1SO5A

Crystal structure of e112q mutant of 3-keto-l-gulonate 6-phosphate decarboxylase with bound l-threonohydroxamate 4-phosphate
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
213
structure length
213
Chain Sequence
LPMLQVALDNQTMDSAYETTRLIAEEVDIIEVGTILCVGEGVRAVRDLKALYPHKIVLADAKIADAGKILSRMCFEANADWVTVICCADINTAKGALDVAKEFNGDVQIQLTGYWTWEQAQQWRDAGIGQVVYHRSRDAQAAGVAWGEADITAIKRLSDMGFKVTVTGGLALEDLPLFKGIPIHVFIAGRSIRDAASPVEAARQFKRSIAELW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-keto-L-gulonate 6-phosphate decarboxylase
publication title Evolution of Enzymatic Activities in the Orotidine 5'-Monophosphate Decarboxylase Suprafamily: Crystallographic Evidence for a Proton Relay System in the Active Site of 3-Keto-l-gulonate 6-Phosphate Decarboxylase(,)
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 84
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature ec 4.1.1.85: 3-dehydro-L-gulonate-6-phosphate decarboxylase.
pdb deposition date 2004-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1so5A00
1D9EA 4GUJA 2ZRZA 4K8EA 3S42A 1GYLA 2J6XA 4MZ1A 3DFOA 3T55A 3W1UA 2E6DA 4MY9A 2XFWA 3G1HA 3FJLA 4O50A 3STEA 2J27A 2Z6IA 5C2XA 3M6YA 3BPWA 2G95A 4O28A 2B7QA 1WOBA 3G1DA 1L6YA 1YADA 3TCEA 3TFXA 4NZJA 4XQ6A 1LRTA 2ABAA 3STCA 3RF9A 3A24A 4N6EA 3GKFA 3UZ5A 1WX0A 2ZA2A 3W1QA 4RLIA 2QF7A 2R91A 1R30A 3CWOX 4DPQA 1DVJA 1S5WA 1H7WA 4IPJA 4ZZ9A 2H8XA 4LS2A 4CCDA 4HNVA 1I2PA 1UBSA 4P2VA 2CLOA 3NL6A 1L6WA 2F7FA 4HSNA 3QRHA 2HS6A 3HG3A 1L9WA 3GAKA 1G67A 3FOKA 5AHLA 3EWUA 3MP4A 3O06A 2P10A 3C2OA 4AVFA 1AW1A 3W7GA 3KX6A 4NVTA 4YL2A 3CU2A 1HL2A 5DY2A 3NQ2A 3NQ8A 2JKAA 1I2NA 4I7UA 3LERA 1HO4A 2JBMA 2H90A 3SZ8A 3HG5A 4UMAA 4K39A 2JKEA 3EX2A 4AF0B 2F84A 2C16A 4UTIA 1HG3A 3EB2A 1VLIA 1M6JA 3SR7A 1TPDA 3NPVA 5K7JA 1TYGA 5U4NA 5CSRA 1QFEA 4FNQA 3SSJA 2FJKA 3TQ0A 5HJLA 1GTEA 4NXSA 6ALDA 4LV4A 2Y89A 1MEWA 1X7FA 2WSQA 4DF2A 1JCMP 3GR8A 1EX5A 2WSRA 3FEMA 1TPUA 3MP3A 4RZ4A 4K6AA 1VR6A 4QM1A 5K2ZA 4K7YA 3LTYA 5I3IA 1SFJA 3WK3A 1A5CA 3PR2A 5IBXC 4O53A 2X2GA 4NX0A 3TC6A 4FNPA 4UTWA 3LRMA 1I45A 3W7HA 1AMKA 1YTKA 1I8JA 1IIHA 2CZFA 5K4ZA 1N8FA 3NQ7A 2X1SA 3NYZA 3HQ1A 1ICPA 4C1LA 4M7TA 1W37A 3KVJA 4IQLA 1FX6A 2EF9A 2KZHA 2YGYA 5LNUA 5L6UA 4YLWA 4GUIA 1O60A 3NQCA 3UQNA 2BZNA 3NL2A 4PFMA 1OFQA 3QC3A 2NV1A 2QJGA 5AYZA 3UD6A 3L5AA 1QO5A 2NUXA 4Q33A 4TO8A 5FF0A 4CQAA 4NJHA 3QW4B 4O17A 3S5NA 3TMLA 2VKZG 4FX7A 2VXNA 3MWAA 1LZOA 2NWSA 3W1LA 5HQEA 4Z1CA 4OV4A 1YXCA 1FDJA 1H51A 2O7QA 5LNVA 4XKYA 1DJNA 5BMXA 5BRBA 3W7QA 2CLFA 4GE8A 3FJ6A 3IGUA 3LDVA 4CQ8A 3Q58A 1ME8A 1Q6QA 4NUWA 1DKWA 1G7UA 2ZRVA 2ABBA 2Y7GA 4UFMA 1J5TA 3SJ3A 3L5LA 3ZR4A 1M5WA 4RR4A 1XKYA 1XBZA 4IPIA 4S2CA 3MW7A 1UASA 2Y7EA 1D3HA 3LI0A 3THAA 1OABA 3ZWTA 1SSGA 2ZZ5A 5CZ0A 2VFHA 4XTDA 3S8HA 3LLDA 3ZWSA 1I2QA 2JK2A 3MJYA 4ZQNA 3TA6A 3WK0A 4IMCA 2YZRA 3NQ6A 1Q6OA 1BWLA 4HIBA 1YPIA 5AC7A 1EWEA 3GX9A 4RKAA 4IJBA 4JYFA 1XM3A 4WQ6A 3C6CA 4JY9A 5AHMA 1UUOA 1XUZA 3FKRA 3ZFHA 2OT0A 4JS3A 3GVGA 1KM2A 3LB0A 2DP3A 4UTJA 3JR2A 2VC6A 3A9IA 4K8HA 1FCUA 3IIZA 5DELA 4Z0JA 3YPIA 5CZJA 2CWNA 1W8SA 3TSMA 2GVLA 4QNEA 1QPOA 2RHGA 1TTJA 3NQEA 4HSOA 4JXCA 1PCWA 4MLRA 3W7RA 1EA0A 2WV8A 3BLFA 1RZMA 1JQXA 4LC6A 3M41A 5CPLA 3O63A 3UWQA 3W75A 4K36A 3NNTA 4B5NA 1GZGA 3RU6A 4WY0B 2QCMA 3KVLA 2A85A 2PRMA 3QMSA 4FIQA 5A5WA 2GOUA 2CU0A 3W1PA 2NLIA 2B7PA 2LLEA 1F2JA 4Q4KA 1OFEA 4PODA 3DU0A 4ZQPA 3EKLA 1SU5A 3G24A 3TKFA 1OK6A 3LHTA 2TSYA 3O8AA 5KZDA 4QNWA 3M5VA 2A6LA 4DEFA 4LW7A 4O13A 4MY1A 3B4UA 4LVAA 2H6RA 4FIRA 3DKJA 4RZ6A 4Y90A 3PWAA 2BLEA 5G5IA 3W1MA 4GWEA 1B4KA 1WBHA 1GQNA 1B57A 3VNDA 1FDYA 1QWGA 3TUUA 4FNSA 4R33A 1QO2A 1RQBA 2Y70A 2TPSA 3TW7A 3I6RA 4A22A 1P1XA 1LCOA 1TPC1 1XDLA 3WFAA 5J5DA 3LTPA 2QDGA 1W5PA 5K9CA 1G4SA 1A53A 2VOMA 3P84A 5F1VA 3IIOA 3Q2DA 2R14A 2QCLA 3QW3A 4R53A 3NPWA 4MYAA 5LGXA 2A7NA 1P4CA 2PC4A 3B04A 5E1QA 3O15A 5U7SA 3HO8A 3MI2A 3NQFA 4XTIA 4IMGA 3LHWA 3P60A 5D05A 4E2BA 5D32A 1NVMA 3W2NA 4CQ9A 4JGDA 2QCHA 2A7RA 2DZTA 5C55A 4BWLA 4LUJA 4TIMA 3F4WA 4AWTA 1IXPA 3HGJA 5G2IA 4Z0SA 4MZ8A 3UWWA 4Y9AA 4ZQOA 3W7IA 2CLMA 5DY3A 3GDKA 4O1CA 5HUOA 2X16A 3P62A 3F1QA 5AC8A 3GNDA 1TPB1 5AN7A 2GVJA 3HG2A 2Z2UA 2CLHA 3H53A 4QAIA 3RLUA 1BTMA 3ANYA 1GG0A 3PS7A 5D2XA 2CZDA 4ICNA 3W7PA 3O1NA 2ATSA 3GLCA 4M7SA 7TIMA 3C4UA 4XBSA 1H1YA 3ABQA 3MBDA 2W6RA 4S2BA 1GPWA 1R46A 4IUOA 4M6PA 2RDUA 4FXRA 2YFOA 3LHZA 4JTJA 5D33A 1BWKA 1AW2A 3VKJA 1XC4A 4NU7A 1N7KA 3G3DA 3NGJA 2RH9A 3LHUA 4GFSA 1VGAA 1YYAA 1RR2A 1GT8A 3GR7A 4FNUA 3U2OA 2XN2A 3OG3A 4MJMA 3EWBX 3LXBA 3NQGA 4UMCA 1L2UA 3PB2A 1OFRA 1YXDA 3W2MA 1O5KA 2QCGA 2ZRXA 4LNYA 4AH7A 2VEIA 1VPXA 1SZGA 1O4UA 4AWSA 5T26A 3RNDA 3CB8A 5J5RA 1FDZA 4UTWC 4NT0A 4UUIA 3RLVA 1YLVA 4QITA 2Z1BA 1OX4A 3OA3A 5KINA 4M5PA 1JCYA 1KM1A 4Y6GA 1PCKA 3TXVA 1QNVA 1KV5A 1X8FA 1K7XA 5MHBA 2VEPA 3GZ3A 4O1AA 1TRDA 1AW5A 5BNKA 4NJKA 3O6YX 2X1TA 1XBVA 4AF0A 3LXAA 1VYSX 4RK8A 2CLKA 2QKFA 3LCIA 3MBFA 3FS2A 3HIJA 2OJPA 1C29A 2A2IA 1TMHA 4NQ1A 1LOLA 3W1RA 4OBTA 4A3UA 2VFFA 3VI2A 3TXZA 3DFNA 2WNQA 5CPMA 1SZEA 3I65A 4JTGA 3ABRA 3W1AA 2C18A 4EF8A 1C8VA 1SO4A 3P80A 2C13A 1KTBA 3GNNA 1IGSA 3PY2A 1I4NA 5AHEA 4ZQCA 1A5BA 3W7LA 4NJIA 3GB6A 3NAVA 1VH7A 5LNWA 3LCXA 3M16A 3HPZA 5CG7A 4MYXA 3MP5A 1YTEA 5HR7A 1TPEA 5KZEA 1JCNA 2VFIA 1H7PA 3W76A 3H54A 2C15A 1VHCA 4O4WA 4RCXA 1FWSA 3E02A 2CFFA 3QSRA 3BLIA 4LTSA 3L66A 5F4WA 5FEXA 3T40A 4JX4A 3AO0A 3W6YA 2JKPA 3DBPA 4WY0F 2E6FA 4XZ9A 2E5DA 5DBTA 2ZFAA 3JS3A 1UJPA 4EOUA 3JRKA 1PS9A 2GVGA 1CW2A 4BK9A 4LRSA 3G1YA 4YCOA 1ZJIA 4O8RA 2ZZ6A 5E0KA 5D09A 4O12A 3MHGA 4O15A 3NA8A 1X1ZA 1DL3A 4NNAA 4OWGA 4DF1A 2DJLA 5EKYA 1OHLA 4OE7A 3M47A 2DZXA 1WBJA 1FWNA 5F4SA 2V2HA 1THFD 4QJ1A 3HB9A 3IVTA 2QCDA 1GTHA 4MIMA 2E68A 4N9BA 3P7YA 3LM7A 1U5JA 3SY5A 3USBA 4FNRA 4LVDA 1E51A 4O1DA 3NZ1A 2X30A 2G96A 1FCVA 3IV3A 1W5NA 2C19A 4JTIA 5D2TA 1SSDA 1G7VA 1PVNA 3TQKA 1TPH1 1HO1A 2Y62A 4JIQA 4IWWA 2OZ0A 3KVKA 2ZRWA 1W3NA 2QJIA 2QCNA 3FYPA 6TIMA 4MFEA 1IXOA 4A21A 1EP3A 3LXCA 5BMWA 2PURA 1OK4A 1VRDA 4MJZA 4TMCA 3PBVA 4RX0A 4I9AA 3S1WA 3NL5A 3TFCA 1M7PA 5KITA 1IXNA 3B8DA 4Z1AA 1FQ0A 3PBYA 5DCBA 1W5MA 3S5OA 3K30A 4UR8A 4D2JA 1DBTA 1V5XA 4ADTA 3BG3A 2YSWA 1JULA 3KVMA 1QMLA 1SW7A 2YR1A 3OHIA 4TU1A 4IOTA 3DZ1A 5F2GA 4PEKA 1WYIA 3QM3A 1P5BA 3VE7A 1IXQA 1VZWA 2WOQA 4RZ5A 4MFDA 1TCDA 1OJXA 3UXAA 4AAJA 3LRKA 4UNKA 1W56A 3TROA 2ZYFA 4OHQA 1XDMA 3L2IA 4HPJA 1EEPA 5K3VA 3SGZA 1EP1A 1OG0A 1XCFA 2E6AA 2PRLA 3FKKA 3BV4A 5I3HA 3W2JA 3E9AA 2R8WA 5G2WA 5AHIA 1G4EA 3QMRA 3FA5A 1AG1O 1ZAJA 5F4XA 5I3FA 4MKNA 3CIXA 1RVGA 3GXNA 1TPVA 3I7SA 4JDYA 5F1UA 3M1ZA 4BWLC 5L9FA 4LT9A 3E0IA 3B03A 4UTHA 3C3NA 2V5BA 4QIUA 2H8ZA 4PC8A 4LV9A 3GK0A 1TV5A 1EP2A 3BW2A 1EB3A 2G5WA 3T4CA 5F2MA 3HPSA 3U6WA 3FIGA 4U4MA 3P74A 3G22A 1MXSA 1KA9F 2C0AA 1QPRA 1W1ZA 3C0JA 2G97A 1VYPX 4KWVA 3HG4A 4W9TA 2Q3RA 5HNRA 1K02A 3M7WA 3TAOA 4N02A 2ZZ1A 2NZLA 1QOQA 5ABTA 3HOJA 1SPQA 1OX6A 5FESA 2Y88A 2DZSA 1XBXA 3PF3A 1TV7A 1WXJA 1N55A 4IMFA 4GJ1A 3CT7A 1PE1A 1TQJA 3E49A 3NXFA 3QZEA 1PIIA 3CC1A 1Q6RA 3G1XA 4A29A 4JTKA 1PV8A 1ZHAA 3OVQA 3LCFA 3PSVA 4N9EA 1IF2A 1MO0A 3NQMA 1KFEA 5CPNA 3QMTA 3NVTA 3ABOA 3IGSA 4BF9A 2ZBTA 4U28A 5D04C 3GXPA 3W2KA 2FPTA 4A2SA 1FY6A 1TTQA 3M0ZA 1H7OA 4AXKA 3IIVA 5FEPA 3IEBA 1GVRA 3EX1A 2X1UA 2FLIA 4LOCA 4MUZA 3UY8A 2TYSA 4DO4A 2VELA 3EX6A 4O52A 3NM3A 1GOXA 2A0NA 4YXGA 3EXSA 3W85A 5FEWA 2RFGA 4WXZA 3UY7A 3DHFA 3E96A 5LHEA 3PUDA 1ME9A 3G3MA 1H7NA 3B0PA 3LV5A 5DXXA 1KBIA 4JTFA 3CEUA 3TJXA 3BW4A 1SFLA 1Q45A 3DHDA 1H7RA 4OGZA 1OX5A 3R8RA 5AC6A 3W70A 5HWMA 1JQVA 5I3GA 4AMAA 4LS0A 4ONVA 3W1XA 1K8XA 1KM5A 1LRNA 1NEYA 1UB3A 2X1RA 3ATYA 3LOTA 3I7RA 1KM6A 1LLWA 3W1TA 5CGQA 3G18A 3KHJA 1A5SA 2V5LA 5IM51 3W86A 3NL3A 1GVOA 3TSBA 3IVUA 1DHPA 1TJRA 4IX2A 3PG9A 1W54A 3PBUA 4DO6A 2YW4A 3W73A 1T96A 3W7MA 4LU0A 4FO4A 2ZA1A 1B4EA 2P1FA 3QQ1A 4LC8A 2NXIA 5TQLA 2BXVA 1OFAA 3GDTA 1SO6A 3CEPA 1RD5A 1HUVA 3UWYA 3EEGA 4DO5A 2HS8A 1GJPA 2EGZA 5HWJA 5I3JA 1W0MA 1H5YA 1KW1A 1H7XA 5HWNA 2V30A 2I9EA 3MHUA 3F03K 1YDOA 4M19A 2FB2A 1P0KA 1G4PA 5FEZA 3TH6A 3BO9A 4HNNA 2EAWA 1D3GA 3OEXA 1RQHA 4ZQMA 4UR7A 4EWND 4JX6A 1MZHA 3TU9A 3L0NA 3TAKA 3ABSA 3W7KA 4UNLA 3G1VA 4UMBA 4XKYB 2ZRYA 1TSIA 3GYEA 2ZRUA 1OF8A 4WUIA 3N3MA 1Y0EA 2IQTA 4NX5A 3G8RA 3UWVA 4FX6M 2A21A 1DJQA 1S5TA 2JGQA 1H62A 4NXKA 4NZFA 5HR6A 3DFPA 1W5OA 2CLEA 3EKZA 1KLYA 3HMJG 4O19A 4MPQA 1K03A 4FHAA 4BI5A 3DKLA 1ZAHA 2TMDA 3DAQA 2VFDA 5C6MA 1R47A 2BSLA 3LX9A 1LORA 2RDTA 3U8GA 4A2RA 3TW6A 1F5ZA 4AEOA 4PCFA 1FWRA 3O6CA 4DXVA 2HTMA 2WKJA 1LYXA 4MLJA 4H6KA 3SI9A 1A50A 5CZTA 5G4EA 3VCRA 1T8XA 4GUFA 1QAPA 3CQ0A 1KTCA 1VCGA 1OFDA 3MMTA 2WNNA 3CM4A 4ADUA 5AOUA 5FF2A 2V81A 3LHYA 4L4MA 4N4PA 5KMYA 1QCWA 2GQ8A 4QISA 4H4IA 5EMUA 3QPZA 3QH2A 1NF0A 1TPWA 3EXTA 3S1XA 4H3DA 1TTPA 1PHWA 3ATZA 3L68A 4UC5A 2CW6A 5D37A 5EPDA 3W2LA 3VFLA 1DV7A 1F73A 4N9CA 4OU1A 4UTUA 3M5XA 5A8GA 1WAUA 3LV6A 4WZHA 4O57A 4LVFA 2YYUA 1TB3A 3L65A 1J2WA 3GDMA 2ZA3A 2C6QA 4Z08A 1Q3NA 1GEQA 4LUIA 3W7DA 4K38A 2V82A 2NX9A 4UTMA 1HTIA 3S0CA 2ZZ2A 3BG5A 1GVFA 4LVGA 3M9YA 2FIQA 3QQ0A 1WOAA 1PL9A 3W88A 4CNPA 3TDFA 2AQWA 3VE9A 3PAJA 3UYCA 3PULA 4JYEA 3C2RA 4X2RA 1JR1A 3PSWA 3CLMA 1LOQA 4JTUA 5KSWA 5CKSA 3W9ZA 1KFJA 2FPYA 2JGYA 1H63A 4O0KA 4PL1A 4FEZA 1SO5A 1I2OA 3NPXA 4TX9A 5F2LA 1GVQA 4K7VA 5EBUA 1LBLA 2CLLA 3F4NA 3L5MA 3LCGA 1L6SA 3W7OA 3N14A 1LTDA 1TQXA 3HGRA 3NR0A 3MHFA 4BI7A 4HNTA 3ZS4A 1OFOA 2QR6A 4HPXA 4BR1A 5TIMA 4KWWA 1HFBA 4JEQA 3GXTA 4NNCA 1XL9A 3UZJA 1EUAA 1YTDA 3W2UA 4JTHA 5AYYA 1JVNA 5G4WA 3B05A 1KTNA 3GAYA 1X6UA 1DQWA 1KFCA 3O6DA 4JNMA 2QAPA 4UTTA 4UFLA 1UUMA 2PRHA 1BKSA 1EIXA 1SW0A 1TV8A 3NDOA 1JUBA 3NOEA 1FBAA 2CZEA 2NUWA 1AL7A 3STGA 1R2TA 3EWXA 2C14A 1ZFJA 4MY8A 4CNOA 4EIVA 2XN1A 5LKYA 3BG9A 1Z42A 1LBMA 5D2VA 1UCWA 2QUUA 1VC4A 2Y6ZA 2YX0A 1ZNNA 1QPNA 4I7VA 2ZZ3A 3P81A 4JDBA 2GPTA 4O4VA 4OT7A 3G1FA 3TQVA 3G0XA 3W7NA 3O16A 2Y61A 1S3HA 2QAFA 1BEUA 3T78A 3C2EA 4LVBA 3LLFA 1RV8A 2Y7DA 3A23A 3BGGA 2FB3A 1K8ZA 3S5YA 2RDWA 2AGKA 1VS1A 5LNRA 3R89A 1JUEA 1VCVA 4IMDA 4WOQA 3STFA 4ML9A 4HNUA 3B0UX 3DGRA 3N19B 2YYTA 2DZWA 4O16A 2CZ5A 2EHHA 4GRSA 4AWUA 1G4TA 1SQ7A 5DBUA 1G6CA 3QSTA 4X22A 1H1ZA 2OCZA 1VQTA 3Q94A 2O7SA 2Y85A 2Q8LA 3LI1A 2NUYA 3W22A 1QR7A 3WJSA 5TBOA 5AB3A 3GKAA 5G1YA 3N2XA 3CWNA 2V2DA 4UIOA 3TK7A 5K4XA 4O10A 3P82A 3W23A 4K37A 3L21A 5G2HA 2VFEA 1QOPA 1ML1A 1EWDA 1AK5A 1B3OA 3THQA 1O95A 4LWWA 2PE4A 1OX4B 2UV8G 4L4LA 1SZNA 1LBFA 1FWWA 1F76A 3RK8A 2HMCA 3CIWA 3G1AA 3G8EA 3TNOA 4KKXA 3H55A 4RXGA 3C61A 1F6KA 2BWGA 5EYWA 2DZPA 2E09A 4JN6A 4M6VA 4AHPA 2E77A 1ALDA 1LOSA 4RJEA 1XBYA 2OX1A 3C2VA 4PA8A 4MVAA 1H60A 1ICSA 2QUVA 3P8IA 1JCJA 1OYCA 2Z6JA 4I7WA 3ELFA 3MUXA 3RMJA 3BVJA 2BX7A 3P5YA 3WJYA 3N2MA 1MEIA 4E38A 3P67A 3DI0A 3QJAA 4ZL1A 3N9RA 3UWUA 4KFPA 1QDSA 1YXYA 4AHOA 2ISWA 4ZMGA 4QSHA 2GQ9A 3MYPA 3NO5A 2I14A 3IIXA 5H91A 3GIYA 2A1YA 1C9DA 4O18A 3HPXA 3IGXA 1JCLA 1W3IA 2NWRA 5HINA 4GC4A 1EUNA 4WY0A 1O5XA 3MI6A 1SR9A 1KLZA 3NQAA 2Q8ZA 2GQAA 4WXYA 2ZZ4A 3LRLA 5KTLA 1T0OA 3PC0A 3L67A 4RXFA 3GDRA 2E1DA 3UNDA 4EVZA 3UXDA 3M44A 3W87A 4O1BA 2FFCA 3OVRA 1RQEA 4WJEA 2AAMA 1KBJA 3TR2A 5AFDA 3M5ZA 2NXGA 2NX3A 4IGHA 3HJZA 3CPRA 5CPOA 4ORMA 1GG1A 2BTMA 3V1PA 2NX1A 3PB0A 2V9DA 4YCPA 3TJLA 3TE9A 2VFGA 5EA9A 2RKXA 3W7CA 3CTLA 1I2RA 3TMQA 3DI1A 1JCXA 3S5ZA 4NJGA 3NPUA 2QDHA 2YFNA 2NV2A 1U83A 2VENA 4Z1DA 4DELA 2A6NA 2R94A 3I7QA 1R2RA 1TREA 3QPYA 5FF3A 2Y7FA 4JIPA 2QCFA 4ADSA 2YCEA 1OYAA 4M6QA 4O14A 3T7VA 1LDCA 3BGJA 3MI3A 4Q32A 3BW3A 3L9CA 2E6YA 4P61A 1DQXA 2QCDB 3KFTA 3BK0A 3A5VA 4JR5A 1KM0A 1R2SA 3HGSA 3DFSA 1K7EA 2B0MA 4ZQRA 2DJXA 4FNTA 2CLIA 1T99A 1NAL1 2P0OA 1SZFA 2YXGA 4JX5A 4HT3A 1YDVA 4GNJA 4DBDA 1ADOA 3PM6A 1TO3A 4E2DA 1CI1A 1JJKA 2VEKA 4JTSA 2A5HA 2H3DA 2V8ZA 3IVSA 3N73A 1IIGA 1KM4A 4ORIA 4JY8A 1OF6A 4FF7A 4Y8FA 4PL2A 4DBEA 1JRBA 4RV8A 3NQDA 2B4GA 2GUUA 3QYQA 4QQ3A 3SW6A 5D2YA 1KV8A 3FFSA 4JTTA 3LCWA 4IXHA 3SGUA 3DENA 4UTLA 2QUTA 2Y63A 3R13A 5FI8A 2ZTJA 2PCQA 4UFJA 2ISVA 2E5CA 2J9YA 3C2FA 4NJJA 4FXSA 3PBWA 3S9YA 1DORA 5H2ZA 3KRUA 1XFBA 2D73A 2ATMA 3L0KA 4FX8A 3T44A 1WV2A 1NFBA 1GVSA 1ZENA 1KFBA 5G1TA 1KFKA 3A22A 4YWIA 5AYXA 8TIMA 3GDLA 4PH6A 1RPXA 3N34A 3O05A 3M5YA 3INPA 3EWZA 3PUOA 1LLZA 3V75A 3L0GA 3UWZA 3QFEA 1VLWA 2EKCA 3QF0A 4UTTC 3TV8A 5HULA 3R2GA 4Y96A 1Q6LA 2V2CA 4O11A 3W07A 2I1OA 3EWWA 1MEHA 3SECA 3R12A 3Q37A 3LTSA 4ZVJA 1ME7A 4EF9A 2HSAA 2GJLA 5HUPA 3N9SA 3HBLA 2ZDRA 3TSDA 3G1SA 2W79A 3W1NA 4GXMA 4FB7A 1XUUA 3W7JA 5DN1A 3BLEA 3MYOA 4R7JA 4E0CA 4TMBA 1H61A 3IIPA 1Z48A 4OQVA 3IRDA 1W3TA 4KFNA 3WJZA 5AHFA 1FCBA 1ZALA 3WK2A 4CLMA 1WA3A 1LP6A 3NEVA 1DOSA 4CCEA 1K7FA 2W0UA 4JTLA 3W3OA 3MO7A 3G0UA 1Z41A 4UTKA 2ZQ0A 4LS1A 2WQPA 1SW3A 1H50A 4GUGA 5IBXA 2WNZA 1AL8A 1G69A 2B7NA 2FDSA 4Z1BA 3DFQA 3AJXA 3KAOA 5FF4A 1O94A 1SO3A 5DCEA 4UFKA 3LCLA 3LBCA 3PG8A 4DPPA 5DXYA 4IMEA 1W31A 2FTPA 2OT1A 3WK1A 3I68A 3FLUA 3LCHA 4HN4A 5D2WA 1KM3A 5E93A 4XUGA 3P61A 3EWYA 2A4AA 5LNSA 1LROA 3KXQA 1WQ5A 3C52A 4C1KA 1OFPA 1F7BA 2V0TA 3G0SA 4JICA 1YPFA 3TIMA 1LM1A 1K3UA 4AB4A 4UFIA 2QEZA 3TX9A 1JUKA 4HHPA 1LRQA 4S1FA 1YDNA 3S6DA 2WPBA 4O0ZA 5AHNA 2Z0IA 3W71A 5F2IA 1MSSA 5CSSA 3QEZA 1FXPA 3S1VA 1P0NA 4UFHA 4OV9A 5C54A 1VYRA 1ZY9A 4GBUA 4GUHA 5EY5A 4MOZA 5LHFA 2J24A 4BI6A 3UPWA 5KZMA 2ZZ7A 3EX4A 4KFOA 5C5YA 5LZLA 3W83A 5D38A 3B0VC 5D03A 1GYNA 5BOOA 2B7OA 3KRSA 3NG3A 2ZCGA 2Q3OA 3TC7A 3NM1A 3WJXA 3HF3A 3LGEA 5CZSA 2WO5A 4WOZA 1TJPA 1WDWA 3CHVA 3W84A 3OVPA 2C1HA 1F05A 4XBKA 4NNBA 4J9JA 2TRSA 2YDAA 1W5QA 4N6FA 5K9XA 1NSJA 3P5ZA 3PVFA 2FQIA 4CNNA 1Z44A 5FF7A 2H3BA 5HMSA 3R5EA 2FPVA 3EX3A 2QCEA 5D30A 4JYDA 1GWJA 2DORA 3B06A 1PHQA 1TIMA 1OVDA 5I3KA 3S1UA 3UPBA 3SIZA 3W74A 1TRIA 2QJHA 2WSYA 3A21A 4ALDA 1OYBA 1QPQA 2GJNA 2ISSA 2EPHA 2J88A 1XI3A 2J9XA 1FXQA 1FCQA 2NXHA 4DF0A 2ALDA 4O54A 2DZVA 4R34A 1A5AA 3WJWA 3M43A 4WX2A 5DLCA 4CCCA 2VEMA 1M7OA 4HKPA 5BW6A 3W7EA 1EPXA 4X9SA 4IXXA 1F74A 1VCFA 3LHVA 3A5FA 3OIXA 2J9ZA 3PUEA 3LBMA 3DXIA 4X3ZA 1TPFA 2C3ZA 4MZYA 1TTIA 3NQVA 4TR9A 3NZRA 2YPIA 4N2YA 1JRCA 1XXXA 2ZTKA 4JTEA 2E5BA 1X1OA 4POCA 4UXDA 4LRTA 2DU2A 1B9BA 1OFBA 2DZUA 4JD4A 4UCGA 3D0CA 3P8JA 4N4QA 1CX9A 5LGZA 3RFAA 1VJIA 3EXRA 1ZAIA 3HGOA 3C8FA 4PTNA 4WD0A 2XN0A 1J4EA 4LY8A 1S5VA 2OMAA 4YMZA 3DFTA 3FYOA 4BFAA 3W72A 5EL1A 3KOFA 2QCCA 2A7PA 5LSMA 2YW3A 5SWUA 1V7YA 1K8YA 1ONRA 1NF7A 3DH7A 4G1KA 1VHNA 5K9DA 3KRZA 1ICQA 2WJZA 1FWTA 5GVJA 3O07A 4N9DA 4AHQA 1FUYA 1KFLA 1ZCOA 1F6PA 3E12A 4DQWA 3C56A 3OBKA 5D02A 4XWUA 4IX0A 5DCDA 3BARA 3SFKA 1SUXA
chains in the Genus database with same CATH superfamily
2OQHA 2O4QA 1OD0A 4QS6A 2ZXDA 1GYLA 3DFOA 1NQKA 2E6DA 3FSTA 2XFWA 4NP7A 3FJLA 4UBPC 4P5UA 1VRXA 3FK4A 1GHSA 5C2XA 4O28A 1L6YA 3HMCA 4NZJA 1LRTA 2XUCA 4I8DA 3RF9A 3QR3A 3GKFA 1XF0A 3BUVA 4DPQA 3CWOX 3V7PA 3VIIA 5CLWA 3TP4A 3AS3A 1XRVA 5HXMA 4C5ZA 4H19A 3QR1A 4GH3A 1BXCA 1CLKA 1JD7A 4P2VA 2F7FA 1B31A 2J7GA 3GAKA 2Z2AA 3FOKA 3RPTA 5LXEA 2OTDA 3O06A 1T8QA 2P10A 2WCSA 3C2OA 1AW1A 5GJNA 3W7GA 3VGGA 4ATDA 2W91A 5DY2A 3IJ7A 1BSIA 3NQ2A 1MDLA 3NQ8A 2JKAA 3NQBA 2H90A 2VUYA 3HG5A 6PTDA 4UMAA 4K39A 3R8HA 3EX2A 3PTDA 2F84A 1VBRA 1DE5A 2C16A 1VLIA 2INEA 3BL3A 1CXIA 1TYGA 1TVPA 5DT5A 4NYYA 2J78A 1GTEA 4NXSA 6ALDA 3ES8A 1X7FA 2W3ZA 4DF2A 4B4HA 2O0TA 1MW3A 4RZ4A 4K6AA 1BPLB 1H0GA 5K2ZA 3MS8A 5FKYA 4K7YA 1SJCA 5I3IA 3WK3A 4NX0A 4UTWA 1I45A 4WSJA 2CZFA 3PZ9A 3NQ7A 4GIYA 4GINA 1UR4A 3NYZA 4YVVA 4D9PA 2F9RA 4M7TA 1EGVA 1W37A 1C7SA 3SCTA 5LNUA 2H9AA 4YLWA 1TMQA 3OU8A 3NQCA 3T0DA 2NQLA 2V3GA 3HQPA 2QJGA 4GIEA 2V69A 2E28A 3UD6A 3UCDA 1O66A 3PJUA 4XBJA 1QO5A 2NUXA 4Q33A 4AFYA 5FF0A 4W5ZA 4X63A 3AMKA 4FXFA 3TMLA 4FX7A 2V68A 1JAEA 4TTGA 3MWAA 4W89A 5B7ZA 3SY8A 2EJ1A 4DJEA 3W1LA 1VP5A 2FKPA 4CN4A 3KBWA 1TZZA 4RUBA 3NZPA 4CQ8A 2YCLA 4KCUA 5IFPA 1J5TA 1XIJA 4H6QA 1M5WA 1OIMA 3N04A 1D3HA 1EDGA 1UWAA 3THAA 4QDPA 5AC5A 1F6YA 4GPNA 1BQCA 2VFHA 3VABA 3S8HA 1SVDA 3LSCA 3TA6A 3WK0A 1NWTA 4HMEA 4DYJA 1DIEA 4LPCA 1J0HA 5ENLA 1V02A 4RKAA 1IZJA 4PRWA 3BQ5A 5AHMA 3FKRA 2D20A 2E4TA 3GVGA 2QV4A 3U9IA 1KM2A 3LB0A 4ZOAA 4UTJA 2Q09A 4EP8C 4KGJA 1PSCA 1CYGA 1DWJM 4B5VA 4HA1A 3EDEA 1R3YA 1X6LA 2GVYA 4NZ5A 3TSMA 2OGJA 2HVOA 4HSOA 1PCWA 1A3WA 4ZTYA 3GXIA 3WFLA 2VC5A 3VOJA 1JQXA 4LC6A 4JIHA 5DO8A 3UWQA 3W75A 2I57A 5CJNA 5A6TC 2PDMA 1UH3A 2J8TA 5CC6A 9XIAA 3AI0A 1PYMA 3ZVIA 1V0LA 4ERAA 2OELA 2CU0A 4O8AA 2IKHA 2B7PA 1V6UA 4S3DA 4RE4A 8A3HA 1OFEA 2QV5A 3EKLA 1SU5A 2X7VA 4K1GA 4UQCA 4Z2JA 1OK6A 1JYWA 2TSYA 3O8AA 3AC0A 3M5VA 3BANA 1CXKA 4DEFA 2E9LA 4O13A 4PUDA 3AMLA 3KWSA 4Q4PA 3PWAA 4Y90A 5G5IA 3W1MA 3UF9A 4MB1A 1ZTVA 4H9TA 1CCWB 3NIYA 3PP7A 4CU8A 2VZUA 1B57A 3VNDA 1QWGA 4J28A 1BTCA 3TTEA 1TG7A 2TPSA 3TW7A 3WFAA 3EEZA 5JVLA 5CH9A 4D6IA 1XIHA 1TIWA 1A53A 1YIXA 4LGXA 4PUJA 3Q2DA 4I9TA 3QW3A 2A7NA 1P4CA 2PC4A 3WL0A 3TEVA 3UG5A 3KE0A 3HO8A 4LXFA 2AMXA 1JD9A 4WDUA 3E1F1 4M82A 2HV5A 1J2BA 3HTWA 2YL8A 4CQ9A 3S2MA 2QCHA 2DZTA 4BWLA 3IJQA 2PEVA 1IXPA 4TVDA 5G2IA 1A49A 2PGWA 2P88A 4Y9AA 1LL4A 1EA9C 2HZGA 4ZQOA 3W7IA 1ZBWA 3MZ2A 1VBJA 2G3NA 1BAGA 2AGTA 3F1QA 1TPB1 4A8RA 2GVJA 2BNJA 3HG2A 1A3XA 1ZSXA 5D2XA 2QIIA 2CZDA 2BVWA 2PGEA 4CKQA 1RBOB 3SURA 1J8VA 1YBQA 4B5TA 7TIMA 4H6RA 3ABQA 4B9YA 4ERGA 3MMDA 1GPWA 4M6PA 4FXRA 5CXPA 5IRPA 2YCIX 3I3BA 1XC4A 2DPEA 1N7KA 1ZJHA 3H22A 4G7FA 3FXGA 3V18A 3GR7A 3U2OA 2XN2A 1V7AA 3VTRA 3SUUA 1L2UA 2ZRXA 2GWGA 3AYRA 1MVYA 1UP2A 3RNDA 1OWQA 4CVWA 1TWSA 4HQVA 5JMUA 1YLVA 4QITA 3K4AA 3HN3A 2W4XA 3U2CA 1U30A 3FA3A 1P0BA 2J79A 1PCKA 2YDQA 4GYJA 2PWVA 3GZ3A 1ISVA 3KCLA 2YLAA 3TZFA 4HU4A 3O6YX 1YE4A 5E0FA 2X1TA 4RK8A 3ZXWA 3MANA 3LCIA 2DT2A 4XKMA 3HIJA 3EOLA 1PZ2A 1A4MA 3W1RA 3QOMA 3VI2A 3GNXA 2WNQA 3MDWA 4IG2A 1UH2A 4EPBC 3WQ5A 1TVLA 3LPOA 4Z2LA 1C8VA 1SO4A 4LB4A 3PY2A 3NXLA 5AHEA 2WCGA 4ZQCA 4L6HA 3W7LA 1D7KA 3GB6A 4KPLA 4F0SA 5ABEA 3M16A 3ZLGA 4UR9A 5A6SA 2ADAA 4I9JA 2CKRA 4WKFA 4LB3A 2X0YA 4C6EA 1YTEA 4HOXA 4E2OA 1JCNA 5KZEA 3VNMA 1E4NA 3H54A 1VHCA 1AMYA 5D8ZA 3UG3A 2CFFA 1US2A 3QOKA 4AVNA 2ACRA 3EA2A 4JIIX 3COTA 4K68A 2E5DA 3A4JA 3O6AA 1CGVA 4EANA 3VUSA 3MU7A 3KOXA 1W8GA 2GVEA 1Q6DA 3GQYA 4YCOA 4IIBA 1S2VA 4O12A 1K4GA 4O15A 3OZYA 3P0XA 3SCOA 3T2QA 4OWGA 2DJLA 3AHZA 3GSMA 3H7RA 1THFD 4QJ1A 2HE8A 3HB9A 4E8CA 3G6LA 4MIMA 3RMEA 4LH8A 4TXEA 3LM7A 2EO7A 4ILSA 1P43A 1XH1A 4O1DA 3BLPX 1FCVA 2XU2A 3IV3A 5D2TA 1YEYA 4REQA 1S2CA 4ZENA 3WBYA 5BOEA 4YTQA 3VIPA 3PPGA 1W3NA 2QJIA 1M01A 2QDEA 1UWSA 4JIRA 4LF2A 4M3PA 1ZB5A 3CL6A 3LXCA 2EG7A 5LIUX 2XWEA 1G0CA 1Q66A 1VRDA 1MQPA 4HPGA 4MJZA 2PDCA 1X38A 3OLIA 4I9AA 3R7MA 3S1WA 5D9MA 3E3HA 1IXNA 3B8DA 3BSGA 5HA7A 3BG3A 2VD9A 4CEUC 1E4IA 4L80A 3OHIA 4IOTA 3UFYA 3DCPA 3M46A 4PEKA 3WDRA 3QM3A 1VIZA 1P5BA 2ZKMX 3BC9A 1VZWA 3ZT7A 4XAGA 4M1BA 4MAVA 1M04A 3E0WA 1I1WA 7ODCA 2ZYFA 4OHQA 4HN8A 2J8GA 4CD4A 1NIUA 3BOXA 1EEPA 5K3VA 1EP1A 4WK9A 2GUBA 2E6AA 1NWSA 1WNOA 1V3JA 3FKKA 1KNWA 1GKQA 1B3ZA 3E9AA 2X42A 5AHIA 2OPJA 4IM4A 3FA5A 1ZAJA 3GHTA 5I3FA 1RA5A 3M1ZA 5L9FA 4AIOA 4LT9A 3NZGA 3DYOA 4LV9A 3U3HA 1OCBA 1TV5A 1EP2A 1DTUA 2J77A 4GYPC 1KR1A 4U4MA 3P74A 1P0DA 5BWFA 3F5LA 4E6MA 1MXSA 1KA9F 3DUGA 2C0AA 1AJ0A 5EGRA 3A13A 2G97A 1SFTA 2GJXA 1PYFA 3BICA 1QOXA 1K02A 1R9YA 1OINA 4DJDC 2WC3A 3HOJA 1M65A 2GGIA 2Y88A 1LT8A 3PF3A 5DEZA 1CGXA 2VZOA 1GVYA 4HZ8A 3RN6A 3T8LA 3CT7A 1TQJA 3E49A 1R9XA 3R8GA 3WBEA 4JPGA 4GX9A 5EU9A 4NYUA 2QJMA 3LK6A 1IF2A 1WDPA 4DN1A 1TX0A 1GOWA 2VRQA 5TAOA 3NVTA 1VFTA 5CLTA 3GW3A 3UR2A 4DY1A 1JYNA 2VRJA 1F07A 3W2KA 2XH2A 2FPTA 3M0ZA 4L9ZA 1H7OA 5FEPA 3IEBA 4TV5A 2X1UA 1XLDA 4LOCA 4PMQA 3BXWA 3ZIZA 2I17A 1OG6A 3EPNA 4XISA 1TV4A 3QTGA 3SQMA 4DO4A 3EA3A 3SRHA 2VELA 4JL2A 1Z6KA 2XPKA 3NM3A 3U2EA 1GOXA 2A0NA 4IIDA 4QQUA 1H4PA 1DTNA 5FEWA 2FVMA 1HX0A 3SRFA 1WKYA 1H7NA 3B0PA 3W0KA 4A3YA 4HP5A 5DXXA 1SFLA 3P0WA 1IEQA 2R1LA 2QJNA 4JQ4A 1KC7A 3DHDA 3BMXA 5AC6A 3TW9A 3KBNA 4ONVA 3LN3A 1LRNA 1I60A 2J13A 2X1RA 3I7RA 4F4RA 1KM6A 3VNZA 1JFXA 3D3FA 3W1TA 4IFKB 3RPDA 3THCA 5CGQA 4D6CA 4KQNA 2F2HA 2PU1A 5IM51 5AYBA 1FHDA 1Q63A 3NL3A 4J2MA 4TOQA 4UZSA 2ISFA 4H9UA 4JTAA 3TZNA 4DO6A 1WZLA 3W7MA 4V2XA 2ZA1A 2XFYA 2NXIA 4J40A 4QFUA 1OFAA 1TWWA 3KS6A 4R3UA 3EPMA 5I3JA 4IFRA 1KW1A 1H7XA 4AZ7A 1A5KC 1CXHA 4PFHA 4UOZA 4US5D 2FB2A 1R9ZA 2W5FA 5HBFA 5FEZA 2CIPA 4A35A 2YL5A 1Q5MA 3PANA 3BO9A 2ZDSA 1XIDA 2DVXA 4EAMA 1D3GA 3OEXA 1RQHA 3AQUA 1XPYA 4XAFA 4PTWA 3TAKA 3W7KA 2PDQA 4UMBA 4HCDA 2ZRYA 2X05A 2ZRUA 3N3MA 1Y0EA 4GO8A 4NX5A 4FX6M 1UKSA 2OWCA 1UPMB 4NZFA 4OECA 1S5TA 1H62A 1MW2A 5BZAA 4AY8A 2CLEA 1KLYA 3HMJG 3TLLA 4MPQA 1K03A 4FHAA 4QLJA 1ZAHA 4AZCB 4IGNA 2VFDA 2RDTA 3TW6A 3KUMA 3QKEA 1E9YB 4AEOA 2QDDA 3VIGA 5HAOA 3NYDA 2HTMA 2P50A 1IT0A 5E09A 1EKOA 5A8MA 1A50A 5CZTA 5G4EA 2WJEA 4AMCA 1T8XA 2BY2A 1E0VA 5XIAA 2DFAA 1KTCA 2WVUA 1VCGA 1UH4A 3VKDA 1A3HA 3FDGA 4ADUA 3GG0A 2PC8A 2RAGA 1DWHM 4L4MA 4N4PA 4JCMA 5KMYA 4INFA 2XINA 3QH2A 1TPWA 2XSBA 1UR8A 1IV8A 5DT7A 3ATZA 1W1PA 4DWDA 1DV7A 4U5KA 1XIMA 3UZWA 4TQTA 3SUTA 4Z2KA 3STPA 3N3TA 4FOKA 4Z08A 1TELA 2VHLA 4K38A 3MKCA 4MHBA 3K8MA 1PKLA 3WG6A 3R43A 2WMJA 3M9YA 1R3WA 2QF8A 1JNDA 3PULA 3C2RA 1I0DA 5CKSA 1M7JA 3R10A 1KFJA 3ITYA 1H63A 4O0KA 4M6UA 1XLLA 5ABHA 4TX9A 1GVQA 4WRHA 3NURA 3R25A 3LCGA 3N14A 1TQXA 3MHFA 4M1RA 3VIOA 3ZS4A 2QR6A 4BR1A 2OO0A 2FGZA 2OWXA 3WQGA 2YLLA 5E9XA 5AYYA 3TOPA 4PTVA 3WO8A 3B05A 3SRDA 4FAMA 5HNNA 2ZUSA 4OUIA 3O6DA 1BKHA 1A0CA 1BKSA 1SW0A 3GUGA 4YYCA 1B90A 2PGFA 1FH7A 4BCEA 4KWOA 4CNOA 2VR5A 2RJHA 4AU0A 5FSEC 4HZMA 3DG3A 1F3TA 1LBMA 3OYXA 2TAAA 1SMDA 4UQBA 4OT7A 3FDKA 3PBMA 1KBBA 1EJSC 2VJXA 2VL4A 4LAOA 5I07A 5E5CA 3W7NA 5DQPA 5FJIA 2YZ5A 3G5EA 4L64A 2QAFA 2OU4A 1XLJA 1AUSL 1G5AA 2D2OA 4G1NA 2Y7DA 3A23A 2O55A 3IS4A 3BGGA 4ZOEA 3IWPA 2WVTA 1Z3NA 4WOQA 1XS2A 3STFA 4ML9A 4QCEA 3B0UX 1EC7A 3LSBA 3N19B 2PDHA 1TX2A 2DZWA 4UZUA 1G6CA 3CO8A 3QPEA 4GVHA 3FA4A 4MM1A 2IPWA 1VPQA 2OCZA 3Q94A 2PDIA 2O7SA 3WDPP 3LI1A 4H8VA 3RUBL 4XB3A 1QI4A 3GKAA 3N2XA 2BG5A 3H12A 2ON3A 3BV7A 2WLYA 2VFEA 3KBMA 2XTKA 2Y1HA 1QWKA 4LWWA 5JQ9A 2PE4A 2UV8G 1SZNA 1LBFA 4WSKA 1FWWA 3RK8A 4D6GA 3I6TA 3NSNA 3G8EA 4FZIA 1HKMA 5I23A 2GWNA 1F6KA 4JN6A 2CKSA 1LOSA 1UD2A 3V35A 4MVAA 1ICSA 3WDIA 1KCKA 5JXQA 2OZ8A 3NJ3A 3G77A 1DJYA 2J7BA 4GNVA 4GFIA 4PBFA 3H21A 3RM9A 3UWUA 5H6HA 2X0SA 1QDSA 1FWDC 1YXYA 2ISWA 3EMCA 2GQ9A 5DX7A 4LYRA 2HWGA 3IIXA 5H91A 3PZVA 3O7UA 2P8CA 4O18A 5I3DA 1FTXA 4GC4A 4MWAA 1EUNA 5M03A 1SR9A 3T9PA 2CYGA 4WXYA 5KTLA 4RXFA 1UZDA 3UNDA 4J27A 1ADSA 2PTZA 3W87A 2IS7A 1BVZA 1QW8A 4C1NA 4JL1A 5JU6A 3WQCA 1RQEA 3GHRA 1ONEA 3NEHA 4FALA 3GWQA 1DE6A 5EMYA 3THDA 5I77A 3M5ZA 4IGHA 1OEPA 3R58A 1PKMA 1HXJA 4H8HA 1V51A 2O92A 3WEMA 3WNNA 2R1MA 4YCPA 3CL8A 1XIIA 3GTNA 4B3KA 1WKDA 4GY7A 5M17A 3H23A 5G4HC 3NPUA 4DELA 4F0KA 4ZXOA 1TREA 1GK8A 3QPYA 5JBDA 2ZWYA 3AISA 3WF0A 3EAUA 4HSHA 3AICA 4ADSA 1LUCB 5FACA 4XIAA 3M0MA 4IPPA 9RUBA 1KCZA 2E6YA 5BRPA 2QCDB 3KFTA 4FSAA 1KM0A 1R2SA 4WDXA 1VJZA 3LEPA 3DFSA 1WKFA 1JDAA 4S23A 4GK8A 3VM5A 4DBDA 2DQXA 1TO3A 4KEVA 3L4WA 3ARXA 2RJGA 3G2GA 3OGRA 2BODX 1IIGA 3WLOA 2Z1XA 4J3WA 2VZTA 4HZ6A 5C9WA 4JAWA 4RV8A 4OJYA 4WKHA 2B4GA 3QYQA 4QQ3A 4G5DA 1KV8A 3MUAA 5I78A 7REQB 3CXOA 4QDMA 4UTLA 1VIWA 1TE6A 1R85A 2ZTJA 2P3ZA 2ISVA 1P7TB 2W67A 3CZ8A 4QE4A 4M56A 3S9YA 2QXWA 2Y5SA 3I6EA 3KRUA 1NOUA 1XFBA 4FR1A 3E38A 5DF0A 4FLQA 4FP1A 3TVAA 1ZENA 3A22A 2CHOA 1EQPA 2XHYA 3ID7A 2HDJA 4PH6A 2ZUWA 3EWZA 3KL0A 3P93A 4GVGA 3PAOA 1LJYA 1V79A 3JUGA 4EWJA 1XH0A 4BEQA 3WIJA 1ME7A 4WGHA 3N9SA 4ZGYA 3VNJA 3I3EA 2W79A 1UA3A 3PJTA 2D0FA 4FB7A 1WXYA 1NARA 5LA0A 4R7JA 4E0CA 1H61A 5I06A 1V4YA 2PLJA 1RA0A 4XZNX 1B1YA 5AHFA 1ZALA 1T40A 1WA3A 1LP6A 4CCEA 4GGHA 2VQTA 3W3OA 2QYGA 4U5IA 2V5DA 3MO7A 4GCAA 3G0UA 1Z41A 3MKVA 4LS1A 3CQIA 2YBUA 4GUGA 4R5EA 4DZAA 5AECA 4YS1A 2B7NA 2FDSA 3KAOA 4V1XA 1SO3A 1E0TA 4PSPA 5HQLA 4NF7A 2RUSA 4DBSA 1ADDA 4DPPA 3PWGA 1EDTA 3FLUA 5D2WA 1EF2A 5DMMA 4XUGA 4KEMA 4MB4A 1ZJBA 5GNYA 1VPYA 1OFPA 1F7BA 3UU0A 1JNEA 3TIMA 1LM1A 1BG4A 2O9RA 5HMDA 1QI5A 1V6YA 3BAWA 3TX9A 4HHPA 4S1FA 3L12A 3S6DA 4Q7BA 2WPBA 4O0ZA 1VD6A 4QLLA 3W71A 1MSSA 4OOUA 3T0AA 4UFHA 1Z7AA 1ZY9A 1N2VA 4PYSA 2G8ZA 1HGYA 2NQZA 4RPQA 3KP1A 4MOZA 5CSUA 3W29A 3ITTA 1QI3A 1KXTA 1CBGA 1W1YA 2HROA 3N4FA 2ZZ7A 2ZUVA 4KFOA 2J7EA 2PWEA 2UBPC 3N1AA 5HNTA 3LBOA 5D38A 4FLSA 4J7RA 1GYNA 4Q8WA 2XISA 2J8FA 4EXAA 3KRSA 3CUZA 4YYFA 4Q8OA 3VKKA 3OOQA 4W88A 2Q3OA 4MF4A 4C91A 2WJFA 2XVNA 1PZ3A 5EFDA 2WO5A 2INFA 5LXXA 4JHMA 4I6KA 4MGGA 1C90A 4XBKA 4DWSB 2R1NA 3QXBA 4XD3A 3UJ2A 3PVFA 1Z44A 5FF7A 5BU6A 1XJBA 2FPVA 3EX3A 2FHBA 2QCEA 4JYDA 3A47A 2DORA 4H7VA 1S2WA 4DI9A 3VD9A 1Q7ZA 2WSYA 4FI4A 1QPQA 2FZ8A 3OW1A 3CV1A 4DF0A 2NXHA 3GG8A 4XZHA 1JFHA 3WJWA 3K4DA 5M2FX 4WX2A 1JZ7A 3F2DA 2FZ9A 4HMNA 1EPXA 3ZSTA 2OOGA 1VCFA 3LHVA 1S2AA 3PUEA 4X3ZA 3NQVA 3B97A 1JRCA 3ZZ1A 1XXXA 4X0VA 4POCA 2QW5A 4PMVA 4UXDA 5AZ1A 4LNCA 4X2PA 1TR1A 1FKXA 3LM3A 1EQCA 4PMYA 5CPQA 4GH1A 3WUEA 5LGZA 3XISA 3BJSA 2Z1VA 4UQAA 3USZA 2QMKA 2XN0A 1J4EA 3POHA 1S5VA 4MNKA 1B3YA 4AC7C 1GOQA 1DYSA 3KOFA 2QCCA 4AX6A 3DGBA 5I03A 4NG3A 2F6KA 5EB8A 5T9BG 3DH7A 5JIPA 4Z2GA 3P6LA 5C9RA 3BCJA 5GVJA 3DFYA 3WBXA 4N9DA 4DWSD 1KFLA 1F6PA 4XAYA 4DXXA 1XP3A 2CETA 4IX0A 3SFKA 1D9EA 4GUJA 4K8EA 2YB1A 3RLGA 2Q01A 2RGMA 4H7ZA 1TJ2A 1LUCA 2J6XA 3T55A 2CBIA 2NV9A 1TZ9A 4O50A 2J27A 2OXNA 3BPWA 2B7QA 1WOBA 4IGSA 1S5MA 1XYMA 3STCA 4N6EA 1UA7A 3UZ5A 2YJQA 3D6NA 2PP0A 4X61A 3AALA 4EPEC 4N7QA 4Z2HA 1AZ1A 4CCDA 4CEXC 3WQOA 1R3QA 4MUPA 1F3XA 5XIMA 2JFEX 3NL6A 4KW2A 3LG3A 1WE5A 3QRHA 3HG3A 1L9WA 3IJ6A 1G67A 4ES4A 1HW6A 3VMNA 1P48A 3KX6A 4NVTA 4AZ5A 3DDMA 1MI3A 3CU2A 1I2NA 2WLZA 3WLRA 1HO4A 2JBMA 3RDKA 7REQA 3W28A 4E2VA 2JKEA 1HG3A 1CXLA 3ARYA 3W6LA 3L4TA 1HJSA 5K7JA 3T1GA 1H1NA 2Y89A 3VKCA 1MEWA 3AMDA 4HTBA 2WSQA 1JCMP 3WQEA 4B90A 3FEMA 3MP3A 4H9ZA 3WUFA 1MWOA 5A6JA 3FEQA 4QM1A 1E6XM 3MY9A 1R3TA 3LTYA 4L56A 5GNXA 1XYBA 5IBXC 4O53A 2X2GA 4FNPA 2D0HA 1ZU8A 3W7HA 2PDPA 1OC7A 1I8JA 2WPGA 2D1ZA 1YQ2A 5CPTA 1N8FA 3SEPA 4LANA 4C1LA 2GUYA 1GEHA 3S83A 3KVJA 2YGYA 1O60A 3FVMA 5A6BD 2BZNA 4EK7A 3NL2A 4IPNB 1FWCC 3VDHA 1OFQA 1QI2A 3QC3A 4MSSA 5T8GA 3RM8A 3L5AA 4RZBA 2BY0A 3FY1A 1NOWA 4LUSA 4NJHA 5LA1A 3M4HA 1S1RA 3QW4B 3S5NA 4GZIA 1W9DM 5H8MA 1LZOA 2WMHA 2AQOA 2Z28A 1W9PA 1VEOA 5E6YA 1EO5A 3WF4A 3SCUA 2FZNA 3E5BA 3W7QA 3CS2A 3FJ6A 3ARRA 3GYCA 2R9RA 5D8WA 5HJYA 4NUWA 4BA0A 2ZRVA 1YHTA 2ABBA 4QROA 3OG2A 4QGCA 3ZR4A 3V16A 3QHOA 2AOSA 2PA6A 5CCZA 3MB9A 2G4JA 3DYMA 1SSGA 2ZZ5A 1SYTA 1DXEA 4J35A 3ZWSA 1I2QA 2E67A 1M3UA 1RAKA 3KS5A 2PFHA 4GOAA 4IMCA 2YZRA 4HIBA 1REQB 4CNUA 4R9OA 1EWEA 4JYFA 1XM3A 3C6CA 3GTXA 4JY9A 4YJ5A 3BQ6A 1XGZA 4JS3A 2OSWA 2VUNA 4GZEA 4QLKA 2J47A 1XLIA 1GOIA 3FX4A 1XYZA 4F2TA 3EKGA 3JR2A 2VC6A 3T2PA 3A9IA 4L65A 4K8HA 3M07A 2EEXA 4KRZA 2PWHA 1XWYA 2HK0A 1J0IA 2ZUNA 3WLHA 4PN2A 2GVLA 1EYEA 1QPOA 2RHGA 1TTJA 4MLRA 3CUJA 4Y9PA 4QSFA 3WMSA 1RZMA 2J7FA 3B3DA 2GSEA 3M41A 3CPUA 5CPLA 3NNTA 4DWSA 1LQ2A 3RU6A 2PRMA 5A5WA 4EPKA 3QGKC 4H00A 4CQBA 3W1PA 1C8XA 1CLVA 3TYAA 1R3VA 1F8IA 1KXVA 3RGTA 3TKFA 1CGYA 1P6CA 3RXZA 2CBJA 2DDXA 2VDHA 3GHUA 2A6LA 4LBUA 4ZO8A 1UC4A 3TYZA 1J9YA 4LVAA 4JFSA 1I1XA 5HMEA 4FPSA 2Z29A 3AIQA 3HPFA 1GQNA 4EXQA 4K8GA 1FDYA 3TUUA 5HQMA 2WZTA 1QO2A 2OEJA 1M1BA 2Y70A 4A22A 3I6RA 1LCOA 5J5DA 3WNKA 1W5PA 2DT3A 3JZUA 5K9CA 3N25A 3C8NA 2VOMA 3P84A 2Z26A 5I02A 5F1VA 3IIOA 1Q2RA 1FHVA 2QCLA 4CCZA 1KRMA 3NPWA 4KWSA 1DJXA 5DRCA 3RX3A 3EDKA 3MI2A 4IMGA 4CU7A 1OCQA 3LHWA 2MUCA 5D32A 4KF1A 3WQ6A 3W2NA 4M24A 3TCSA 1EC9A 2A7RA 2D3LA 1O1HA 4GQQA 3VDAA 5BXTA 1HL9A 3AJ7A 2CLMA 3A3HA 5DY3A 3VIHA 5HUOA 4ACYA 5CAHA 1P6WA 2OYMA 5AN7A 4ML4A 3E0VA 1NP2A 2QS8A 1SM9A 8RUCA 4J3UA 2NVDA 3H53A 3VZYA 3RLUA 1BTMA 1GG0A 5IHSA 4H9YA 3TYEA 1A0DA 4XX6A 3W25A 5TF0A 3QFWA 4GJIA 4G8TA 4M7SA 4PR4A 1W9XA 4AIEA 3MBDA 3MUIA 1R46A 3OIHA 4IUOA 5IDZA 5D33A 2YFOA 2L5HA 2PDJA 3LHZA 3C3UA 4KS0A 5HPOA 3W82A 4NU7A 6TAAA 4ZSUA 1Y5XA 3M0IA 4W4QA 1JDCA 3W37A 2PPGA 1HP5A 1RLCL 5A6BA 4FNUA 3OG3A 4MJMA 2A3LA 3PZGA 3V0UA 3NQGA 3PB2A 1OFRA 1YXDA 4F0LA 1O5KA 2QCGA 1Y5WA 4AH7A 4IFOA 3U2ZA 4HPHA 1AA1B 1O4UA 3TR9A 3H2NA 3ITOA 4AWSA 1QHZA 5T26A 1FDZA 4UTWC 3RLVA 4QS5A 3OO2A 5CAKA 3VNLA 2VC9A 3HFTA 1FRBA 3M64A 4Y6GA 1KRAC 4XUYA 3TXVA 3NFUA 1X8FA 2AKZA 4IUGA 1K7XA 5MHBA 3PZOA 3CZGA 2VEPA 3FHQA 1TRDA 3OZOA 5ECVA 3K4WA 1AD4A 3KLKA 5C8BB 5CG0A 3WBAA 4B15A 2OZ3A 2P8BA 3FCPA 3EB3A 2WKGA 2PS2A 3R11A 1HZYA 2VCBA 1EGMA 2EPKX 4A3UA 3OB8A 4XZWA 4QRNA 5AVNA 1QBBA 4DJEC 3I65A 4JTGA 3ABRA 5MKGB 4LYKA 2C18A 5IFTA 2YIHA 3GBDA 2GJPA 3GVVA 2C13A 1KTBA 2ZE3A 2YKKA 4HNCA 1BFNA 1VH7A 4AC1X 1S5NA 3HPZA 3AZRA 3GS6A 4TTUA 2PTWA 1Q13A 3NO1A 1TPEA 1EXPA 3W76A 4O4WA 1U2YA 3QSRA 3XIMA 4KCTA 3EDJA 4B92A 2C1IA 2GGGA 4WY0F 4DYEA 1IZCA 2EJAA 1X1NA 4TVCA 3JS3A 5FOOA 2GK1A 2GVGA 1CW2A 4D1JA 3RJXA 3AS2A 2GGHA 1NFPA 4Y2WA 2PDWA 2D69A 4LRSA 4PMZA 5CGTA 3G1YA 4GQRA 1W3KA 2ZZ6A 4OVXA 2QHAA 4KIRA 3MHGA 1TWZA 4KRUA 4LCRA 1UR2A 1DL3A 1J0KA 1OHLA 4OE7A 1MXDA 1K6AA 1WBJA 4HYVA 5F4SA 2JIWA 4PTMA 5FJJA 3UCCA 1GTHA 1FVPA 3VDBA 3APGA 1K77A 4DUWA 1XRTA 3SY5A 3USBA 1E6SM 1WZKA 4FNRA 3WD0A 1E51A 2X30A 2C19A 3E5PA 3ZLFA 3TQKA 1OGGA 4HPNA 3GU2A 1XD1A 4JHZA 4J4KA 1T41A 2OZ0A 2PWFA 2ZRWA 3R79A 4KT2A 2QCNA 6TIMA 1RY8A 1UC5A 3MT1A 2WZEA 4Y8EA 4A21A 1PKNA 4ACZB 1GQJA 2UY3A 4DZHA 3MCMA 4TMCA 3PBVA 4KETA 3NL5A 1VEPA 5KITA 4Z1AA 1FQ0A 1W5MA 2VX4A 3I4KA 1RP8A 1BWVA 1LWJA 3OLDA 4ADTA 1JULA 1XLGA 1EBHA 4GO9A 5GNZA 3WEOA 2YR1A 5HNUA 4HNLA 1PBGA 3WLJA 1WYIA 3VE7A 1CB2A 2WNWA 1X8CA 2WOQA 4RZ5A 4MFDA 2VM8A 4OFCA 1YNQA 1WUEA 4AAJA 4UNKA 3A3WA 4HMDA 2VO5A 1A47A 2GOKA 3VC6A 2IKJA 4YPJA 3WX7A 3SGZA 3THUA 2QLYA 1EJWC 2PRLA 3W2JA 1TV3A 2IPJA 4RW5A 3KDOA 1G4EA 2GZXA 4A8LA 2A3CA 5F4XA 5LA2A 1H41A 4JFVA 3CIXA 1DJWA 1JGIA 4JDYA 1W9UA 4BWLC 3E0IA 3B03A 4PC8A 3BZGA 3WEZA 4P7RA 3WLMA 3FIGA 4BKNA 3CUXA 4I3GA 3G22A 1OY0A 3SB0A 1PIGA 4BF5A 1G01A 3AXMA 4QG6A 1LLOA 4MJ4A 3AIBA 3F2CA 4HHLA 4HU0A 3QHMA 1VFLA 2J7DA 1J96A 3CJPA 3PFMA 2YOCA 3M7WA 3H70A 4Q22A 1OX6A 3BAKA 1WXJA 3BE7A 1N55A 4S3EA 4IMFA 1XICA 2IXUA 3ZSSA 4UWMA 2NQ5A 3R0UA 3UESA 3LCFA 3PSVA 3RM4A 2CWXA 4O0QA 3QMTA 3IGSA 1JPIA 4BF9A 5D04C 2W9MA 3IUDA 1FY6A 1TTQA 4AXKA 3II1A 1GVRA 2FLIA 4MUZA 1LL6A 3AIEA 4CD8A 1A5MC 1JCTA 4QXIA 4P8WA 5XINA 1YDYA 4YXGA 5JH2A 2ZOXA 5LYRA 4WXZA 3UY7A 3E96A 1PX3A 3PUDA 2DUZA 4ICCX 3LV5A 4IQJA 3URNA 2VGGA 3CEUA 3TJXA 1QW7A 5B7YA 3QLDA 1QNSA 3HURA 1Q45A 4OGZA 2F6UA 3SUSA 3H7VA 3W70A 5I3GA 3HQOA 4LS0A 3W1XA 3ITCA 1R6WA 5JBEA 3EA1A 4Q4SA 4ZCWA 3ZR5A 1LLWA 4WVXA 4ZO6A 3WLLA 3VZZA 3G18A 3ANUA 1A5SA 1ODUA 2V5LA 1JZ3A 3IVUA 1K70A 3AXHA 3LGDA 4TVUA 1X7IA 3W73A 1EYWA 4LU0A 1B4EA 2P1FA 2BXVA 2VX5A 3GDTA 3CEPA 3EEGA 2OG9A 2HS8A 1GJPA 5HWJA 3PJWA 4OOZA 2H9AB 1H5YA 3QZAA 4M19A 4PUWA 1P0KA 1X39A 1X97A 3PZNA 1UQYA 4WJ8A 2EAWA 1QTWA 7TAAA 5CBJA 4S3GA 4D6FA 2PD5A 4MB5A 2P53A 4UR7A 4EWND 2ZADA 1UZHA 1QHPA 3WY1A 3ABSA 4FK9A 4M29A 3T6CA 5HATA 1DIDA 3SCPA 4J3XA 4UNLA 3GVQA 1OT2A 3G1RA 2DGAA 2IQTA 3LMZA 3UWVA 4DVOA 2YCLB 1IHIA 1GOOA 4KIEA 1DJQA 2JGQA 1C9WA 4NXKA 5HR6A 3DFPA 4W87A 4H8UA 4CGTA 2XVKA 3KRBA 1QU4A 3SSZA 5KETA 5C6MA 3LX9A 5E0CA 1LORA 2DT1A 1W9VA 3TN3A 4UQDA 3W00A 4DXVA 3CASA 1LYXA 4H6KA 2QVNA 2WJDA 3CQ0A 3MA8A 4AZHA 1UD8A 3FHAA 2BXYA 2WNNA 3CM4A 1XPGA 1NY1A 3N2BA 3LHYA 4BS0A 4RDYA 2GQ8A 1SR0A 1R38A 5EMUA 1NU5A 1K9TA 3RPMA 3E6EA 3LGGA 3L68A 4UC5A 2CW6A 5EPDA 2WHMA 3VFLA 2BHUA 1KXHA 4LAMA 1WAUA 3LV6A 1WZMA 4O57A 4XD4A 1K9EA 5B80A 3P2VA 2QPUA 3J7HA 4JOMA 2QIWA 1POJA 3W7DA 2XGBA 1UZ4A 3AROA 3S0CA 3ZO9A 4C65A 3BG5A 1EPVA 1GVFA 2XIQA 4LVGA 2FIQA 3VX0A 2FZBA 3QQ0A 1PL9A 3W81A 3GH4A 3UYCA 4ACZA 3PSWA 4BQ2A 1VBHA 3CLMA 1CZ1A 3CB3A 4H8NA 1BGAA 1SO5A 1W3JA 1E5JA 5F2LA 3W27A 1DWAM 3NZQA 3LS9A 4IH3A 1LBLA 2I5IA 2PMQA 1L6SA 2VVNA 1AZ2A 2W27A 2OO6A 2CPUA 1GJUA 3BH4A 2P3EA 4IF2A 1WXZA 3HPAA 1VKFA 3U4FA 1EF3A 4JNZA 1HFBA 4YTSA 1IEVA 3GXDA 2C79A 4NNCA 5GQBA 3WLKX 3UJSA 1BVWA 1UD4A 2A3EA 3GFYA 3W2UA 3WQVA 1JVNA 1W1VA 1MDRA 3FNDA 3M7SA 2QULA 1DQWA 3L2LA 2XJ7A 4IIGA 3RR1A 1KFCA 1ISXA 4JFTA 4LF1A 1TV8A 4QE5A 3NOEA 2G3IA 1DIKA 1E9ZB 2CZEA 1AL7A 3CBWA 3KTCA 3PZUA 5A69A 3KW3A 3V5CA 3BG9A 4GXWA 5D2VA 4JTRA 4I90A 2Y6ZA 5HDRA 2YX0A 4PTXA 1ZNNA 3ARQA 3P81A 3HM7A 4ZODA 3KBVA 4J3TA 4Q8PA 3G0XA 3UZYA 4Q4MA 5PTDA 3IJLA 1RV8A 3BWWA 3IV8A 1V3KA 1NFGA 5CJMA 3S5YA 1VS1A 1EIBA 4IISA 3R89A 3WLPA 2CZVA 1YBQB 4MPKA 1TUXA 3E0LA 2YYTA 3V5FA 4O16A 2CZ5A 5M3WA 1SQ7A 1EBGA 2QGYA 2WHLA 2UWFA 2WQDA 3LLXA 4ZB0A 1DQUA 1OGBA 2WZIA 4PUMA 1EOKA 3M0LA 1TWDA 3JZEA 4DI8A 5DMLA 1Q4NX 3VGBA 4WLCA 2YDSA 1JDFA 1ZRQA 4OIFA 1Q2SA 7PTDA 3WJSA 2OKOA 4MADA 2FVKA 1T7LA 3VGEA 2HVMA 4PB4A 3W23A 2BHZA 3L21A 5G2HA 3PTMA 2D0GA 1EWDA 2W62A 1A5NC 2X09A 1UBPC 1O95A 3M6DA 3NDZA 1FH8A 2OEMA 4DUVA 1GW1A 3HV9A 3CIWA 3G1AA 4L9XA 3CHCA 4ZO9A 3C61A 5EYWA 4M6VA 1A5UA 2E77A 2PDBA 7ENLA 2ISDA 2QUVA 3P8IA 4C6BA 1JCJA 4C5YA 4TV6A 1UP0A 3ELFA 3MUXA 1UR0A 4C6QA 3T42A 2G50A 4E38A 4QX4A 4DRSA 4B91A 1J79A 4ZMGA 4XVEA 2IW0A 1C9DA 1RCOB 3IGXA 4IG2B 1JCLA 1W3IA 2NWRA 3F4CA 1RK6A 1AH4A 2R6OA 4WY0A 1KLZA 1M53A 4HK6A 1BVNP 4DBWA 3REQA 3V0SA 5EMLA 1QATA 3GDRA 1ECQA 1X98A 3VPLA 4ZTXA 3UXDA 1UYQA 5DMYA 2PLCA 3ME3A 2HE5A 4O1BA 1JXKA 4NILA 4WJEA 4F9JA 2P5NA 1ZL1A 3KOZA 4C90A 2NXGA 4CN1A 2NX3A 4GD0A 1K4HA 5LIYX 3MUCA 1KRBC 3V1PA 2PGRA 1JF6A 2VFGA 4L6OA 3W7CA 3B8UA 1KR0A 3TMQA 4PMOA 4AD0A 3S5ZA 2VENA 1R2RA 5FF3A 3D5HA 4JIPA 2QCFA 1KFWA 2YCEA 1OYAA 3T07A 4M6QA 3K8KA 2O9OA 3MI3A 6REQA 2V3FA 4Q32A 1O7AA 3BGAA 1DQXA 3BK0A 3TTQA 3A5VA 3VCNA 4PMNA 2DJXA 4FNTA 2P0OA 1NAL1 3WL1A 2D2JA 4EXBA 2YXGA 4JX5A 4REQB 1EXBA 4NAFA 1K1DA 4GNJA 1B2YA 3VMOA 3PM6A 3UP8A 3L4VA 4C6JA 1JXJA 1CI1A 3WCZA 4JTSA 2V8ZA 3IVSA 4XO7A 3RJYA 1KM4A 4JY8A 3IANA 4FF7A 4Y8FA 4H6EA 5JH1A 4Z2IA 2VR2A 4C7FA 3T2OA 4JTTA 1E72M 2PTYA 1WP6A 3LUTA 2NQJA 2XFFA 3R13A 1UD5A 6ENLA 5FI8A 2DY3A 1LL7A 4UFJA 2FHFA 2BFGA 5I00A 4NJJA 3BAXA 4QG8A 2RDXA 3KBSA 3AYTA 3UCQA 1DORA 1WDQA 4GX8A 3OGVA 1I0BA 3AYSA 4FF5A 1RALA 2D73A 3L0KA 4FX8A 4N42A 2JEQA 3HA1A 1NFBA 1LT7A 2VEGA 3LZ3A 4IJRA 1O1ZA 3EOEA 4YWIA 1UD6A 1RPXA 3N34A 3M5YA 2XSXA 1LLZA 2UY4A 2YBTA 1ZCCA 3B8SA 3O3RA 1Q6LA 2DH3A 1V3MA 2V2CA 2VDIA 3ZJ7A 3CUFA 3EWWA 1MEHA 4C6MA 1SFSA 3R12A 4XV0A 3CNYA 1ITQA 2BV9A 1YW1A 2GJLA 2Z25A 1EEXA 3MSRA 3KZSA 4G7EB 1F9CA 3W7JA 3BLEA 2Z7GA 3MYOA 4GLEA 2ZX6A 2V67A 3LNMA 3RLHA 1CT5A 1OC5A 3H26A 4MG4A 4OQVA 4C6DA 1UWIA 2BY3A 4W8LA 3WJZA 5A2BA 4DXKA 3BTNA 3UPMA 3JU2A 4L4OA 1IWPA 4RNHA 4JQ1A 4L5ZA 4U2YA 1K7FA 1UKTA 3SQSA 4GXPA 3MPGA 2GJXB 4UTKA 4UB9A 3NGFA 4NI3A 4RE0A 4L9YA 1JG9A 1UR3M 3TYCA 2FVLA 1AL8A 3ARZA 4IP4A 4NSBA 1QHOA 5DRIA 4Z1BA 3DFQA 3OBAA 4NZ4A 4ZA0A 1O94A 1N8WA 4F48A 5DCEA 3WNPA 3PG8A 3VOIA 5DXYA 3ITGA 1V6WA 3VFCA 3QV7A 3IUHA 3E2RA 4GQBA 5A8NA 1LROA 4P8XA 4AW7A 3G0SA 4JICA 4Q8NA 1AVAA 1K3UA 4B5XA 4UFIA 3PNUA 2J75A 1JUKA 1LRQA 2AL1A 3OYZA 3LPFA 3A6OA 5F2IA 1G94A 1A5OC 3VD7A 4HB7A 4P7OA 3WLIA 4OV9A 3H2EA 1Q6EA 1VYRA 4GBUA 1PJ9A 1D2KA 3VK5A 1UPPA 5EY5A 2W66A 3SIMA 3T8QA 3WD4A 3V1HA 5C7VA 3AU6A 4B3LA 1HJXA 3UPWA 4BI6A 3EX4A 3GE7A 3VINA 4DX3A 5D03A 1C92A 3M0KA 3SY1A 1P6BA 2ZCGA 1W3LA 3TN6A 1P1MA 3NM1A 4XSMA 5C9XA 2VQUA 3WJXA 2DUXA 5CZSA 2IQ0A 3ARVA 4E4FA 3SN0A 3CHVA 3S47A 4NNBA 3C2YA 2PU0A 4J9JA 4MWAC 3IJIA 5FIPA 5K9XA 3L23A 4CD5A 4P8VA 2E0PA 1PTDA 1KWGA 1KBKA 2XM2A 4MJ2A 1B9ZA 1GWJA 3U57A 3B06A 4Q8QA 1TIMA 3BJFA 3UPBA 3MVTA 3W74A 4UOQA 1OYBA 2OR2A 1RJQA 2VEFA 2J88A 1FXQA 4ENLA 2ALDA 4O54A 2DZVA 4R34A 2E9BA 1E0WA 1XYLA 3FAWA 1QUMA 4X9SA 4MB3A 2FTWA 5AKQA 4ZXLA 4DYKA 2OB3A 3LBMA 3CH9A 3MSYA 4MZYA 4U3AA 5HPCA 4TR9A 3NZRA 3VNIA 4N2YA 2NQHA 2BHYA 2ZTKA 4K2SA 4JTEA 1X1OA 4CD6A 4LRTA 4Q4RA 1UUQA 4JD4A 4EKJA 4ERIA 1CX9A 2NT1A 3LZ5A 3O0KA 1VJIA 2VRKA 4EAYA 1ZAIA 3AU2A 4WD0A 1HP4A 1ZP3A 2OMAA 3IPWA 1PX4A 3PZMA 3CMGA 1OCNA 2PDGA 3B9NA 4W86A 2V3DA 4ATWA 4G1KA 5K9DA 1FWAC 1F3WA 2WJZA 4Z1YA 4MDPA 5ABFA 1FUYA 3VOFA 4PTDA 4DQWA 1W1TA 1WPCA 3GW0A 3GM8A 4XWUA 5DCDA 1VEMA 3BARA 2QUNA 4AEFA 4PE8A 2ZRZA 4PB3A 4WDWA 1FHUA 4ZOBA 4DAFA 3W1UA 1R87A 3AMGA 4MY9A 3EDFA 3STEA 4I5RA 2Z6IA 4MWAE 1Z69A 3G1DA 4XZMX 2VT0A 3IJ8A 4C7DA 3TFXA 1XQKA 3MWCA 2BVTA 4XQ6A 4H41A 1F4AA 1B3VA 3A24A 3QY6A 4RE3A 2ZA2A 3W1QA 1W1IE 4RLIA 2QF7A 4KRTA 1JZ6A 1DVJA 2AQVA 3ZQ9A 3MMUA 1H7WA 2ZXQA 1E6RA 4IPJA 1I2PA 1XISA 1UBSA 3KOWA 2E7FA 1L6WA 1VAHA 2WHKA 4NAEB 4HSNA 1MQRA 2NT0A 5BCAA 5AHLA 5HOSA 1Q65A 4ZE5A 5A6LA 4AVFA 4E3TA 3BLDA 4R9XA 1HL2A 4HJWA 1JF5A 2JALA 4A8IA 4I7UA 5C9ZA 4F79A 4AF0B 3ZR6A 4UTIA 3SR7A 1TPDA 3W26A 2OYKA 3GFZA 3A3XA 3K5XA 5U4NA 3UR8A 4FNQA 3FYYA 3TQ0A 3ZJ8A 1D8WA 3ZVHA 3UEQA 2F6XA 1TPUA 2ASHA 3F7JA 3GTHA 5TNVA 2OQYA 3N11A 3DOPA 4R27A 1AQFA 3KCJA 2BP1A 3QV9A 2ODOA 3L4UA 3PR2A 3QV6A 5I2UA 3LRMA 1AMKA 5BXRA 3CH0A 1Q7QA 5K4ZA 3PZIA 4S38A 1TCMA 2X1SA 3IJ9A 3FGCB 2DSWA 1ICPA 2X41A 2A79A 1FX6A 1H5VA 2EF9A 2KZHA 2O4MA 5L6UA 7A3HA 4G7EA 1JZ8A 3UQNA 3VGFA 2NSXA 2NV1A 2GDQA 1KCXA 1CXEA 3VO0A 1XLCA 2J62A 1JPHA 4JBRA 4CQAA 4CN6A 4O17A 2VXNA 3U0HA 2NWSA 5HQEA 3URBA 1XH2A 4Z1CA 4OV4A 4BJHA 1BG9A 1FDJA 1H51A 2O7QA 5LNVA 4XKYA 3RAOA 1VJSA 5A2AA 2O9PA 5BMXA 5BRBA 3LDVA 2ZX7A 3Q58A 1G7UA 1XYCA 2Y7GA 3EBVA 3SJ3A 1XKYA 4S3FA 4IPIA 4S2CA 1O12A 1UASA 4UOJA 2Y7EA 2DVUA 2PDYA 3LI0A 4E8GA 1VFMA 5TD4A 5CZ0A 3LLDA 5A1AA 2BMBA 3FJNA 3H8AA 1U33A 2JK2A 3MJYA 4ZQNA 1KO0A 4IPLA 3UG8A 4V28A 1Q6OA 1BWLA 2V5CA 4XD6A 1RH9A 2VVSA 1ITUA 5AYIA 4IJBA 3CQKA 4UTFA 3ZFHA 1UUOA 1XUZA 2OT0A 1NDVA 1POKA 4H01A 4MTVA 3UGRA 1TMLA 4QTGA 4RNJA 2PZNA 3AZTA 3M0JA 3PTQA 3OGSA 2O9TA 1ESWA 5A6KA 3L4XA 3MSDA 5DELA 1GONA 4Z0JA 3YPIA 4J3SA 2CWNA 4V15A 3RG6A 3OHMB 1W8SA 4FXJA 4D8ZA 4QNEA 1ITXA 4JXCA 5M5DA 3GUWA 2A3HA 1HJQA 4HMCA 3CQHA 3E2QA 2WYSA 1UWQA 3GVWA 4IGMA 4K36A 4B5NA 1GZGA 4MWAB 2IUZA 3KVLA 2A85A 4FIQA 3QMSA 1M68A 5D9PA 3UXKA 2LLEA 1F2JA 4ZOCA 2CXEA 4Q4KA 3SBFA 1E5NA 4PODA 3KEHA 3CTTA 5HMFA 2UY2A 2GJRA 3DU0A 1EZ2A 4ZQPA 3VU2A 3G24A 1E71M 2QT3A 1FWBC 2CEQA 5KZDA 4C1NB 2IPFA 2IMRA 3B4UA 3GO2A 1KXQA 2H6RA 2HBVA 4RZ6A 3DKJA 2BLEA 4D6HA 2EXOA 2XVPA 1B4KA 1W2PA 1OCJA 1VFOA 4LAKA 5H1WA 3IRSA 2EPNA 3W4RA 3VIJA 1CENA 4R33A 4L7ZA 1RHCA 4ZEPA 1P1XA 1TPC1 1XDLA 4JKMA 3LTPA 2GSHA 1G4SA 3TC3A 1LQ0A 2R14A 5FAGA 4DAIA 4R53A 1CPUA 2IQDA 3B04A 3NQFA 4NKCA 3P60A 4E2BA 3WELA 4F2BA 3VNYA 3ANVA 3T05A 5C55A 4LUJA 4P7LA 3F4WA 1Z8AA 3BLOA 3H4WA 4Z0SA 4MZ8A 3UWWA 3N2OA 3OLGA 4O1CA 2X16A 1CGWA 3P62A 2B81A 5AC8A 2CESA 3GNDA 4PULA 3W02A 2E8YA 2HNEA 4N0RA 1QNRA 4MWAD 3WDQA 3PS7A 4MMWA 2VI0A 2GYIA 1PTGA 2ATSA 2WWCA 1LG2A 3C4UA 2I7GA 4Y9MA 3VIKA 4LALA 4JTJA 3RRAA 1FWHC 1LF1A 1E6QM 2VP8A 3D3AA 3LHUA 2E3ZA 1VGAA 4GFSA 3SCQA 3DX5A 3UBPC 1RR2A 3G6MA 1HKIA 1IWBA 1BXNA 3EWBX 3LXBA 4UMCA 1VFHA 1MXGA 3LU2A 1HN1A 3W2MA 1MFUA 1A5LC 4LNYA 1R3RA 1S2TA 3QC0A 2VEIA 1VPXA 4YTUA 1SZGA 1UKOA 3PUGA 4NT0A 2E25A 2Y8VA 2Z1BA 1OX4A 1FWFC 1JCYA 1KM1A 1MYRA 3H4GA 1UD3A 4NAEA 2QQ6A 2OVLA 1PWMA 1QNVA 1IR1A 2ZVRA 3I4EA 4O1AA 4UQEA 1AW5A 3WD1A 3ZM8A 5CZKA 1HIZA 4M0XA 3R1ZA 3U7VA 3MV01 1XBVA 3VOCA 4J3VA 3LXAA 4AF0A 1VYSX 3SAZA 2PP1A 2VGFA 3VD3A 4H83A 4F2UA 2CCRA 3WDJA 1UMLA 1S3TC 1C29A 2A2IA 1XDJA 3MTWA 1HJWA 4OBTA 1MQQA 2VFFA 2WMKA 1SJAA 1TA3A 5EMKA 1QNOA 4DO7A 3DFNA 4KCVA 3CAVA 1LWIA 3C86A 3GU1A 2ZUTA 3W1AA 5A6MA 4AVOA 3GC2A 4Q7IA 1SMAA 3BLKA 1E43A 3MO4A 3GC4A 1UR1A 1I4NA 3TJIA 3U5YA 3DBNA 1KB3A 4H7CA 4DIAA 2ACUA 3AHXA 5CG7A 1Q8AA 4JTDA 1ECEA 1US0A 1MW0A 2WZMA 3FGCA 4Z17A 2VFIA 1H7PA 1UP3A 2XWDA 3GVRA 1FWSA 3E02A 4LAZA 3BLIA 3T40A 3L66A 4H9XA 4JX4A 1EZWA 3AO0A 3W6YA 2JKPA 2X8RA 4XG1A 3ITXA 4XZ9A 4HTYA 2ZFAA 3CT2A 2NW0A 2EPLX 3JRKA 2PDUA 1J11A 1PS9A 1GVEA 4IIEA 4BK9A 3GHSA 4CVUA 2Z00A 4XAZA 1E6NA 4B4FA 1ZJIA 1E6ZA 2WM0A 3PZTA 4S3AA 4NNAA 4DF1A 2YB4A 4F9DA 4QJ3B 5EKYA 2ZC1A 1G1YA 1CDGA 1V3HA 2DH2A 1GQIA 3IVTA 3KL3A 2E68A 4U31A 1U5JA 3GC5A 3ARTA 5FD0A 3NZ1A 3ICJA 2G96A 4UNIA 4ZSTA 1HO1A 1I75A 2E1WA 4IWWA 4M8UA 4GABA 4FA3A 4BY3A 4DWSC 1V93A 4H2HA 3FYPA 4MFEA 2ICSA 1EP3A 2NVAA 4QHRA 4RV3A 3V0TA 2CBVA 2V3EA 1OK4A 4WJXA 3ERPA 2WVVA 2TODA 4GI8A 4V1YA 1V3IA 3DC8A 5CQ1A 1WZAA 3AWNA 1RJPA 3K30A 1DBTA 1V5XA 1ZBKA 1R7AA 2YSWA 4J1OA 5EBAA 4P7NA 4TU1A 5F2GA 1K9FA 2C71A 3TOYA 2WWDA 3PTKA 4DBUA 1XR2A 4LJ3A 1IXQA 2HPIA 2PBGA 3AOFA 3ONCA 3S3GA 3SCSA 3UXAA 3K2GA 3LRKA 2YCKX 1YE6A 2AL2B 1W56A 4PUEA 1AH0A 3F5KA 3KP0A 1QVBA 4IQDA 5H8PA 3QHNA 2BOFX 1XDMA 2PDLA 3WBWA 3L2IA 4HPJA 4BZYA 3NUKA 3MUY1 1XCFA 3O0FA 4CD7A 4RL3A 3CV6A 3BV4A 4URIA 5I3HA 4PB5A 2R8WA 3UR5A 5G2WA 3UERA 2OX4A 5REQB 2GGEA 3DEQA 3HV8A 1AG1O 4MKNA 1RVGA 2VR4A 3GXNA 3ZLHA 2EG6A 1JZ4A 3C3NA 4QIUA 3GK0A 1EB3A 3T4CA 3S6OA 2GSJA 4XO6A 2ZIDA 1CEOA 3HPSA 3P3BA 3F5JA 3OZPA 5C0QA 1HJVA 2IPGA 1W17A 2HISA 1U22A 4IL0A 1EL3A 1QPRA 1W1ZA 2FTYA 1J01A 3VYLA 3HG4A 4Q8MA 2Q3RA 1Q6GA 4HGXA 3UZZA 5HNRA 2FHCA 3TAOA 1IGWA 2REQA 1XD0A 1QOQA 1SPQA 3V4BA 1YNPA 5FESA 3E74A 1B54A 4GJ1A 1NH6A 7XIMA 1ZQ5A 3CC1A 1E9LA 1GZJA 4I8YA 3N9KA 1U1JA 1ZHAA 1UROA 1XLMA 4N9EA 4HU8A 1MO0A 5H8UA 2Z24A 3NQMA 2ACQA 1KFEA 5IDIA 3TONA 3GIPA 3ABOA 4AWEA 3MUZ1 1UKPA 1EFZA 3PN8A 4U28A 3K8LA 2CHRA 1KGUA 4A2SA 2GL5A 3WMBA 3IIVA 2BGSA 2PDXA 1IWAA 2QMJA 1OSEA 3UY8A 4HHMA 3EX6A 1EHAA 4QDWA 3CIVA 4HJFA 3EXSA 2RFGA 3DHFA 1WDSA 3H7UA 3GD6A 3G3MA 1KKRA 1L6GA 1RLDA 1KBIA 4JTFA 3QZ6A 5A95A 4IT1A 9CGTA 3GXFA 3GG1A 3NOYA 1C3FA 2VURA 1OX5A 8XIMA 4AMAA 1K8XA 1KM5A 1NEYA 3RCNA 1FH9A 3ATYA 3N17A 1TUFA 5FL0A 3CV2A 1UMYA 1ZJAA 1Y5VA 4EPDC 1OT1A 4IL2A 1XCWA 3BSHA 2JIEA