 4Y96A 2P10A 1VJIA 3DXIA 5L9FA 4MJMA 3LTPA 3SFKA 2A21A 2C16A 1PCWA 3T40A 4QIUA 2A2IA 2ZFAA 4HIBA 4ZVJA 3UWZA 3KFTA 3MI3A 3FKRA 4LV9A 2BTMA 2Y7DA 3AO0A 4O0ZA 5G4WA 1RQHA 2FIQA 4JTSA 3HPSA 3N73A 1W31A 3CIWA 3O8AA 2GJNA 3LCWA 2RDTA 1H1ZA 3LDVA 5KINA 5F2GA 3QMTA 2QCDA 3A24A 3IV3A 4RX0A 3W6YA 3LRKA 4R34A 2GVGA 1G6CA 1OFQA 1ZFJA 3R12A 4O54A 1ALDA 2VENA 4JTFA 1K8XA 4YCPA 3LLFA 5DXXA 3Q2DA 2Z0IA 5EL1A 3NDOA 2NWSA 4N9BA 3MP4A 3W7DA 1GJPA 3W71A 2DJLA 4MYAA 5J5DA 1B4EA 2RH9A 1XL9A 4DO5A 5MHBA 4UFKA 1U83A 3W7NA 3E0IA 1GT8A 4DBEA 2CLKA 1G7UA 1OFPA 3B0PA 4N9DA 3VI2A 3E9AA 2A7NA 3KVLA 1F05A 1PL9A 3N19B 2HTMA 2OX1A 4MOZA 5D38A 3TH6A 5F4SA 3P7YA 3TCEA 4OV4A 2QAFA 4UNKA 1KM4A 5HNRA 1KM5A 4PFMA 1GVRA 2DZXA 1RR2A 3T7VA 1GYLA 1B4KA 4LC8A 1XCFA 3LERA 4O15A 5EMUA 3EWZA 4DPPA 3WK2A 4HHPA 4JYDA 2J9XA 3UY7A 4LY8A 2E1DA 4M7TA 2EF9A 1VCGA 4PC8A 3CWNA 4DQWA 3L65A 3STFA 3NOEA 3TE9A 1KM1A 1YTEA 2Q3OA 2WV8A 2QCHA 2GUUA 1ONRA 2GOUA 4FNUA 3FLUA 1P0KA 5AFDA 2QAPA 3KX6A 1G7VA 1K7FA 1XKYA 3TIMA 3LLDA 2NX9A 3FFSA 3JS3A 3L68A 2ZQ0A 1OYBA 2H8XA 1FDYA 1O94A 2HMCA 1Z44A 5AC7A 3JRKA 4RXGA 4ADSA 1JJKA 2BZNA 5FF0A 1AW1A 4Z1CA 5CZJA 3W87A 2OJPA 4A3UA 2E68A 1TQXA 5U4NA 5LHEA 1JCNA 2FB3A 5D03A 4CQ8A 2JK2A 1NVMA 2G97A 4AHPA 3QSTA 3G1SA 3I65A 5HR7A 2YPIA 4JDBA 1OYAA 3N2XA 1IXOA 1D9EA 2V2DA 2QCGA 4BR1A 2ZA1A 4XBSA 2ZZ5A 2D73A 4M6QA 2ZRZA 4IXXA 1X7FA 3YPIA 4N4QA 3I7SA 4QNEA 3L2IA 1I2PA 4JGDA 1FQ0A 3DAQA 5G2IA 3SIZA 3G1HA 2QUTA 4BWLC 4RXFA 1RVGA 3DGRA 1R2TA 3M47A 2CLIA 4UTIA 4AH7A 1K7XA 2RDWA 4O4VA 2QCNA 4HNNA 3GDRA 3W1PA 1O95A 3O63A 4ZQMA 3PUDA 2YSWA 3R8RA 3RLUA 2V5LA 3MHFA 2X16A 3N9RA 4HN4A 4QITA 4LUJA 2G96A 3P80A 4LTSA 1QMLA 3CC1A 3SI9A 2V82A 1PVNA 5LNRA 3BGGA 1EUNA 5CPOA 1J5TA 1L2UA 1SO3A 4WY0A 3TJXA 4O57A 5H2ZA 3CM4A 1R30A 2QCEA 1R47A 1JCYA 1LCOA 3W85A 1HFBA 1QPRA 3OIXA 3LRMA 1TV8A 3MO7A 3NO5A 1AL7A 4FX8A 1OX4A 4G1KA 5DLCA 4Z1BA 3UWYA 1XUUA 1FY6A 3LHWA 3CU2A 1Q3NA 1F6KA 1QO5A 1L6SA 5FI8A 1TPB1 4NJIA 3W1AA 2V81A 3W75A 1R2RA 4GUFA 3LHTA 2YR1A 3PULA 4UFIA 4UMBA 4YCOA 3FYPA 2ZBTA 2RKXA 2C3ZA 1ZENA 3NG3A 4IMFA 3S6DA 1I2QA 4BWLA 5AYYA 4WZHA 5IM51 4QJ1A 5F4WA 2QCCA 1UJPA 1HO1A 2V5BA 1NFBA 1Q6LA 2J88A 1JUEA 1TV5A 2IQTA 1AW5A 1X6UA 3F1QA 3PC0A 3W1UA 3UWWA 1QO2A 1W3IA 1TSIA 3M7WA 4NNBA 3PWAA 2YYTA 4R53A 3GKFA 2ISSA 2WPBA 3EKZA 5HWMA 3GR7A 2Y61A 2QJHA 1KFCA 3FKKA 5C55A 3NR0A 1KM2A 2EHHA 5I3KA 5CGQA 2YX0A 1T99A 4UTWC 1JULA 2C6QA 2YCEA 1MEIA 3P81A 1GQNA 4LVGA 5BNKA 1OF6A 5HWNA 3DFPA 2CLEA 3M5ZA 1DOSA 1FX6A 1UASA 3EXTA 1M7PA 1F6PA 1CW2A 1KFJA 1IGSA 1OG0A 3NNTA 2JKAA 1A50A 1H7OA 2PURA 4NU7A 5GVJA 4K36A 4AVFA 1W5OA 4ICNA 3A22A 5AOUA 3ABRA 1SZGA 4Q32A 4JD4A 2ZRUA 4ZZ9A 2B7QA 1WBHA 1L9WA 3QMRA 1UB3A 1YYAA 2ZZ7A 4ZMGA 1RQBA 3NAVA 1VLWA 1B9BA 2PCQA 3KOFA 3QM3A 3PS7A 4GNJA 5HUPA 5C5YA 2H90A 3DFNA 3HJZA 4LVFA 5KZDA 3TQVA 3MJYA 3LHYA 2BX7A 5CPNA 4S2BA 1TPH1 3R13A 2HS6A 3CEPA 4FNSA 3TNOA 3W2KA 1I45A 4MLJA 4DF0A 3M9YA 3W7KA 4O8RA 4Z08A 3UZJA 1R2SA 3HGOA 2JKEA 4UTWA 1A53A 3LGEA 4RV8A 1KLZA 1P5BA 4GUGA 1YLVA 3GIYA 4O53A 3PSVA 1SZEA 1LRTA 3W3OA 1W56A 4NXKA 3W1TA 4M6VA 3RFAA 1AK5A 1SU5A 1ZAHA 1SW3A 5AYXA 2FLIA 5F2IA 1P0NA 1IIGA 3THAA 2X1SA 1TPC1 5FEWA 5FEXA 2E5BA 4Z1AA 3DHDA 1TCDA 1L6WA 1JQXA 1LYXA 2CZ5A 3QRHA 3ZWTA 1KBJA 4JS3A 5LZLA 3FJ6A 2WNNA 4M7SA 1SUXA 3B0UX 5K9DA 1QPNA 3GDMA 4WD0A 5CSRA 4WOZA 1FXPA 5AHNA 2ZTKA 3LB0A 2J9ZA 1DL3A 4ZQPA 5HULA 1W8SA 3C2RA 1QWGA 4H4IA 4JTUA 5LNUA 1FCUA 4MYXA 2ZCGA 1O5KA 3GDKA 3ATZA 4S2CA 3HG3A 4N6EA 2FPVA 3WJSA 4A29A 1VPXA 4N6FA 2Z2UA 3WFAA 4FNTA 4GXMA 4WX2A 1VZWA 4POCA 1O5XA 2CW6A 1OF8A 3M0ZA 5D30A 4ZQOA 1J4EA 1LROA 4X9SA 3UYCA 4CNPA 2VC6A 4JY8A 1Z42A 3CPRA 1UBSA 3EEGA 4AF0A 1K7EA 4ADUA 2WNQA 1TTPA 2DZUA 3PG8A 3EX6A 1N55A 5DN1A 1KFBA 5D37A 2FJKA 5CZ0A 3MUXA 3G0XA 1S5VA 1I8JA 4GWEA 4UMAA 2E5DA 1GG1A 3W7PA 2ZZ2A 1WOAA 3RU6A 3W1XA 5I3IA 3IGXA 3ZWSA 3U8GA 4Y6GA 5FF7A 4CCEA 3L9CA 1THFD 1SFLA 1ZCOA 4K8EA 5IBXC 1GEQA 3TC7A 1SQ7A 4YMZA 4UFJA 1T8XA 1AMKA 1SFJA 1BTMA 1KFLA 1DV7A 3SZ8A 4WUIA 2KZHA 3PUOA 3N9SA 2NUWA 3P62A 2WOQA 4BI5A 4LVDA 3DH7A 4ZL1A 1EA0A 2ATSA 4BI7A 3P8JA 1A5AA 4TMCA 1JCMP 4A21A 3MI2A 3M5VA 1F5ZA 3USBA 3NQEA 1W5QA 2I14A 2C14A 3NL5A 4AHQA 4N9CA 1BKSA 5TBOA 4UTLA 3TKFA 3V75A 4PH6A 1QR7A 1JR1A 1VYSX 3Q58A 3U6WA 3NL2A 2WSQA 3M41A 5EKYA 3TROA 3MHGA 4X2RA 4XTIA 3NQVA 5HINA 4UTHA 4AHOA 3FEMA 1DQXA 1OFRA 1QAPA 4UNLA 5AHLA 1RZMA 3NPXA 2XN1A 3S9YA 1XUZA 3C0JA 3G3DA 3LCGA 3R2GA 4FNPA 4C1LA 5IBXA 1H62A 3LBMA 3S1UA 1JVNA 3PM6A 4EF8A 1OK6A 3LM7A 3VFLA 4O16A 4TX9A 2VEKA 2X1RA 4LU0A 5CZTA 3L5AA 2Y7FA 5FESA 1K02A 1GG0A 2F84A 1TYGA 5SWUA 1LZOA 3W23A 2NXHA 1GZGA 2PRMA 2B7NA 3HOJA 1T96A 3LHUA 4B5NA 3M16A 1EUAA 4YWIA 4MY8A 1KM3A 4LV4A 1H5YA 3EX3A 4IWWA 2VKZG 3W73A 2B7PA 3TXZA 4UIOA 3I7RA 4WJEA 5K3VA 5KMYA 3C3NA 2J27A 2DJXA 2E6YA 3P74A 4PODA 4P2VA 3A5VA 4UFHA 5AC6A 3DFSA 3DKLA 3W72A 1KV5A 4GFSA 4XKYB 1DKWA 3BARA 3TA6A 2GPTA 3BG3A 3TQ0A 1L6YA 4UC5A 3A23A 2ZDRA 4LC6A 4XBKA 3LHZA 3W2NA 3GR8A 3MBDA 2ZRXA 3LV5A 4JTJA 2CFFA 2ZYFA 1F2JA 4OE7A 2ZZ6A 5KTLA 2DZVA 3IIXA 2ISWA 1IXQA 3QQ0A 3QF0A 3BV4A
chains in the Genus database with same CATH superfamily
2A6NA 4B5TA 3LMZA 2WJFA 4HT3A 4QJ3B 4L9ZA 3RDKA 3TQKA 1GWJA 1TX2A 4FXSA 4O19A 1HP5A 1PCKA 3WBEA 4B3LA 1S5WA 5E6ZA 2IPGA 4KCVA 4C90A 4IFOA 3B8SA 5KZEA 4GRSA 3QKZA 3R0KA 1H41A 2I56A 3UWUA 3QQWA 3SUUA 1WAUA 1MQQA 4PTWA 3VUSA 4QJ4B 4MPQA 1OCQA 4P7QA 3W7MA 1S5TA 4QHRA 1D3CA 4KWOA 2Y89A 2TSYA 5DO8A 2A6LA 3FDGA 4G56A 3SR7A 4MSSA 1R3TA 2QJMA 3VGFA 3WMLA 2WJZA 3GNDA 4B3ZA 4FR6A 1CGWA 2WYSA 5AHMA 1W1ZA 2CITA 4JIIX 3NPWA 1NAL1 1OWQA 2WKJA 2OG9A 4WY0F 4DYKA 3CASA 3N2MA 3AIQA 2YB4A 1B57A 1CENA 2DV0A 3CV6A 1JCXA 1AD4A 5D2XA 1OVDA 3EOUA 2JFEX 1X1ZA 5CGMA 2WPGA 1RXOB 3IGSA 2WVTA 6REQA 1R9XA 2PSNA 4LS0A 1VYPX 4HYRA 3NQFA 4GVHA 2PU0A 2D23A 3HB9A 3SCNA 1SSGA 3ITYA 5DQPA 4CU6A 1WXJA 2D0HA 3B0YA 3QY7A 4PCSA 1E0WA 5E9AA 1W5NA 3LCIA 4LW7A 3VMNA 3VAVA 3IRDA 4R88A 4BHYA 3TNBA 3GNNA 3S1WA 1W1B1 1YDNA 2CYGA 2O9TA 1XLHA 1IF2A 3BGAA 4DF2A 3PBVA 1JAKA 1IEQA 1YXYA 3MHUA 2CZEA 2YBTA 3FV9A 1PWMA 4DNMA 5CZSA 1EP2A 4Q4RA 5F1UA 3WSUA 4PUJA 1KV8A 4EPEC 1WUFA 4AQLA 4MVAA 3G1AA 1S2CA 3EB4A 2XVPA 1Q8JA 2GGGA 3QW3A 4C6FA 4JDYA 3ZO9A 4C1NB 1JNDA 1H51A 4ONVA 3W7OA 2Z27A 3EDEA 2WKGA 3W81A 1HKMA 3T6CA 1H7WA 5HAOA 1WV2A 5G2WA 4W8BA 4XZLX 2PGEA 4AFYA 2BHZA 3CL6A 3NZ1A 4U28A 4E2VA 4QX4A 1XM3A 3LTYA 3S8HA 3CHDA 1XYAA 1EP3A 3B8IA 4NUWA 4WCJA 1ZUAX 3NJ3A 3V36A 4F0LA 3CH0A 2C15A 1XIHA 4JTKA 3STGA 3HBLA 3BAJA 1UD2A 3CBWA 2WVUA 1VBGA 3V1HA 2OKTA 3E3HA 4F48A 6ALDA 3N34A 1XX1A 3TLLA 1DXEA 2VTFA 4AZ5A 2CLFA 1PDYA 3PF3A 4FP1A 4PULA 1A5NC 3EGJA 2OGJA 1MEHA 2PDKA 3GLCA 2R1MA 3RR1A 1ZGDA 3W83A 3QY6A 4JN7A 3A47A 3GR4A 2OMAA 3OVRA 2H3BA 1TR1A 4WVXA 1HJXA 4WF7A 3O2LA 2F2KA 3BK0A 4L56A 2BGQA 2G95A 2BLEA 4M0XA 1A0EA 3OZYA 3PZIA 3UXIA 3C0LA 1KC7A 1PYMA 4E0CA 3TDFA 2VZOA 3EWYA 5C9XA 1C92A 1ZP3A 4F0SA 3NQ2A 4AMAA 4PMUA 4XZHA 3V16A 3W1RA 3QKEA 5DEZA 2GL5A 1KKRA 1JAEA 4XQ6A 3GIQA 3PTDA 1XD1A 3IK4A 2QDDA 1F3EA 2OSYA 3WF1A 1EPVA 3BLOA 4H41A 2CNCA 3B8TA 3G1DA 2J7BA 3WK1A 3FN9A 3U48A 4U33A 4JQAA 3KAOA 1UQYA 3KBMA 4QGCA 3NXFA 5HNTA 1AJZA 2BY3A 4IMGA 2J24A 3GH4A 4HMDA 3W1MA 1UWRA 3E02A 1TB3A 1C90A 2WNWA 4GI9A 4FOKA 1Z69A 3KXQA 1V77A 5H91A 2A4AA 3MYPA 1E70M 3MBFA 2Y88A 4KCUA 3M7SA 5DF0A 4ROPA 3LPGA 3NQCA 1NU5A 3V35A 3PVFA 5IFPA 3FAXA 2GJPA 4FOUA 3L0KA 4HQVA 2J79A 4NAEA 3QN3A 5C2XA 3KL3A 1E9LA 1VYRA 3HGRA 5D2WA 5A69A 3MWCA 3KOYA 3QFWA 3A3HA 2DZWA 4UUIA 3AWOA 3TUUA 1QOQA 1M9HA 1TG7A 1P1XA 3DFTA 3VIHA 3BMXA 3WJWA 4B5XA 3WD0A 1WX0A 3FVDA 4GX9A 3QGKC 4MAZA 4UTKA 1XSJA 1ZHAA 1QI0A 1W5PA 3C61A 3OZOA 4DZHA 4IX2A 3TTYA 2UBPC 1Z6KA 3T4CA 1XPGA 1XYZA 5BXTA 2VVNA 4NIRA 1M7JA 3L4ZA 2Y1HA 3XIMA 1BF2A 5LKYA 1LF1A 4A2RA 1A4MA 1IEVA 4Y8FA 1LL7A 1JCTA 1DXIA 4M8UA 4Q7NA 3F03K 2GK1B 2RAGA 3E0VA 1TVLA 4JTHA 3T0AA 4MJ4A 1JXJA 2VUNA 4AEFA 1W1A1 4LWWA 4GJ1A 3ABSA 4GCXA 3SRHA 3F4NA 2ABAA 1OC6A 4CQCA 4GUHA 4GGHA 2ACUA 3OG3A 3VNZA 5G1YA 3A12A 2XUCA 3SN4A 3N9KA 8A3HA 5ABGA 2Y7EA 1DJXA 2WMJA 4FLSA 4NZFA 2ZTJA 2LLEA 5D2VA 1XDMA 1JI2A 5E09A 4EP8C 3VGBA 3PTKA 1W37A 1XBZA 3RPDA 1YDVA 2JKPA 2J7CA 1SO5A 3QFEA 1Q45A 5FD0A 3FEQA 1OZMA 1HKWA 2OYKA 4KS0A 1H61A 3W2LA 2YCIX 1DIKA 3L7RA 4HOWA 5A3HA 3F2CA 1DWAM 1I6NA 4K1WA 3W70A 4MFDA 2VT0A 1V3KA 3AYSA 5T9BG 1V03A 3HFYA 4MGGA 3G3MA 1A5UA 3N29A 2D0GA 1QI2A 3PUGA 3UXAA 3O07A 1CXFA 1EX5A 4QAIA 3GDLA 5HBFA 1SJCA 3R1ZA 4H6EA 1UHVA 3I4KA 1FOBA 1G4SA 4QLJA 1DVJA 2Q01A 3PAJA 2DSVA 4X0NA 3GKAA 3LXBA 3UEQA 1YDYA 5LSMA 1JRCA 4HSOA 1ODUA 4I6KA 4ECLA 1SO4A 4MWAD 3LNMA 3MW7A 1V3MA 4OIFA 2FTPA 4LBUA 3GO2A 2YBUA 3NURA 1M68A 1LLWA 4OGZA 5IOBA 1GVEA 1E6PA 2BNJA 4IOTA 2PEVA 1L6FA 2XVGA 4TO8A 3ZIZA 3U2EA 5GJNA 2DFAA 3CLMA 4NRSA 4U2YA 3OB8A 3TFCA 2QULA 1YDOA 3ZR4A 4V2XA 3GU1A 3CUHA 3S47A 3O7UA 4LUYA 3V3WA 3WUGA 3B04A 1R87A 1XJBA 1VC4A 1RH9A 3EEZA 3O05A 5HMEA 5C6MA 3CT2A 4JL1A 2BBFA 4RE2A 1XLBA 3CV1A 2RFGA 3GK0A 3ZYZA 3S5NA 2EG7A 1TE1A 3P5YA 3TYDA 1FWSA 3CB3A 1ICPA 5B7YA 3CQHA 3ES7A 5LNSA 4U5KA 3CUXA 1FWCC 3H54A 4TIMA 2QJIA 5D9PA 1DHKA 3SUSA 3S0CA 4KFNA 4O14A 4HA3A 4KH2A 4EWJA 4RK8A 1B30A 4JIHA 3WUEA 1KTBA 2OZ0A 3GC4A 5FSEC 3NVTA 4TTUA 3QPZA 4N02A 1MVYA 1JGMA 2CZFA 1XQKA 3HPZA 5DBUA 5BRPA 4PB5A 1WKFA 1PBGA 3DFHA 4L64A 1XPYA 3CL7A 2YA0A 4TVCA 3S1VA 4UNIA 1ITUA 3ABQA 1EOKA 2PWDA 1ONEA 1A5CA 2A5HA 5BMWA 1JPHA 1TTJA 4F79A 3AJ7A 1DIEA 3UZXA 3BW4A 2EPOA 3AYTA 1X98A 5HNUA 2X30A 2Q8ZA 3H2AA 3E2SA 2HPMA 1GOQA 4NZCA 1P0BA 1NF7A 2NV1A 1LBFA 2P1FA 1QBBA 4OWGA 1Z32X 2QKFA 3D47A 3RM4A 3GXFA 1Y7VA 4NRRA 1WZKA 3MZNA 3UG3A 1G0CA 1MZRA 3C2EA 2E9BA 3R5EA 2NT0A 4DYJA 2W79A 1LRNA 2CERA 2L5HA 3O1NA 1NH6A 3APGA 1JCLA 3BTNA 4FF5A 3PANA 4GGBA 4ZEPA 3B4UA 2EG6A 3WZ0E 3QV8A 1JRBA 4GPNA 1O1HA 3NQ7A 4NG3A 3RILA 3LCHA 3QPYA 1B1YA 1GCYA 4F0KA 2VXNA 3WH6A 1OABA 3C0SA 3AJXA 2B7OA 1ZNNA 2PFHA 2YL9A 3O3RA 5HWJA 2ABBA 1TVNA 3OVGA 2CXEA 3P8IA 1D3HA 5HPOA 1Q7ZA 5HXMA 3LGDA 4F4RA 2ZX9A 1X1OA 2VR4A 2DUAA 1KNWA 3Q94A 4EIVA 3QHNA 5BMXA 1XCWA 1MDRA 2AKZA 2E6AA 3AMCA 1QI4A 1DTUA 5I5RA 4JTEA 1JXKA 2P8CA 4IGMA 1SYTA 1HL2A 4IPIA 1HZYA 4YL2A 4XTDA 2V3DA 2HNHA 3AFBA 3CAWA 4E4FA 3UZ5A 1R9YA 2PTDA 1H63A 3SADA 2YFOA 1J5SA 4Z42C 2JE8A 1E40A 2X8RA 1N8WA 1AZ2A 5FF3A 2WC4A 1MUMA 5L6UA 3SCTA 4GLEA 2W66A 5HNNA 4ERAA 1FCBA 3AI0A 3VZZA 4C6IA 4JTRA 1E4LA 1V6XA 1UUMA 1ISZA 3SW6A 3TSDA 4PUNA 4LUSA 1ZRQA 1J2WA 2CLOA 3NPUA 4JHOA 1XLDA 3BOFA 2ZZ4A 3VKCA 1H7PA 2GUYA 3W76A 2CZVA 1A5BA 2QS8A 4JX5A 3BICA 3PP7A 1DWGM 3W53A 1WZAA 3KBNA 3HPXA 1S2WA 2QCLA 3N3TA 1B90A 1LOSA 3S6OA 4DZ5A 1E0XA 2C0HA 5ECUA 2WMIB 5EA9A 2AGKA 3P61A 1JQVA 3W1QA 4S3DA 4L4LA 1HKJA 1ZBKA 3IJQA 2INZA 3CZ8A 1BXBA 1FUYA 3U2ZA 1TTIA 3VTRA 4C7FA 1QJWA 3TR2A 1WAWA 4MLRA 3VIGA 1QPQA 4JTGA 3CAQA 5CC5A 4UQDA 4KFOA 2CCRA 3GXIA 4M19A 5D33A 1M5WA 4NI3A 2GUBA 2JGYA 4B5SA 4KGLA 2Z28A 3O0FA 3T0DA 4PMOA 4Q8PA 1P6WA 5HUOA 2R9RA 2CLHA 2VELA 3PZNA 1LQ0A 4UTFA 4R33A 3TQPA 2A0NA 2NLYA 1W9XA 4DUOA 1PIFA 4WXYA 1OCNA 3UW6A 4F66A 1VP5A 4NXSA 4YHEA 4BS0A 4M6PA 2B4GA 4FX6M 3F4DA 5HANA 2R8WA 3HA1A 2PDWA 2CU0A 2HQAA 1A3HA 3VGHA 5I00A 1A3XA 3BLIA 3W01A 1SFTA 1QW9A 2YGYA 2WXDM 1W17A 1TO3A 5AVHA 1XQLA 3SY8A 2OPJA 4TU1A 2YXOA 3TTEA 1LDCA 2HVOA 3A6OA 2PRLA 1X96A 2VEFA 1Z41A 1S3TC 1E6XM 2IS7A 3SGZA 1XINA 1I4NA 1XIEA 2Z7GA 1UD6A 1JIBA 1TWIA 4C1NA 2DW6A 1EQPA 4NX5A 5JMUA 1F7BA 2E9LA 1RD6A 2QEZA 4NI8A 4WY0B 5JU6A 1OM0A 1PE1A 2BOGX 3AIRA 4TX6A 4GVFA 2H8ZA 1RV8A 3TZNA 1W3TA 1RJRA 3O6CA 3GRIA 2REQB 4A8IA 1GOOA 4Y96A 4HYVA 3CJPA 3FK4A 1PCWA 1UPMB 4K3ZA 1GEHA 7ENLA 4X63A 1F3TA 4FK9A 5LA0A 4ZVJA 3KFTA 3MI3A 4BQ2A 4LV9A 3MMWA 1S2UA 4XSMA 3UJSA 3TYBA 4ACYA 2PDLA 3MUZ1 2FIQA 3BANA 3HPSA 3N73A 4GOAA 2GJNA 1Q7MA 3LCWA 1H1ZA 3CK5A 5KINA 4B3KA 3QMTA 3A24A 5KETA 3UG5A 1GZJA 3LRKA 3QHOA 4R34A 1HKIA 1Y8BA 1ALDA 4PBEA 2VWTA 4JTFA 1EJTC 1DJGA 3WH8A 3LLFA 1RK6A 3E38A 5EL1A 2NWSA 3VIIA 4D8LA 1H2JA 1VFTA 3W71A 3VNLA 4MKSA 1A5OC 2Y5JA 3W26A 1XL9A 5HQMA 2INEA 1VFUA 4HCLA 2Q6ZA 1GT8A 6CGTA 1PJ9A 4DBEA 3KBSA 2IKGA 4IJRA 2O9RA 4M24A 3VI2A 1T8QA 4PTMA 1PXGA 3KVLA 2QZRA 2HTMA 4G1NA 4ZXLA 4C7DA 1KXVA 5D38A 3TH6A 4Q7IA 1Y65A 4OV4A 4QCEA 4UNKA 1YHTA 2VX6A 1UA3A 3B8UA 1XCFA 3EWZA 4H9UA 1RPKA 1RBLA 5CC7A 3IAPA 4E6MA 3CPGA 2EF9A 3VC5A 2F6KA 4JFVA 3MCMA 3T08A 4DQWA 3L65A 3STFA 2XZ9A 1IEWA 3TE9A 3CLWA 2Q3OA 2WV8A 4CQDA 4CU7A 1BLIA 3V5FA 3K46A 2AOSA 4A6GA 1S2VA 4UQCA 2QAPA 3C8NA 3KX6A 1K7FA 1XKYA 2NX9A 2G41A 4MADA 4MPKA 3CUIA 3ZJ7A 1QNQA 4INFA 2ZICA 4TUFA 4GCAA 5AC7A 2XFRA 1JJKA 1YEYA 5CZJA 4A3UA 4H83A 5D03A 1NVMA 4W7VA 4FR1A 3RHGA 3VA8A 2IQDA 4AW7A 1EZ2A 1IWBA 1MWOA 3G1SA 3I65A 3QSTA 3QTPA 4JDBA 1KGWA 2PBGA 2GZXA 2V5JA 4Q6JA 1D9EA 4P5UA 1FH7A 2ZA1A 2ZZ5A 1PPIA 4AY8A 4NASA 4N4QA 2XFYA 3L2IA 2BGSA 1VPYA 1UWQA 2E0PA 4TTGA 3G1HA 3RR4A 2QT3A 1R2TA 1EGVA 1XYBA 3WDHA 1V08A 4GI6A 2YSWA 2V5LA 1CYGA 1RP9A 4HN4A 4QITA 3P80A 1WKDA 3RO6A 1CXLA 5CPOA 1SZRA 1UH2A 2GK1A 5B80A 4XK2A 3VPLA 1R30A 3W85A 4Z17A 2VD8A 3AZTA 4FX8A 3LMYA 3T2PA 3CU2A 3UR2A 1Q3NA 1VFHA 1F6KA 4XISA 1YNQA 5C70A 4BCEA 4UZSA 1AA1B 3DYPA 3W75A 1UKSA 5CXPA 3LHTA 3GD6A 1J93A 2ZE3A 1MDLA 1M7XA 1ZENA 5HQLA 4GH1A 1I2QA 3E1F1 5AYYA 5XIMA 1E1EA 1M65A 4B9YA 2PP0A 2QCCA 3C3UA 4JQ4A 1NFBA 1Q6LA 4XZNX 2DSZA 2HBVA 3F1QA 2IQTA 1AW5A 3ENLA 3N2BA 3FJNA 3UWWA 2CBIA 2XZ7A 5IDZA 1A5LC 3GKFA 5LXEA 3AYVA 3U5UA 3W6MA 2EPNA 3FKKA 4I8YA 1KM2A 2EHHA 5I3KA 5HMFA 1CTNA 4LBSA 3GFZA 4H7ZA 1RAKA 4EPKA 2YCEA 3PJTA 3P81A 1GQNA 5BNKA 5HWNA 3DFPA 3SJNA 5E5CA 3TR9A 3EXTA 1F6PA 3BLDA 1T7LA 3PZVA 1W9UA 1CW2A 3RLGA 3EDJA 4ZE4A 1IGSA 3AS3A 3TJ4A 1H7OA 4NU7A 5GVJA 3CMJA 4K36A 4M82A 4LF1A 1SZGA 4A8LA 3CO4A 3LQLA 4XD4A 4Q32A 1W8GA 3PBMA 4JD4A 2P88A 5C71A 4ZZ9A 1DP0A 2B7QA 1L9WA 3QMRA 2ZZ7A 4ATDA 1VLWA 4QBXA 4JBRA 1B9BA 2ZXAA 3QM3A 4GNJA 5CPSA 2V38A 1F3XA 1Q66A 3AXXA 3MTWA 3R11A 3NZPA 3N04A 1JZ4A 3TQVA 1GQKA 4CD8A 1NFGA 3R13A 1O12A 5CBJA 4LFYA 2HS6A 3SCOA 3S3GA 4FNSA 3VDHA 2F6UA 1Q6DA 1R7AA 4ZO7A 2NSXA 3URQA 4EKJA 2V63A 1R2SA 3WLPA 1W9PA 1ADDA 1S5MA 3GFXA 2HXTA 3PSVA 3IJIA 4W8AA 1B31A 1V3JA 1M3UA 2NQLA 2DSUA 5F2IA 1KFWA 4KEZA 1H5VA 2X1SA 4CEUC 3S1GA 5A95A 5LIYX 5FEXA 2XGIA 5A2BA 1G1YA 1LYXA 3VMPA 3UCDA 1DXFA 4F2BA 5LZLA 4LH8A 2WNNA 4H9XA 1SUXA 1RA0A 3FYYA 4HTBA 3B0UX 3GDMA 4WD0A 2VOTA 2XVNA 4WOZA 4AZ6A 5HJYA 5HULA 4ZQPA 1QWGA 3LZ5A 4MYXA 3D3AA 5I06A 4XAPA 4DLMA 1BYCA 1AJ2A 2C1IA 4N6FA 3WFAA 4GXMA 2XSAA 2VX4A 5AKQA 4J7RA 1P7TA 5D30A 2EJAA 3BAYA 1XIDA 1LROA 4JFSA 4X9SA 4FI4A 1KWKA 1SR0A 3UG8A 3VIFA 3IS4A 2VX5A 3SM0A 1Z42A 3GG7A 1EO5A 4FALA 3EEGA 4DWDA 1VFOA 3WF2A 4AD2A 2WNQA 3PG8A 3EX6A 1MQRA 1FP9A 4MF4A 1NP2A 4C6JA 5M3WA 3G0XA 3WMBA 2NQ5A 1EZWA 3UESA 3W7PA 1XV8A 1M04A 1B3ZA 3ZWSA 3N15A 3M6DA 1V6YA 4CCEA 3L9CA 2ASHA 2VDHA 4YMZA 2Q8XA 1PTAA 1SFJA 1W3LA 1V7AA 3GG0A 2NUWA 3DFYA 4BQ4A 2XIIA 4WRHA 2OR2A 4DJFC 4GK8A 1EA0A 4IPNB 3P8JA 4O1EA 1JCMP 3MI2A 3USBA 3NQEA 3AMDA 1PX3A 5D9OA 3OOQA 1BKSA 3ISIX 4PH6A 1E71M 1JR1A 2QLYA 3U6WA 3HFTA 2FJUB 3TROA 2C79A 4GBDA 2P0IA 4H9MA 3ES8A 1QAPA 4ZOAA 4LCRA 2H9AB 4HK6A 4IPLA 2XN1A 3S9YA 3R2GA 1KBBA 2GGEA 1CGUA 4L61A 1GJWA 4I3GA 2V3GA 5MKGB 2CKRA 2F61A 4ZTYA 3VNJA 1QHOA 3GY1A 1ECEA 3M46A 3NEHA 5E70A 3RMEA 2KAUC 4L1GA 4O16A 2QPXA 4LU0A 4KWSA 4DJFA 5JQ9A 1DJZA 4OKDA 3RPMA 1K02A 3WBAA 1C93A 1I0BA 1TKKA 8CGTA 2NXHA 4TV6A 2X0YA 4GYPA 2EPMX 2B7NA 3N2OA 2EJ1A 2W27A 3TYZA 4R9OA 1Z7AA 3VINA 3NXLA 1RY8A 4GX8A 2YL5A 3LHUA 2XSXA 4JTCA 4B5NA 1EUAA 4YWIA 1H09A 4OOZA 2YL6A 2W5FA 1EC9A 1H5YA 2E4TA 1PKMA 3F5KA 3EX3A 3WQWA 2B7PA 4UIOA 1E0TA 5K3VA 2J27A 4PODA 3F7JA 5AC6A 3DFSA 4UCFA 3H7UA 3GDBA 2O0TA 1J0HA 4GFSA 1Q7QA 4NHVA 2E25A 3TQ0A 2GSEA 1QATA 3LHZA 2WMIA 4REQA 3WH9A 3ONBA 4HMNA 3IIXA 1CXKA 2E8ZA 3QQ0A 1BGGA 1G4PA 4X22A 3VYLA 4RNJA 4AWTA 1TV7A 3BLFA 4PFHA 1R3YA 3AIVA 4DXKA 5D05A 4AZIA 2BVDA 1C8VA 4BA0A 1UIOA 2QGYA 2PF0A 3L2LA 3KS6A 5H8MA 1ESWA 3ZJ8A 1EDQA 3VUPA 3A9IA 4H2HA 5DMLA 4JFUA 2E6FA 5B7ZA 1DIOA 1ZAJA 1ZB5A 2ACRA 4S38A 1LP6A 3TW7A 4FNRA 4O12A 3SY5A 5H6HA 4DBWA 2FGLA 1U2YA 4F2TA 3AMLA 3KCJA 4IGHA 5BOOA 2XJ7A 3BURA 3P84A 2QUUA 4GY1A 3B03A 3VMOA 3LV6A 1J0JA 1TPWA 1AL8A 2IMRA 5LIWX 3IIOA 4UWMA 4XAYA 1NQ6A 3AXKA 3H7VA 3R79A 4ZE5A 1S1RA 3UPBA 3OVQA 3CQ0A 2YDRA 3Q37A 3SIMA 1SMAA 3K13A 4UOJA 4IX0A 2FVMA 2VEIA 3O06A 3W7RA 2G0WA 1ZBCA 1HT6A 3KS5A 1ITCA 3UZWA 4MKNA 1EXBA 2Z1XA 2XIMA 1SJAA 5I24A 3PZTA 4G7EB 4OHQA 3KWXA 4C6CA 4S1FA 5BRQA 1EDGA 3L5MA 1OQFA 4K2SA 1XFCA 1E51A 4DM2A 1JDAA 4BQ5A 4C5ZA 1FKWA 1WPCA 3UZZA 4GO9A 4XO6A 4MHBA 3CHEA 3UWQA 5E93A 4RPPA 3TFXA 1QASA 4ATLA 1ML1A 2O9PA 1OD8A 5G2HA 4PUUA 3UXLA 2X42A 1UWTA 4I7VA 4LSBA 3GXNA 5CKSA 2VFEA 4MJZA 1EEXA 1E73M 2VO5A 4OU1A 3LCLA 1Q2SA 5BZAA 1IZKA 2OLHA 2REQA 2ZIDA 5JUVA 3GW0A 2BS9A 1WKEA 4DJFD 4MB3A 4IMAA 4IFRA 4Q6XA 3LI0A 1CLVA 1YKWA 4PBGA 2QUMA 3PWGA 1TWZA 3K4AA 4J4KA 4DM1A 4I9MA 4Q3MA 3GTFA 3UGRA 3BW2A 3QH2A 1ISWA 2WLYA 1KD0A 5C9WA 2I7GA 4NNCA 2CXGA 1Z8AA 1Q5MA 2DORA 4FS9A 4OUEA 1BD0A 2AL2A 3TJLA 2J8TA 1H1YA 5BOEA 5I3DA 4NZ5A 3KOZA 4L1WA 4XZ9A 5D2YA 4CD6A 4AZCA 4RKAA 3B3DA 4HZMA 5HMSA 4O1CA 2J9YA 3WF3A 2YFNA 1UOZA 2FTYA 4B92A 2GSJA 1XSIA 3G1XA 4UFLA 1V93A 1XRTA 4ORMA 3BG5A 3VCCA 4HBKA 4TMBA 3VO0A 2NLIA 3WLLA 2WSRA 1HG3A 1OC5A 3GX9A 1CX9A 2VFHA 4H6RA 5M2FX 1K4HA 4Z2JA 1GVQA 2FZ9A 2VDGA 5G5IA 1XR2A 4HNUA 1EJ7L 2JIWA 2RGMA 1D7FA 4J1OA 1JDCA 3L67A 1XSKA 2FZ8A 4I9AA 4P7NA 4XAGA 3BAIA 1EH9A 1UP3A 4IQEA 3CZKA 3C6CA 4H9ZA 4O1BA 1JG9A 3S9ZA 2XGBA 3ANYA 5FJOA 3NFUA 1UJQA 4ZA0A 4RR4A 4JFWA 1JDEA 3GWQA 3NOYA 2EG8A 3STCA 2GSHA 3FCPA 3NUKA 1VRXA 1A80A 1KGXA 5AHIA 3K8KA 4EF9A 1XS2A 2ATMA 4A3HA 4H1ZA 5IHSA 4NYYA 2QDGA 3W86A 2Y8KA 2GJRA 1ZS2A 3Q67A 3DEQA 3QVQA 3JW7A 3F2DA 4U3AA 4XUYA 3WBXA 1QCWA 5DT7A 1XIJA 1HTIA 4O11A 4C60A 2ONEA 4C6MA 3WQFA 2YBVA 4C6EA 4W87A 4IHCA 1LORA 4GJIA 1P4CA 4JNMA 1BSLA 4PBFA 1ZBWA 1DJQA 3R89A 5AYBA 3BGJA 3PY2A 3LN3A 1VHNA 1MXGA 1GZ1A 2GJXB 1R9ZA 3UJFA 4DJDD 1TPFA 3AWNA 3T78A 1QI3A 2VJXA 1QU4A 2QUNA 3PB0A 4IF2A 4KWUA 5M17A 3TW6A 3RK8A 3NPVA 1R0MA 4D72A 2YXGA 1UR1A 3LX9A 1IYXA 1F6YA 1XLMA 3OA5A 1JI1A 4JIRA 4IIBA 3TC3A 5AVNA 3CWOX 1VBRA 1C3FA 4DO6A 5DY2A 4C91A 4D1IA 2PGRA 4TX8A 1BF6A 4KF1A 2AAMA 2PLCA 3KRBA 3PZQA 2J78A 1X7IA 4CUCA 2F7FA 4HSHA 2VZSA 3WUFA 3ITLA 2VEMA 1UH3A 2Q71A 3L21A 5HQEA 4PMXA 1CIUA 2HPIA 3W7IA 2QPSA 2WANA 2AQWA 3G5EA 2IXVA 4LEFA 1VEPA 4U5IA 3WK0A 4FHAA 3LZ3A 1RJQA 1VENA 2X1UA 2EKGA 4PSPA 5CSSA 3TC6A 5JBEA 2XTKA 3BO9A 4JN6A 2FH6A 1GPWA 2D2JA 5G1MA 1AH3A 3TN6A 1YPIA 3HO8A 3WQ6A 2PC4A 3GC5A 4W7WA 4D6DA 2J7FA 4GI4A 3M0XA 3W7LA 2DUXA 5D02A 3VNDA 3OTRA 2YW3A 4JQ3A 1UUOA 3PBGA 1AUSL 3MYOA 1XW8A 4ZO9A 5A8OA 4PUEA 1NJJA 4M6UA 4GJJA 3M1ZA 4I90A 4JICA 4K68A 4RV3A 1C9WA 3MKKA 3CHCA 2IW0A 1LWHA 3B4YA 3MO4A 1JYVA 3ARXA 1UPPA 2YYUA 4HVXA 3OODA 3LOTA 3LUTA 3O6YX 4DXVA 1A47A 5I79A 1XLLA 2XM2A 4H6KA 3H2MA 1PHQA 3KVJA 4IISA 2PDPA 5DCDA 4Q8WA 4IMCA 1H0GA 1OGSA 5EYWA 1XYCA 4PMJA 1RLDA 4AWSA 1TPDA 3UCQA 4FA3A 2OEMA 3N14A 3LTSA 1HW6A 3EWXA 4CQBA 5E0KA 2X0HA 3G24A 4P8WA 1A5MC 3NQDA 3E2RA 2XIBA 3C2OA 2DEPA 3OYZA 4C1KA 4GUJA 4CU8A 4EWND 3RN6A 1E6NA 4H9VA 1OC7A 1RCXB 3ARQA 4Y90A 4HCHA 2OT1A 3IWPA 4F0MA 2FPYA 2BVTA 1ADOA 1KA9F 4PE8A 1F74A 4H00A 4FZIA 3EB2A 3VKDA 5A8PA 3E12A 4H8NA 1W2VA 5F1VA 5KSWA 1Q6OA 3RG6A 1B5TA 3RCNA 4YTSA 2W6RA 1PS9A 3H22A 6PTDA 2C7FA 4JFTA 4HTYA 1TPEA 2BSLA 3DUGA 3W7QA 2RJGA 3FS2A 4NZ3A 2FZMA 5I6SA 3W74A 1UD5A 4GKLA 1E9YB 3NZRA 3FDKA 3WDJA 3EXRA 1BVNP 3QR1A 5CG7A 1XLEA 4O4WA 1XHGA 4WKAA 3KHDA 1QK2A 2DT1A 2C18A 3EWCA 2RJHA 3QMSA 4O0KA 4NJKA 1H49A 4JPGA 3GH7A 1R3RA 2B31A 2HZGA 3BWWA 4OTKA 5EPDA 3LBCA 2VC9A 1P6CA 3UT0A 3I7QA 2XGZA 3CO8A 5K9XA 3H23A 3MUIA 3II1A 3HGJA 4RNHA 3UWVA 5DRCA 4K1GA 1XIFA 4MZ1A 2WBKA 2J4GA 3UU0A 1OEPA 2CLPA 1XRVA 2HE8A 1EIBA 1VPQA 2XSBA 5I3HA 3ZVIA 1WDQA 4KMQA 5LIXX 4NZ1A 4GUIA 4XWUA 1XLIA 1K8CA 3E5BA 3MT1A 2NX1A 3NQ6A 2CHRA 4PN2A 4E5TA 3WLOA 3KHJA 1W9DM 5FJTA 3LXCA 1V02E 1M6JA 3SCSA 5M5DA 4Z2IA 2GGIA 1GQJA 4LPCA 3NM3A 3RCYA 1JDFA 1TTQA 3NL3A 4QNWA 4IL0A 4R3UA 4B5UA 3DI1A 2ZX6A 2GVYA 2WBGA 4O10A 2Z1WA 1NWUA 3WNMA 3W07A 1DWHM 1JNEA 4GIAA 1HXJA 3HMJG 1K6WA 2O92A 5BXPA 3JUGA 1EO7A 1MEWA 3L0GA 5JBDA 2IKJA 5I23A 2WMFA 4AIBA 5AN7A 3W27A 6ENLA 2QJNA 1A0CA 3OLIA 1NQKA 2PWUA 4AF0B 4R7OA 4O52A 3QEZA 3SURA 2H3DA 4A8RA 7ODCA 4X3ZA 1TX0A 2RDXA 3UD6A 1OJXA 1WQ5A 3CT7A 4H8VA 2WHKA 3POCA 3I68A 3USZA 1PYFA 3NM1A 1G4TA 3K8MA 3FY1A 5K4XA 3SY1A 2H9AA 3L4UA 4FOJA 3I4EA 4OT7A 3D46A 3VFCA 3KZSA 3EAUA 5T8GA 5HR6A 3GFYA 1R38A 1VCVA 1XLKA 3N3MA 1EJSC 4LUTB 5MKGA 5CSUA 3C52A 2FZBA 3IVUA 1R85A 1EIXA 2PDHA 3N2CA 4AEOA 1XDJA 1WBJA 4NJGA 2Y85A 3POHA 1XBXA 1EXPA 4IPJA 1FKXA 1XC6A 5TQLA 1GHSA 3R7MA 1JUKA 1QNVA 1JDDA 4Q8NA 1CGVA 1LG1A 4YXGA 1K4GA 4W9TA 1VS1A 3SCWA 1NIUA 4J5NA 1YIXA 2YKKA 1I60A 3CUZA 1QW8A 1ECQA 3ARVA 2GWNA 4OUIA 5A2AA 4LAOA 1OFDA 3S9IA 2WZHA 1PWLA 1L2QA 3E0WA 4JR5A 3ITXA 4HGXA 1FWWA 3G22A 5JVLA 3KVMA 1PUDA 3WH7A 2UV8G 4J3UA 3P3BA 4I7UA 4UXDA 3MP5A 3VOIA 1UR8A 4KETA 3RYSA 1BVZA 4S3KA 3WJXA 1C91A 3SRFA 4Q4OA 3QZAA 1UQZA 5XINA 4DI8A 3TOPA 4AIUA 4MB4A 1TA3B 3W4RA 3HQOA 4IH3A 3C4UA 1LTDA 2XFFA 3BMWA 1WP6A 1TJPA 1O7AA 2RHGA 2QV4A 1G69A 4UTTC 3ZFHA 1A5SA 2QYGA 2VGIA 3GAYA 1SZNA 5EBAA 3TLQA 1UZDA 7PTDA 4AWEA 4N0RA 2XIQA 4GINA 2OT0A 5AB3A 1BG4A 1KRCC 3BAXA 1DWIM 2V5KA 4JYFA 2WC7A 1OFOA 4WEVX 3E2QA 3ARRA 1JPKA 3QZEA 4N4PA 3GQYA 2WMGA 3SB0A 3M0MA 2XWDA 4V28A 3H53A 1LWIA 4K8HA 4YPJA 3W1NA 2PLJA 5A6TC 4NYUA 3S5YA 3BC9A 3EX4A 4TXEA 1G01A 3TK7A 3SQMA 1TV3A 4ACZA 2R91A 3D0CA 2ON3A 3SFWA 5CPMA 3W00A 3EOOA 3GDTA 3EB3A 1YADA 5CPQA 1BWKA 1EBHA 2YOCA 2ZOXA 1F8MA 4UTTA 4M5PA 1J0KA 4A3YA 1XRFA 4PZVA 3TN3A 2IKHA 3IUHA 4IUOA 5I2UA 3EX1A 2FDSA 5BXSA 3KVKA 1LRQA 4EAMA 4GNVA 3H2NA 4K8GA 3CMFA 3FYOA 1TWWA 4G7EA 3T8LA 1E56A 3OEXA 4ES4A 4TR9A 3AHXA 2ALDA 4IM4A 3V7PA 5DRIA 3WFLA 4L7ZA 5TAOA 1GNXA 3PK7A 1K77A 3S2NA 4S3CA 1E3XA 4JXCA 2ZUSA 1GVSA 3EDFA 4GY7A 3ICJA 2FTWA 1NEYA 2D69A 3PJUA 4DJEC 3ZVHB 1XGDA 1VH7A 2PI6A 1ZP4A 1TJ2A 3WLQA 4YYFA 1PKLA 3CQJA 1MW1A 1KXTA 3PUEA 1EHAA 2UY2A 2ZUWA 3KWSA 2CWNA 3TSBA 2VCBA 3ZQ9A 4HK7A 3GAKA 5FKYA 3VKJA 1JYXA 1ZY9A 3GU2A 3CXOA 1OK4A 3LPOA 3LRLA 1DJIA 4QSFA 3M43A 3VOHA 4NX0A 1Q8AA 2PDMA 3PR2A 2BOEX 3TYEA 2YZRA 1E1CB 3HG5A 2DQWA 3QTGA 1H60A 2J6XA 5GJPA 5K2ZA 4DBDA 4D9PA 1GKRA 1SW0A 1XLFA 1GOKA 2ZRWA 3EWUA 2PP3A 3M44A 3P5ZA 2X7WA 3N4EA 3GXPA 2ZVIA 4DJEA 1XIBA 3GUGA 4M51A 2P50A 2V8ZA 1UR2A 3GU9A 4ADTA 3WEMA 3M6YA 4C6KA 1WZLA 1XH0A 4E38A 6TAAA 4ASTA 5A8MA 3ARUA 1VJIA 4TV5A 5C0QA 2VRQA 5L9FA 3SFKA 3ITGA 2C16A 3N13A 4O0QA 3SSZA 2G4FA 1UC5A 3G6LA 1IT7A 2FDMA 3UWZA 3G1RA 2BTMA 3AO0A 1MUWA 3IRSA 1AMYA 3BH4A 5G4WA 4ML4A 2MUCA 1Q2RA 1Q6GA 4QDMA 1W31A 8RUCA 1M03A 1SVDA 5G4HC 5KZ6A 2PDNA 3HV8A 4HA0A 3BMVA 2YB1A 3AISA 5F2GA 4OECA 3WF0A 2PWEA 4W5UA 5I09A 5FCZA 2XH2A 4RX0A 3W6YA 1OFQA 4RDYA 2VENA 1K8XA 4MWAE 2RUSA 3Q2DA 3DHPA 4QG8A 3TA9A 3NDOA 1ADSA 3B40A 3ZLFA 4N9BA 3W7DA 1GJPA 1J2BA 2DJLA 1B4EA 3MUY1 5GNZA 1SJDA 4DWSB 5C8BB 5MHBA 1U83A 3W7NA 3KLKA 1LUCB 4F0RA 4XG1A 2J74A 1OFPA 3B0PA 4JIEA 3E9AA 2A7NA 3N19B 4B4FA 4B91A 3ZT7A 3UWEA 1BRLB 3QLLA 1FWFC 3KTSA 2QAFA 1GQIA 3LSBA 3EKGA 3LG3A 2CESA 3CTTA 1FWEC 1B4KA 2GJXA 3CUFA 3LERA 4O15A 5EMUA 2PLKA 2CPUA 2VNCA 4GIEA 2J9XA 3H2OA 4C65A 2PCEA 4XAFA 1VCGA 2OYMA 3WBYA 2WCAA 2IKIA 4MB5A 1YTEA 4HJWA 2J8GA 4W89A 4LB3A 3FLUA 3MZ2A 5AFDA 3LLDA 4Q4MA 3KW3A 2E7FA 1W1YA 2ZQ0A 4LAMA 2A3HA 1ZSXA 2H8XA 1FDYA 4DRSA 3R10A 3VIJA 3EWDA 3OBAA 4HPHA 3JRKA 4RXGA 2HEJA 4HHHA 4Z1CA 4RNIA 3WQOA 3W87A 2OJPA 2E68A 5U4NA 1S38A 3IUDA 2QVHA 2XDFA 2FB3A 5XIAA 2BVWA 2KX9A 1EKOA 5A6BA 1KCKA 3PPCA 1Q63A 3WNLA 1W9BM 3OPSA 3RIKA 2ZX8A 1K9FA 1BGAA 1XYFA 2QCGA 4XBSA 4RUBA 4M6QA 2D73A 2ZDSA 2VRJA 3TN5A 1MQPA 3S83A 3YPIA 1RCQA 3VGGA 2VCCA 4UOZA 3S46A 4QNEA 1WKYA 1QNPA 1FQ0A 4DJED 5G2IA 2A79A 4IQDA 1KQZA 3T0TA 1BG9A 4W7UA 3M47A 1FWJC 4UTIA 3OZMA 2RDWA 3MQTA 4O4VA 1F8IA 3ZT6A 1Q6EA 3SBFA 3O63A 5AYIA 3RLUA 3MHFA 1PDZA 3N9RA 2HK0A 4RDZA 4ZOCA 4QE5A 2R6OA 4CN1A 3BDKA 2G96A 4LUJA 5FA5A 3CC1A 2HVNA 3SI9A 1VD6A 3SUWA 3UFYA 5LNRA 3KOXA 2WM0A 4CCZA 1L2UA 3TJXA 5DANA 2PUZA 5D9MA 1NDWA 3FAWA 1OGBA 4EACA 3WQ5A 1AQHA 1R47A 1LCOA 1Y5XA 1QPRA 3OIXA 4C6DA 3NO5A 1C8QA 1AQMA 3UWYA 1FY6A 3CYVA 4HN8A 5A8NA 3UR8A 2WB5A 4NJIA 1UW9A 2CIPA 2VVSA 3W1AA 2V81A 3B0XA 2YR1A 3AIUA 2C8NA 4C6LA 4UFIA 3CMGA 2E28A 4UMBA 3FYPA 2Q09A 2C3ZA 4YYCA 3NG3A 3S6DA 3VOJA 4DB7A 3W37A 1US2A 4WZHA 4JQ2A 2Z1KA 4QJ1A 5F4WA 1HO1A 2V5BA 1G9HA 3P0XA 1JUEA 1X6UA 3W1UA 3PC0A 5KEZA 3MSYA 4WDUA 4XSLA 1XH1A 4NNBA 1R3WA 1UP0A 3AZSA 4DZAA 4W85A 3ZR5A 5C55A 5FACA 3NR0A 2ZUUA 1E6RA 4XD6A 2FVKA 3APTA 3DBNA 1JULA 2C6QA 4BF5A 4WHBA 3VKBA 2CLEA 3M5ZA 1FX6A 1V0LA 3WQVA 1RJPA 2OLSA 4X9YA 2WVSA 1Q6CA 1DJYA 5LIUX 5BWAA 4LY4A 2PURA 3U9IA 4AVFA 1CGYA 3EBVA 1W5OA 4ICNA 5AOUA 4D6JA 4S3BA 3HM7A 2ZRUA 4U31A 1PSCA 3FW6A 4RNFA 2SFPA 1WBHA 3JZEA 1TUXA 5GJMA 4KT2A 1O68A 1RQBA 3NDZA 1V6TA 3NAVA 2FFIA 2CETA 7A3HA 4ZGYA 2PCQA 3KOFA 3CH9A 2H90A 4DUWA 2YA1A 3HV9A 4F40A 3DFNA 3MKVA 4LVFA 5KZDA 1V6VA 3AXHA 2BX7A 4S2BA 1TPH1 1C8XA 4AVNA 3W2KA 3I10A 4LYQA 3M9YA 4GVGA 4AD5A 4YTQA 3WY1A 4ZXOA 4DI9A 2DH3A 3PHAA 1KLZA 1P5BA 1W3JA 4GUGA 3GIYA 3U5YA 1W56A 1J6PA 3ZJKA 1MRQA 1GUVA 3W1TA 3RFAA 1AK5A 1SU5A 3VOFA 1ZAHA 4G6CA 1F4HA 2ACQA 2FLIA 3THAA 5DMYA 1TPC1 4ZOEA 1EQCA 2E5BA 4D6CA 1L6WA 1JQXA 2CZ5A 3N6HA 3GVWA 6XIAA 4P8XA 4N7QA 1HP4A 4IUGA 4BQ3A 2J8FA 2GLKA 3ITTA 3VM5A 2JEQA 2Z1VA 5K9DA 4KRUA 5CC6A 4J40A 5CSRA 5CCZA 1FXPA 5AHNA 1JF5A 3C2YA 4B16A 4H4IA 5LNUA 1FCUA 4GZ7A 3B9NA 2G8ZA 3DX5A 3GDKA 3KDNA 4S2CA 3SQSA 3HG3A 2O55A 1B54A 4N6EA 3WJSA 1E4MM 2Z2UA 4NL1A 2NVCA 1VBJA 1AH0A 3WCZA 4Q8TA 4WX2A 1VZWA 2CW6A 3WNPA 1OF8A 3M0ZA 3GVQA 4ZQOA 1J4EA 2HVMA 3TYAA 3ONCA 4CNPA 4CD7A 1UBSA 4AF0A 4Z1YA 1YNYA 1K7EA 3WLNA 4HNLA 4ZTXA 1XIIA 4E8CA 1KFBA 3KBWA 1KBLA 5CG0A 3LNPA 3MUXA 4MNLA 4GWEA 4A4AA 2OXNA 1SFSA 4Y8EA 4W5ZA 5I3IA 3WLTA 2GDVA 3DCPA 2WC3A 3SCPA 5FF7A 1THFD 4GYJA 3FX4A 3QYSA 3MY9A 4LUTA 1XG4A 2QV5A 3N12A 1B9ZA 1DV7A 4WLCA 4WUIA 3PUOA 2WMKA 2BODX 2WOQA 1VBHA 4BI5A 3OLDA 4F2UA 4AYSA 3VNKA 4BI7A 3HURA 3V0TA 3AIEA 3W0KA 3DN5A 3VIPA 3VOGA 4GZJA 3ZT5A 1NTHA 2I14A 3BSGA 2I5QA 4KEUA 1MMFA 4CKQA 4N9CA 3ID7A 5TBOA 2GYIA 2IPJA 1QR7A 3ARTA 3B9OA 4Y9PA 3WDQA 2PODA 3NL2A 2WSQA 3ANUA 3M41A 5LXXA 3MV11 3BZJA 5HINA 3K8LA 2ESCA 5AZ0A 1JD9A 4UNLA 2HV5A 5AHLA 1PTGA 2J13A 3G3DA 4C7GA 4L6OA 2BXZA 1NDVA 3S1UA 1BTCA 1YBQA 1J11A 2OU4A 1GVYA 2GFTA 1X97A 2WJEA 4EF8A 4NF7A 1NY1A 1CXHA 3F4VA 3LM7A 2IQ0A 1EGZA 2VI0A 2X1RA 1AQ0A 1HGWA 5SWUA 3ITCA 2ZKMX 2DQXA 3PJXA 3TCSA 4DX3A 3U0HA 2HJPA 2PRMA 2ZVRA 3MSDA 2OWXA 3LGGA 1LT8A 3UF9A 1XCXA 5D8ZA 3HOJA 1E4NA 2WWCA 2PB1A 2HCVA 3QR0A 2OWWA 3WQGA 1LQAA 4GY0A 2EEXA 1F4AA 4LV4A 2DY3A 2VKZG 1SMDA 1OIFA 3OYXA 3WNNA 4WJEA 2E6YA 1QNSA 3UG4A 3A5VA 3M0LA 1H1NA 4UFHA 1CZ1A 4KBXA 1MW3A 4XKYB 3TA6A 3MANA 1L6YA 4UC5A 4LC6A 3FNDA 1B3YA 1FH9A 3BJFA 2ZRXA 3VD5A 1J9YA 3LV5A 4JTJA 4HZ6A 1KWGA 2ZYFA 4XX6A 4DNHA 2ISWA 1N2VA 2I9UA 3OGSA 3U2CA 3BV4A 3A5FA 3V5OA 3GHRA 3W7JA 1AH4A 1M1BA 3MC5A 2QCMA 3BL3A 5FF4A 2DT0A 1TIMA 2FPTA 4I9TA 3WG6A 3KRUA 1NWRA 1L8PA 3CWHA 2WM1A 4D8AA 1V0MA 4PRRA 4QE1A 2VC7A 5C2CA 1PZ0A 3H21A 4H8HA 2W62A 1Z9AA 2E77A 1K8YA 1ZALA 4ZQNA 4AG0A 1IT0A 4YIWA 3B06A 3CEUA 5CEWA 4U2ZA 2YXXA 1UZHA 4HMEA 1TUFA 3DI0A 3V1PA 4JIQA 4MY9A 4XIMA 2B81A 2A1YA 1M53A 1XYLA 3ZVHA 1UR4A 3ABOA 3WQCA 1WXYA 1TPUA 2Y62A 2QMJA 3GTIA 1KW1A 2AAAA 5HJLA 3I6TA 2ZWZA 2R94A 4RZ5A 1GOIA 1AD1A 1UMLA 2EGZA 5J8LA 2CHOA 2C91A 2J7DA 3MI6A 3CHFA 1DQUA 5FJRA 2J6VA 1QFEA 4MWAB 3DBPA 4OBRA 3PB2A 1GVFA 3CQIA 3G8RA 1W1VA 2X2GA 4LVBA 3K30A 2Q3RA 1TPVA 3HZ3A 1E1CA 4Q4KA 5F2MA 3APYA 3NO3A 3D6NA 3NEVA 3QV9A 1O6IA 2QNEA 3LCFA 2VGFA 4PMRA 4JX6A 3VE7A 3MUCA 4FNQA 1E9IA 2E67A 2H6RA 3BLLA 1ZU8A 3ALGA 4GZEA 4ZSTA 4GABA 3F5LA 4K38A 1ICSA 4IIHA 4YLWA 4AZHA 4JTTA 2OEKA 2WQDA 4L65A 5REQB 4LVAA 5LGXA 2VUYA 4XV0A 4DIAA 4L4OA 9CGTA 1KTNA 4E2BA 3ATYA 3H6OA 3V18A 3QYQA 2YCKX 4O1AA 4S3GA 2JBMA 4W88A 3EMZA 2IXUA 3A21A 2ZRYA 4JTAA 7CGTA 5K4ZA 2PDQA 4LCSA 1HUVA 1AG1O 4WSHA 1OINA 1IV8A 1H0IA 3AHYA 3G1VA 1FFQA 2WNZA 3VGDA 2X40A 3VXGA 4OV9A 1O60A 3PG9A 4HU8A 1E3ZA 2XFWA 3A9BA 1H4PA 1CNVA 3OJGA 2ZA3A 3A4XA 1FH8A 4ORIA 4WK9A 3HU7A 4M80A 4UB9A 1J01A 3IK2A 1HVXA 4DWSA 4QISA 5LHFA 3BSHA 1ZLPA 4CQ9A 1TMLA 4IIEA 3ZOAA 1NOUA 3T2QA 1WA3A 5LIKX 1SZFA 3RM8A 3BW3A 3EA3A 3GTHA 3PZ9A 1FWNA 4K6AA 3JZUA 1U1HA 1U5JA 3S5OA 4UR7A 4PUDA 3CHVA 3GNXA 1RALA 1E43A 3RMJA 4UOQA 1BRLA 2VDIA 1ZAIA 3UBPC 3OLEA 4KWWA 2OEJA 3VC6A 2G5WA 3W88A 3TN4A 2XN2A 5BOFA 2J7HA 3VK5A 3NQGA 4L6HA 2DPEA 1K3UA 3NYDA 2DW7A 3ANVA 5D32A 2D3LA 1MSSA 4MUPA 4HB7A 3G8EA 1GOWA 4AC7C 3NGFA 5BROA 3VIOA 1NOFA 1FWBC 2Y24A 2E9MA 2WSYA 4OQVA 2ZZ1A 1KCLA 4A8NA 4EPBC 1XC4A 3PNZA 2YIHA 2DH2A 2VX7A 4JTLA 1E1FA 3EWWA 3HPFA 4R7WA 1VFMA 1Q6RA 1EC7A 3CS2A 2VFGA 1Z89A 3AS1A 4FXJA 1TJ1A 5CPLA 2TRSA 2E09A 4AEEA 4H9TA 4PYSA 2BGNE 4J3ZA 4BFAA 1CWYA 4ZB2A 4EVZA 1R7OA 1XFBA 1VF8A 3WX7A 2ISVA 4DUXA 4AD1A 3BZGA 4FB7A 5TD4A 3T0CA 3NSXA 4WXZA 3W22A 4NNAA 3TU9A 5HDRA 3GNOA 1IEIA 3S1XA 1P6BA 4M1RA 1F73A 3IACA 4HU4A 3WH5A 3QLDA 3NO1A 4FF7A 1ZJIA 4QSHA 4G7FA 1J18A 4US5A 1XXXA 3S2JA 4LT9A 4F9JA 1LL4A 1HNYA 3WQ8A 5ABTA 2AMGA 1UWUA 5C7HA 2NWRA 1MRAA 1MZHA 1JF6A 2ACSA 1V6UA 3SUVA 1PAMA 4JYEA 3CZLA 2C1HA 3BVJA 5CSYA 3GC2A 3SJ3A 3HGSA 3RM9A 1XGEA 2J7EA 5DELA 4P61A 1OD0A 1MFUA 4AIOA 2E6DA 5KITA 4ZQCA 3RNDA 2P53A 1DHPA 2VEGA 3KLLA 1IXPA 3O0KA 3RJXA 4AXNA 1GW9A 1D3GA 4O18A 1CXEA 4PEKA 3AC0A 3L4WA 1CBGA 2PWVA 2VHLA 3ECQA 2VD9A 5LNVA 2V2HA 1QPOA 4GC3A 1RUSA 5I3GA 2OO6A 2RDUA 1VR6A 3IGUA 4IIFA 3MMUA 4QROA 4NVTA 1UMYA 4DF1A 3A4WA 2ZUVA 5I0DA 3V0UA 1FWGC 3OHMB 2XIJA 1YXDA 1OHLA 1K6AA 4PCNA 5D09A 2XG9A 3CV2A 2W4XA 1U5VA 1XLAA 3CZJA 7TIMA 1A5KC 1O4UA 4TVDA 4E2DA 1TELA 4DO4A 3GVRA 1OX4B 2A7PA 1VJZA 3VD3A 4GH3A 1BYAA 3M0JA 3SGUA 1SPQA 4MFEA 4NILA 1TZ7A 5D04C 2INFA 4WOQA 3MCOA 3HMCA 4RDWA 1Q4WA 4R7JA 1DJHA 1PIIA 1DE6A 3F4WA 2DIJA 3W25A 3L66A 5LA1A 3NIYA 1GYMA 3R6IA 3HG2A 1RCOB 3E0FA 1GTEA 1SW7A 1EWEA 3GHSA 3IIPA 2XHYA 2P0OA 1U1UA 5CH9A 4LNCA 3IV8A 1EEPA 4IQLA 1UUQA 4AY7A 3ELFA 1E4IA 4R27A 2GQ8A 1FXQA 2WHJA 3N6JA 1GOMA 3M5XA 4NZJA 4HOXA 3FA5A 3STEA 2EBNA 1I1WA 3WD2A 3OA3A 2GQAA 3DG3A 1FCVA 1VGAA 1JZ5A 4HP5A 4W93A 1J6OA 3W02A 2V9DA 1YE6A 3KM8A 2TAAA 3IJ8A 4QJ5B 5K9CA 2X05A 3LD5A 3GXTA 4PMZA 4CN4A 1M7OA 2ZUMA 2CC0A 3VDGA 4GBUA 2YZ5A 1ME8A 3R25A 3WNKA 2TYSA 5LNWA 4S23A 4H01A 1WDPA 2A7RA 4S3AA 3RRXA 4HD5A 4PRTA 4XZWA 5D8WA 3QOKA 2Z1BA 2XN0A 4GACA 1BSIA 4US5D 4LUSB 4MY1A 1PX4A 2Z29A 4AZBA 3VNMA 1O1ZA 3L2MA 2OOGA 1VAHA 2OWCA 6A3HA 4V33A 3DKJA 4KIEA 8XIAA 5GNYA 5FJIA 2ISDA 3R8HA 2Z6JA 3W28A 4NY2A 3E49A 1VRDA 3CYJA 4U10A 3L5LA 4MZ8A 3AIBA 1BXNA 1EJXC 1O5RA 1OFEA 3EMCA 1HJVA 2PDBA 1J10A 1FDZA 1TV2A 3O16A 4L9YA 3CIXA 4AXKA 4L4MA 1WDRA 1AJ0A 1V3IA 1TREA 3AU6A 1EB3A 2VFDA 2Y70A 4ZFCA 1IR1A 3H2EA 3FHAA 2DT2A 3P0WA 3IVSA 4WR3A 3GVVA 2XU2A 1X1NA 3PPFA 3FXGA 4ATWA 1F9CA 1MO0A 3FHQA 2E5CA 2C19A 4NT0A 2PTWA 1EP1A 4R85A 1OB0A 4Y9AA 3VDAA 4KRTA 4DAFA 3TMLA 3DENA 4B90A 1IZCA 2TMDA 2Q02A 1OY0A 1GVOA 3VM7A 1IGWA 3AU2A 3DFOA 4LS2A 3I6RA 4LS1A 4OZOA 4S39A 3B8DA 4IMDA 5DT5A 3U2OA 3RX2A 3HJEA 5K7JA 4KIRA 2GVLA 4DY1A 4NJJA 3S5ZA 2HBXA 2XVLA 4MIMA 1F61A 2QCFA 3OO2A 4FIRA 4UCGA 1OFBA 2NZLA 3AUOA 4BF9A 3DECA 3KE0A 2ZZ3A 4IP7A 3BQ5A 3RLVA 5BWFA 3KP1A 3NA8A 1VHCA 3URBA 1E55A 1V5XA 4I8DA 1XF0A 1OADA 3IUIA 1K9DA 4OFCA 3UJEA 3L4XA 4BK9A 1PB0A 4XIAA 3R94A 3AUJA 2ISFA 2VFIA 3ZSTA 5DCEA 4QDWA 5H8UA 3MV01 1N8FA 3WO8A 2BWGA 5TIMA 2DSKA 5DX7A 1EJVC 4Z2LA 1S5NA 3VKKA 4L5ZA 3PBWA 2Y7GA 3N11A 3AIWA 1QNOA 1Y5VA 2J75A 3WD4A 3PBUA 4KCWA 1OX5A 4A05A 1QTWA 1Q13A 1XI3A 1WUEA 4E4PA 4EAYA 4Z0JA 4XUGA 2YDSA 4GC4A 1UR3M 4GQ0A 3EA1A 3ZS4A 1VFLA 2BB0A 2OVLA 4WIWA 1NOWA 4QP0A 2BXVA 1EGMA 1GYNA 1U30A 2W63A 5CPTA 2X1IA 2VR2A 1KR1A 3SN0A 4BY3A 5EMMA 3L0NA 5DFAA 1OX6A 1V51A 1PEZA 1UBPC 4UTJA 2VR5A 3W6LA 2WCSA 1CB2A 4HYWA 2GVJA 4J9JA 1HQT