1SO8A

Abeta-bound human abad structure [also known as 3-hydroxyacyl-coa dehydrogenase type ii (type ii hadh), endoplasmic reticulum-associated amyloid beta-peptide binding protein (erab)]
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
248
structure length
208
Chain Sequence
b'RSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTDPAEYAHLVQAIIENPFLNGEVIRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-hydroxyacyl-CoA dehydrogenase type II
molecule tags Oxidoreductase
source organism Homo sapiens
publication title ABAD directly links Abeta to mitochondrial toxicity in Alzheimer's disease.
pubmed doi rcsb
total genus 67
structure length 208
sequence length 248
ec nomenclature ec 1.1.1.178: 3-hydroxy-2-methylbutyryl-CoA dehydrogenase.
pdb deposition date 2004-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1so8A00
4PLZA 4XYLA 3GG9A 4R4JA 2IYPA 2G1UA 1HE2A 3VH1A 3H9EO 1ONPA 1WZIA 1EVZA 3PP8A 1EUZA 1XU7A 3WTBA 3HDYA 4XJTA 2X23A 3AW9A 1YXMA 2Y0DA 2CVZA 2ZB3A 1A5ZA 3AFNA 4C7KA 2W8ZA 3JQGA 4IJKA 2C54A 3V5NA 2Q1WA 3VVBA 4D79A 3S2EA 2AE2A 4QECA 5TJ9A 1DIRA 1H0KA 5TJHA 5KNLA 2Z5LA 5I7VA 5JMWA 5HS4A 1V6AA 1X7DA 4MKXA 5JYEA 1U28A 1BXGB 1XLTA 2HK7A 1E3EA 2R00A 1ORRA 2ZTMA 3GNQA 3JQ8B 4TSKA 1A7KA 4ALLA 5KVCA 3DMTC 4D41A 4BIIA 2FOIA 4GLLA 2R00C 4Z3DA 2I9PA 1MG5A 1ZJYA 4HBGA 4YR9A 3JQFA 4QUKA 1U7TA 4FIZA 4Q39A 2W2KA 3CSDA 2CSUA 4HWKA 4MPDA 1BVUA 4UREA 4A2CA 3INRA 1JDJA 4KZPA 4XQCA 4URFA 4EJ0A 3RAJA 4J2HA 3WLFA 1YS4A 1EZ4A 3WOHA 3HN7A 3UKOA 2V65A 2I3GA 1NFRA 2V6GA 1TVEA 3D3EA 3RUCA 3WYCA 1B16A 5T64A 2B4RO 3MWDB 3BTUA 1JA9A 2YJZA 3U4CA 5CDTA 4GX1A 1KEVA 1C1DB 2HSDA 4Q3CA 2J5QA 2JCVA 1E6EA 1H2BA 3A28A 4N7RA 2X0RA 2I76A 1ZZEA 2RH8A 2AEJA 3GQVA 1NPYA 4JNKA 2Z95A 4R9RA 1J5PA 1HT0A 1NR1A 3DMYA 2C07A 1DEHA 1PS0A 3E48A 1EDZA 3VPHA 4DBVO 1SC6A 4W82A 4AVYA 2PKQP 3S1LA 3CZRA 4CM7A 3JQ9C 3AUAA 1E92A 1NPTO 3RC7A 5TLSA 1XDWA 2Q2WA 2Y0CA 2NM0A 3K5PA 3VPXA 4EUHA 2GN8A 3ZNOA 1YJ8A 4F6LA 2EIHA 3S2IA 5DCWA 4J4TA 3PDUA 2RHRA 3NKLA 4BNYA 4ROSA 2QG4A 1PQUA 2Q2QA 2AMFA 3WGQA 2VYVA 3P19A 4MVJF 3TOXA 3ONDA 3RUAA 1NYTA 4CL3A 3PHGA 1VL0A 2Q2VA 3EAGA 1UDBA 4YAKA 1ZEMA 1GU7A 4DPKA 5K0ZA 3ROMA 1DIGA 3PLRA 4WLFA 5DP2A 3I4FA 3O26A 2IXBA 3BMCA 3KLPX 1YH3A 2JL1A 3F47A 4GVXA 1M6WA 3TZ6A 2D2IA 4BO4A 1HE5A 1JQBA 4OGWA 1UDCA 3FCOA 4O5OA 4RZIA 4KUHA 3WYEA 1P9LA 4FB5A 2RBEA 5TS3A 2WM3A 4UUMA 4BO8A 4RPGA 2HK8A 4YTEA 5AVOA 1O89A 3V2UA 4ZQBA 4BS9A 3RC1A 1U4SA 4CLDA 4I8XA 4OJNA 3D4OA 4D3DA 5HM8A 1DC4A 4DQXA 1GAEO 1ENOA 2ZCUA 3P5SA 5AXDA 1SB9A 2HAEA 3M1LA 5F1PA 1VL8A 1PZHA 2BELA 3SC4A 2PGDA 1WPQA 4YJGA 3KYCA 5JXWA 1VM6A 2VOJA 2VYNA 1EEHA 1GQQA 3AOEA 1IZ0A 3DEYX 2E4AA 1ENZA 2H5LA 2PH5A 3Q1LA 1LLQA 1PU2A 4RVUA 4BNXA 5ER9A 1DPGA 2Q1UA 1LLDA 4PLGA 3CKYA 3DMTA 4RV9A 2ZYGA 2NTNA 4JXKA 3A06A 4IDCA 3KOUA 1MFPA 3PI7A 4L73A 2NTVA 4HUJA 3DAFA 4QT0A 2B4QA 3CZMA 3QA9A 3WIEA 4BQRA 1LSUA 4BGIA 1DIHA 5DBFA 1N9GA 4AJKA 3OM9A 1GZ4A 1RWBA 3Q0EA 4WECA 3KO8A 1I32A 2JHGA 4U7WA 3KHUA 4GBJA 3WFIA 1I36A 3MZ0A 3C7AA 3GNSA 1H6CA 2VYND 5JPIA 2Y68A 4MP6A 4S3MA 2RIRA 4W9NC 3GGOA 4NHEA 2B35A 1U7HA 4KWHA 4FFRA 3HG7A 5EINA 2C0CA 1Q7CA 3OJEA 5JFOA 3PWSA 3MOIA 3FF4A 1RYDA 1UR5A 3JQAD 4OOFA 3BXXA 4L76A 3WNVA 2QYSA 3NT4A 5L7WA 3PDJA 1ZK4A 3WDSA 4E32A 5IFLA 3H2ZA 5KJ6A 3JD2A 4D45A 3UH1A 2HLPA 5JCJA 3RUIA 4LVUA 4R3NA 4ALIA 4ALJA 4RORA 3KYBA 3GC6A 4DRYA 5AQ1A 2V6FA 4MIEA 1YL7A 3EC7A 3GDOA 1LU9A 1NAIA 3OJ0A 3WJAA 3C3XA 1GL3A 3OMLA 4XX0A 5GZ6A 5KVSA 1F06A 1U2DA 3ZWCA 3KXDA 2P9EA 2C5AA 5GMOA 3JYQA 4AICA 2O7QA 4JLWA 3IOYA 1AHIA 1PSDA 4KP7A 2POQX 2VNSA 9LDTA 1KYQA 2ILTA 1EFLA 4F6CA 1LDNA 4DIBA 4JP3A 5I9NA 4NPCA 2VHZA 1HE3A 4IZIA 4RVSA 1F14A 2EERA 1DC5A 4GPD1 4OIMA 4QEDA 4HFRA 2HMSA 4CLEA 1DLJA 4MIYA 3VKVA 4YJHA 4ND3A 2W2KB 4ILKA 2YDXA 2GUGA 2QQ5A 1PGOA 2HRBA 3ANMA 3LC1O 3RD5A 3IP1A 4C7JA 1DAPA 3G1UA 3QE3A 2UAGA 3I9KA 5IDQA 3GAZA 3T7CA 3O38A 5IZCC 1ADFA 3BHJA 4FQ8A 4YT5A 5T8KA 3OBBA 1OC2A 4YQYA 5ILOA 3PIIA 3ZNNA 3OF2A 4AJ2A 1DO8A 1H6AA 1M76A 2LDBA 2NU9A 4XQEA 3DBHA 4P38A 1GPDG 3UICA 5CHEA 1T2EA 5IF3A 5B12A 3IAHA 4WNIA 3KSZO 1E7SA 1SNYA 1UP6A 3L6OO 1B7GO 3KTDA 4H15A 3FBGA 2IODA 2BI7A 2F1KA 4J1SA 4LSMA 3OFSA 2NVUB 2ZTUA 3NRCA 2D5CA 1C14A 3WYBA 2UYYA 2BHLA 2VHXA 4RVHA 1K6XA 4JBHA 2JFFA 5IG2A 4IMPA 1BW9A 2HJRA 4XB1A 4RLSA 3OECA 2IEDA 4RF5A 2PTGA 3GMDA 5BT9A 3RIHA 4FS3A 5FF9A 2TMGA 1N5DA 3BMOA 2Y0EA 4Y6PA 4YB8A 3ZW9A 1M6HA 2J3KA 4HNGA 1DB3A 1OI7A 1E3JA 4O1MA 4CMEA 2R2GA 3IUPA 4IIVA 2YHIB 4YRBA 1LLUA 3ZV3A 4R54A 3LK7A 3N58A 2QIOA 4MIOA 3ZWAA 4AJNA 4BNZA 1DHRA 4H3VA 3A14A 2DPGA 5A3JA 3QWHA 4IBOA 4CV3A 4QXMA 1JLLA 2I99A 3H9QA 4ESOA 5AXAA 1Q0LA 1ISMA 4IUYA 4J4HA 1HDOA 1BW9B 2X8LA 3H3FA 4P4GA 3TZCA 3C1AA 3H5AA 2OUIA 4E31A 4AJJA 2AQ8A 3DTYA 4CPDA 1TA4A 1B8PA 3E1KA 5ICMA 4PCVA 2CNBA 2OBYA 5CDYA 1ISJA 2CMDA 3GRKA 4MVJM 4LMPA 3G17A 1C0PA 3I6QA 1JKFA 3EVTA 1HDZA 1TLTA 4IDFA 4OO3A 2Y05A 2DFDA 1F8FA 4JJGA 4BO0A 3WWYA 1J4AA 1GD1O 1MA0A 2V7PA 1WMBA 3COSA 3I4CA 4H7PA 3GG2A 4RO0A 3HDQA 3JCZA 3VDRA 3PJDA 2AQHA 3RC9A 1UH5A 3QRWA 2VOEA 4ZQEA 4DLLA 4U0JA 2EGGA 2WEKA 1X7GA 3H6KA 1AGNA 3I9MA 4P8RA 3Q2IA 4GMFA 5ITWA 4BNIA 3FSRA 2OFPA 4MVJH 4D42A 2CDCA 2I66A 1I3NA 4R1TA 4MOWA 2B37A 3QLJA 1DBVO 4WOJA 2HQ1A 2EWMA 4OKNA 1DFHA 3DBRB 5JMPA 3WQRA 4HP8A 1OZAA 1ID1A 4JROA 3RUFA 1DIAA 1PJ4A 3ZWBA 4TMFA 1C0IA 1T24A 2J5KA 3ETDA 3F5QA 4FFOA 4PLHA 4IXTA 5TSDA 3N74A 2GR9A 4JK3A 2H63A 3H9GA 3BTOA 2HK9A 4D0RA 4EYEA 2FPPA 3ONEA 5BSFA 4B3IA 4EZBA 1RJWA 2Q4EA 3BMNA 4HFJA 5I7SA 2QRLA 3B1FA 5TX7A 4E6PA 3MCVA 3GGGA 3PYLA 4HKTA 3L9XA 2O2SA 2CVOA 1P1JA 1KVRA 1N7GA 2J3IA 3Q9UA 3QVXA 1M67A 1U8XX 3K2EA 4J43A 1I8TA 3DTTA 4A27A 3HN2A 5L95A 3HE3A 2JAHA 4BB6A 5I9MA 4NDNE 4EEZA 2WE7A 1U3VA 3G1TA 1DJNA 4IDAA 1BDMA 3VH2A 3G79A 1MXHA 1Q0HA 4CL8A 3D3WB 3NJ4A 1MB4A 1P33A 1IB6A 5C5IA 5HBRA 3TZKA 4QX6A 3VH3A 2XXJA 4BGUA 3KBOA 4R16A 1PIWA 4CR7A 4ALNA 5DN9A 1GY8A 4W9NA 4ND1A 1W8DA 3IP3A 1IHYA 3RU7A 1B26A 4GX0A 1PGJA 1ZUD1 2G17A 3PZRA 1L7DA 2BRUA 3FD8A 3QW2A 4Y8VA 5IDYA 2OXIA 4B7UA 2NV6A 2YV3A 2EF1A 4XGIA 2CF6A 4A5OA 2P2SA 3FPLA 4ALMA 3PJEA 3K8ZA 3O4RA 4CMAA 3KZVA 1AXEA 5DNAA 5CEFA 5K9ZA 1KC1A 1A71A 4DYVA 3L9WA 3OJFA 3E6AA 3ASUA 4TVOA 3FR8A 3GY0A 4U6QA 3WFJA 3OETA 2GN9A 3CEAA 4D3FA 5T57A 5CP8A 3F6YA 2WD8A 1GYRA 2WE8A 1ZVMA 3LC7O 5G0WA 3F4LA 3FNGA 3OIDA 2ZTLA 5A03A 1UZNA 3ON5A 3P2YA 4ZVVA 1QP8A 1YDWA 3RVDA 4NJMA 2DC1A 1N92A 2DFVA 2V6MA 4N54A 2VTDA 1TT7A 2YQ4A 5F5LA 1FMCA 2VRCA 1T2CA 1BSVA 4NG5A 5U9CA 1ZSVA 2XOXA 4DC0A 4QO7A 4KUEA 1R6DA 1IPEA 5CDUA 1R4MB 1K5HA 4TRJA 1R4NA 3NEPX 3TSCA 4LRSB 4FFMA 1ZXLA 2HMUA 4EDFA 4BL5A 5I8ZA 5I8WA 3D4PA 5A04A 4YAIA 4IGFA 4II2A 2NTJA 3LQFA 3DOCA 3ZU5A 1HYEA 1WP4A 2G82A 4O0LA 3KM0A 4RF4A 5EMHA 1E1MA 1E6UA 1TT5A 1EQ2A 1CQIA 4NMHA 4CUZA 3RI3A 2PGLA 5T67A 3O9ZA 1NPDA 4EBFA 1ML3A 4PG4A 4CLOB 1EUDA 1WDKA 3GH3A 3KV3O 4YDRA 4R9SA 5BNIA 5C37A 1TXGA 2VZ9A 5B37A 4FC7A 1EVYA 3GEGA 2YYYA 3SLGA 4AJEA 1J0XO 1PS9A 3C1OA 4CM8B 7ADHA 1VE9A 2GGSA 3JQ8A 3F9IA 3NT5A 5DDIP 2WDZA 4GL4A 1B3RA 2ET6A 2EW2A 2JD2A 3BIOA 4ND5A 3M2TA 4W6ZA 4I5DA 1D8AA 2CFCA 2Y99A 3ROQA 4YAGA 2CF5A 1GFSA 4LRTB 4UUNA 1MFZA 4CLHA 3RKRA 2VN8A 5JC1A 3KSDO 1Z45A 1DOHA 4WLOA 3W8FA 3WX0A 2VWGA 4BNKA 3TF5A 4I9UA 1HLDA 1XCBA 4L8VA 1CWUA 3T7EA 1RKXA 3G3EA 3I9JA 2PV7A 5EPOA 1NWHA 2BH9A 1EDOA 2AA3A 4IJWA 3TOZA 1E0DA 4P4LA 3ENNA 2O4CA 3B6ZA 3A4VA 4FW8A 1EE2A 3QIVA 2FR8A 1GYPA 1DRVA 2Y1CA 2OBNA 1I10A 1Q1NA 3F4BA 4YYZA 4WNCA 3FPCA 2CDAA 3IC5A 4IDDA 3GK3A 4Z6KA 3VPFA 3WB9A 3OHSX 4RPKA 4D3SA 1Y8RA 1PEDA 2VTEA 1PR3A 1HE4A 3NDRA 3JD4A 1QLJA 3AK4A 3TNLA 2O50A 1SPXA 5ITVA 1ZK0A 3K96A 1FDUA 4QSMA 5CEEA 5G4KB 1HDCA 1M75A 3PFFA 1LBEA 3UFXA 1SO8A 1WDLA 3RBVA 2Q49A 4DTIA 4BGEA 4BNJA 4Z0HO 3VZRA 1YOVB 4CQMD 3HSKA 4W7HA 1KVUA 1ONNA 2O48X 3AY6A 2YV1A 1SAYA 3GT0A 3WMXA 4XQGA 2HMWA 2X22A 2Q4BA 1ZBQA 3WSVA 3NX4A 4XJSA 4E2YA 2WSBA 2JAPA 2VUSA 3JQCA 4CM4B 5F1OA 4IJUA 1U9JA 1DRWA 3DFUA 4B3HA 2BLLA 1WNTA 3FNEA 4NU5A 4BNMA 1IUKA 1PJ3A 3IUSA 4GQAA 4IDEA 4UVIA 4WLVA 3UF0A 4CLOA 3SVTA 4XGKA 1BG6A 3HZZA 1JTVA 2BFOA 1HDGO 2PD3A 3LDHA 3AI3A 1HDYA 3STHA 4AJ1A 1XHLA 4Q9NA 3G0OA 4HX5A 1EK6A 2ZATA 3GVHA 2HO5A 3ZDFA 4YT8A 3UCFA 1QYDA 4CQLB 5BSHA 4BKUA 1WWKA 1W0CA 4EI2A 3DONA 4R5HA 5G0VA 4PZEA 1T25A 2FMUA 4P22A 4RF3A 1IY8A 5KVQA 1HSZA 1N9GB 3CMCO 5CFZA 1IOLA 2X0IA 3LLSA 3K2BA 4YAEA 2P9CA 1P1IA 1DFGA 4AJIA 4ZHSA 1GYQA 1IYZA 3PLNA 1N8KA 1UAGA 3ZWMA 3PHJA 3ICPA 3ZNPA 3UCEA 1GUFA 4CM1A 5L40A 1DC3A 2VRBA 1BWSA 4EUEA 3F46A 1OMOA 2GNAA 3RQSA 3NDJA 4L4RA 1ISIA 2O3UA 2HKIA 5I9LA 1W6UA 1A4IA 3CTMA 1LX6A 4I9NA 3MEQA 5KKCA 2WMDA 3E9NA 3K6JA 2GRAA 2EKQA 3GFBA 4UVEA 2IZ1A 1TT5B 4NR0A 4MVJP 3RSHA 3PWKA 4CV0A 4RPHA 4IJVA 1GUZA 3F5SA 3EZYA 1X1EA 3JYPA 4BKRA 3ZV4A 4MP8A 1ZSNA 4R3WA 1ZMOA 4CMIB 1HLPA 3CIFA 1DHTA 2D5AA 1MLDA 4B7CA 1UZLA 1XR3A 3EYWA 3JQ9A 1YB4A 4IINA 4FJ2A 5JNLA 3ZWOA 3I23A 1W73A 4BNFA 2DPHA 4DMMA 1K6IA 2X5OA 1Y5RA 4RJTA 2X86A 3NT2A 4AJHA 1RM3A 1LDBA 4A7PA 4PLCA 5THKA 3BA1A 2ZQZA 2H9IA 1LC0A 4RVGA 3VPGA 5TGDA 3SLKA 1E3WA 3H65A 4GKBA 4JBIA 1NVTA 1LTHR 3UAGA 1LDEA 3JV7A 1CDOA 3KEQA 1AHHA 1C0KA 1P3DA 1GPJA 3OEWA 2FSSA 3D5QA 3FR7A 2IE0A 5JE8A 3U0BA 4PG5A 4D7AA 4CMKA 1ZKMA 4CMGA 1PJCA 1BHSA 2GF2A 3BMQA 3ANNA 3OA0A 4IGEA 1ZXBA 4JJFA 5KWEA 1H6DA 1V3TA 4K28A 5IZCA 5BQFA 3C7DB 1HDXA 2VWHA 1QYWA 3DC2A 4PZCA 1C0LA 4DL9A 3HNPA 2NVBA 3GMSA 4J7XA 4GGOA 2YZ7A 3PJFA 5KKAA 1GQYA 2FZEA 4CLRA 2Z1NA 2A9FA 4YXFA 1KEWA 1G0OA 2JJYA 1EE9A 4BO6A 2BI8A 2O3TA 1O94A 2PA3A 4DBZA 1LRJA 4CMIA 4EJMA 1ZH8A 4JIGA 4XZ3A 3EUWA 4F45A 3AM3A 4G81A 3TDKA 2B5WA 1YVEI 4DPMA 3L6EA 2GZ1A 3EMKA 4M86A 3O8QA 3QWIA 5EN4A 1EVJA 3HB5X 3TFOA 5AYVA 3TPCA 3WGHA 2GN4A 2OZPA 4DLBA 5FWNA 5I7FA 5IN5A 1Z7EA 4O6VA 4IDBA 1C1XA 1HYHA 4HXYA 1JVSA 3JQEA 4K1LA 3L4BC 1HRDA 5G0UA 2X5JO 3HFSA 1ZCJA 2FN7A 2A94A 5JCJD 1CQJA 1Z6ZA 4ITUA 4IS2A 5TC4A 2OO5A 4QO8A 2CD9A 2P91A 4CM9A 3IL2A 5DOVA 4S1VA 1PJ2A 1LI4A 4XYEA 2B83A 3ADPA 2NLOA 5EERA 1LDYA 4B79A 3BMOB 4PGFA 1VLLA 1I01A 1JWAB 2PZJA 5ES3A 4R1UA 3OEYA 2XAAA 4FGSA 5KIAA 1YBMA 3DHNA 4WLUA 4BGVA 3FTNA 1BVRA 4CQLA 3EK2A 3UCXA 2RCYA 4XYMA 2H1SA 4QFCA 3T4XA 4GH5A 1C1XB 5BNTA 2V6BA 1YE3A 4CODB 4I1IA 3GN1A 2AEMA 4ALKA 3P2OA 3TZQA 3I9LA 1KETA 3L77A 3NV9A 1KY4A 3M2PA 4G2NA 1SCUA 1GADO 3HHPA 1AE1A 3R1IA 4EEXA 1O6ZA 1CYDA 2EG9A 4IQGA 3BHMA 3JD3A 5A02A 5KJCA 4RGBA 1P77A 4Q3AA 4E5YA 3L6DA 2VQ3A 2C5EA 3E5RA 2G5CA 4JCOA 1V0JA 3MOGA 2FY8A 1QORA 4J49A 3V8BA 4Q3NA 3VPSA 2C2YA 2Z1MA 4PG8A 2YHIA 3V2HA 1K89A 3Q3CA 2C7GA 4BKOA 1PJSA 4UVGA 5U4QA 4M8SA 3WQQA 3I9OA 4ZGWA 2DT5A 4FFNA 1I5RA 2PZMA 3WIDA 3NTQA 4HV4A 4ND4A 4PLWA 1LRLA 1E3IA 5EL0A 3K31A 1M66A 4DYDA 4XR9A 1YRLA 2DU8A 1NX6A 2D0IA 3QWAA 2HMVA 1PL8A 1D1TA 4XYGA 1QMGA 3I1JA 5EJ2A 5L7YA 5THQA 3V1YA 5K6AA 3BHIA 5G2OA 2QW8A 1ENYA 5ENDA 3WWZA 4CM5A 5IXYA 2FR0A 3CH6A 4CM9D 1VJ1A 1KEUA 4A73A 1P44A 4R41A 4RL6A 3ASVA 3I6IA 4Q3DA 4ZQFA 2ZB8A 3NGXA 4FFLA 3DZIA 4DWVA 2GERA 4UUOA 3KYDB 3SEFA 1NFQA 1QLHA 4ZQGA 2RAFA 1E1LA 4OAQA 3V1UA 2H6EA 4J16A 4XB2A 1LXCA 1K2WA 3JQGB 4OMUA 5ER6A 1EUCA 3GFGA 4FJ1A 4L75A 3VC7A 4KWIA 4LGVA 4WE3A 1YQGA 1E3SA 3BTVA 4LVCA 3PQEA 3IQDB 2AW5A 2A92A 4U5QA 1IHXA 2X6TA 5TT0A 3RKUA 4BNUA 4BMSA 4FJ0A 1VC2A 3W8EA 3RROA 5A9RA 1F8GA 2RHCA 2NNLD 4YACA 3WGTA 3TL3A 4I9HA 4NJOA 1Q0QA 1BXGA 1EBUA 2VZ8A 4HFMA 1HSOA 1UP7A 2B0JA 2Q45A 3CXRA 5JAMA 4MO2A 2O7SA 4N5LA 4Y67A 3D3WA 3QQPA 4CMBA 1YBAA 2ZCVA 5B4TA 5C7OO 1ZO8A 2D3TA 5CEJA 3GOHA 1YONA 2YUTA 4WJZA 3K92A 5AXBA 1A72A 4GSLA 5L51A 3FBTA 2DAPA 4W7IA 1YWGO 2IRWA 8LDHA 3A9WA 5C3MA 1U8FO 1JN0A 4JP2A 2BFMA 4M55A 4MJLA 3V2GA 3DFZA 3U3XA 3Q9NA 3JQAB 1Z82A 1Y8RB 1UXKA 3G49A 3AY7A 3UVEA 3DZBA 5ILGA 3M1AA 1I30A 3H5RA 3UHAA 4CM3A 3MTGA 5KCZA 1FDSA 3CPSA 1ZK2A 1V35A 4M49A 1HZJA 1HL3A 4WKGA 4DGSA 4Y98A 2GD1O 1X7HA 4DA9A 2B4TO 3KYDA 4RDIA 3ULKA 3PFWO 3DZGA 3MJ4A 4JBGA 1YJQA 1OOEA 3DZKA 1SOVA 2ZYDA 4Y6SA 3MJVA 3S2FA 2O3RA 3DB2A 3MJSA 1QYVA 3GVXA 2DBZA 4RF2A 3TFQA 4DMLA 5DCUA 1ZIDA 2PGJA 2VT3A 5A4DA 2VCYA 4PLTA 3F1KA 1WVGA 5EQFA 2I65A 4FGWA 4BKQA 3PVZA 1KVSA 3QY9A 4GMGA 4R68A 4DIFA 1D3AA 3WSWA 3VH4A 4AJ4A 3DAGA 4I5EA 4R1SA 3LZ6A 2FSVA 1N1GA 1W4ZA 4R5MA 2Y67A 4LCJA 1KVQA 2OP1A 3KEOA 3K73O 3PWZA 3WGYA 2AG5A 4PFJA 2YDYA 3FNFA 1R15A 2ZK7A 3DOJA 2FPGA 4OL9A 3TQHA 2ZTVA 1S6YA 1E3LA 4PIVA 1MP0A 3ZWXA 2FWMX 5LCXA 1SZJG 3ITKA 1Y1PA 2WYUA 4NNJA 1FDWA 3BZUA 5K6AC 1ISHA 3Q2KA 1K0UA 5EIOA 2NQTA 4E4YA 2VNAA 1Y6JA 5JYDA 3PQDA 3EY4A 5A9TA 3QJ5A 1DJQA 4E13A 3JQ6A 5EESA 5L45A 3RU9A 2O2YA 2NVUA 3EW7A 3AU8A 1A7AA 1E7RA 1K3TA 1U5AA 3DZJA 1M2WA 1Y5MA 2C59A 1U2GA 1O8CA 1DSSG 1ISFA 4CMJA 3U62A 5A5FA 1HYGA 4ND2A 3DDNA 2Y93A 1U5CA 3DQPA 4F46A 1VL6A 1E7WA 4E21A 3SX2A 1NWCA 4XDZA 1V8BA 3PYXA 2JKVA 5G0TA 3RFVA 3PQFA 4E5MA 4FDAA 3RBXA 1R0LA 4GGPA 4J9VA 4DLAA 2HUNA 2JCXA 5JAZA 2B36A 1KY5A 2Y1FA 3RUDA 4NZ9A 1DC6A 1P1FA 3KVOA 2O4UX 4CQMA 1WZEA 4NQZA 1QSGA 4R51A 3E03A 2GZ2A 4J0FA 4OQZA 3RUHA 1Q2XA 4IMRA 3WNQA 4TRMA 1PX0A 2GLXA 1KBZA 3U4DA 4CM8A 5TRTA 4FPXA 2PWZA 4HADA 2ZIZA 3PRJA 1P1HA 1PZGA 2O23A 3GEDA 4AL4A 4MVJE 3JQBC 3R0IA 2WYVA 3R3SA 1JVBA 4E2WA 1N1EA 4K26A 4CLXA 3E5MA 1XQ1A 3DHYA 3LU1A 4E30A 5DT9A 2IEBA 4FBGA 3H5NA 4JGBA 5IDWA 1PJQA 5HA5A 3W4JA 4BNVA 2E37A 1XU9A 1JAYA 4YA6A 1S7CA 1BXZA 1DAOA 3Q11A 2Q99A 1X1TA 2GASA 4FD3A 2X9VA 5BNFA 3WJ7A 1SB8A 1C1DA 4MINA 4BQPA 1F0YA 4FCCA 1Y8QB 2FHSA 1MC4A 4BUCA 4P4NA 3AUTA 1H93A 2JD0A 4N18A 5JO9A 3TRIA 2ZJ0A 4UEJA 1AUPA 3LSYA 2YFQA 3INGA 1H2HA 1LNQA 2X1HA 1G0NA 3GA0A 3GHYA 4KDFA 3RC2A 1IPFA 3OQ1A 2JFGA 3ROKA 1CF2O 3X2FA 1VPDA 5JDCA 1KIFA 3QSGA 3OIFA 4WCFC 5C7IO 4U8GA 1KVTA 4XYBA 1O0SA 2BFAA 2NU8A 4IDGA 2NU7A 3ZZNA 3BYZA 4KOAA 3ST7A 1QKIA 3ZHXA 5JAQA 2FPIA 1R4NB 4R01A 3R6DA 4J1TA 1U3UA 2IZ0A 5G0SA 2F00A 4Z9XA 1R66A 3PHLA 4KQWA 4RZHA 3W6ZA 4UEKA 3E8XA 5JBIA 3MTJA 3GDGA 3HFGA 4GKVA 5F21A 2AEFA 3GZNB 3ZWVA 4CV2A 4EJ6A 3BAZA 5ADHA 5L9AA 3WGOA 5HWSA 1NNUA 2NQ8A 2UVDA 1LUAA 5JW6A 1ULUA 4B4OA 4YPOA 4NFYA 5CG2A 1GEEA 4WASA 5FI3A 4ONEA 2O3JA 4EITA 3S8MA 3W4KA 1BGVA 4NK4A 2VHWA 1HKUA 2BF7A 4INAA 2P5YA 3L0DA 5KOIA 1HETA 2PLAA 2DUUA 3D4NA 4X54A 1WMAA 2Q3EA 2X0JA 3R3JA 4YJDA 2EP7A 3AU9A 4I5FA 2CUKA 1ZSYA 4OXNA 4XEHA 3VZPA 1R0KA 1JWBB 3FN4A 5DULA 3ZI0A 3B1JA 4WCFA 1U3TA 4QQRA 4WEOA 3ROPA 4PLFA 1P74A 4UVDA 4M87A 1R0SA 2QZZA 3GF4A 5KVVA 4YEDA 5BSGA 4ZN6A 3WMWA 4B4VA 1EVIA 2Y1GA 4DVJA 3D7LA 3Q6IA 2P68A 3CUKA 3PGXA 2HCTA 1KS9A 2DBVO 3DHEA 4E2XA 2NWQA 4DIOA 3FHLA 1E7MA 3W4IA 4BNHA 2AHRA 2PY6A 2P5UA 1Z7BA 2C20A 4IXWA 3KRTA 2YHUA 1I3MA 1R12A 1T4DA 2Q46A 4KQXA 4E2ZA 4DUPA 4IQ0A 1I2CA 2YW9A 4N5NA 3RWBA 5LDGA 1VSUA 4MVJG 5IZ4A 1A4UA 4AFNA 3AM4A 2VZ0A 4XD2A 2DBRA 5AOVA 3ONFA 3FTPA 2J8ZA 4NJMB 3RFTA 4TROA 3M6IA 2X9GA 5L3ZA 1DXYA 3RASA 5T6BA 2XPCA 4WUVA 4ZICA 1FXSA 5FI5A 1PJLA 2HJSA 4Z9FA 4O59O 1RPNA 1PQPA 4K9DA 1GCUA 3LC2O 5DBGA 3O03A 2AQKA 1D4FA 1QYXA 1ZNQO 4O63O 5DOZA 5FFFA 4FSHA 4OYRA 3AUSA 3GGPA 4KDEA 3UGKA 1YB1A 4ZU3A 1I0ZA 4M54A 3PXXA 1V3VA 3PEFA 3GUCA 4CM4A 4B7XA 1WDMA 3IKTA 2GO1A 4LCEA 4BV8A 2PR2A 2OHXA 3DO5A 4YBZA 2ZYAA 3JQDA 1I3LA 1G1AA 5JS6A 1UUFA 2J3JA 2YV2A 1MC5A 4AJOA 3PHHA 3U09A 5A9SA 1UXJA 1LC3A 3JQBA 3JSAA 1BMDA 1YOVA 5H81A 1U4OA 2NVWA 1R16A 3QV1A 4WCDA 1GV1A 2BD0A 2ZQYA 1ONOA 2NADA 4NIMA 1DLIA 3CE6A 2RH4A 4MVJA 4TKLA 3GZ4A 3EDMA 1B8UA 5L4LA 4YCAA 3OA2A 3C7CB 4GWGA 3WGIA 1PZFA 1NR7A 1XYGA 3AWDA 3L4BA 1FDVA 1WXDA 3AOEC 1PGNA 4Q3EA 5DCYA 2VUTA 2GN6A 2BGMA 6LDHA 1DFIA 1ZJZA 4M1QA 4CR6A 1C3VA 4YRAA 1I2BA 5IXSA 2Q50A 4FOSA 5A05A 3WTCA 4EW6A 4IY1A 1F17A 4NBWA 4UUPA 4BMVA 1GR0A 4DREA 1KEPA 2W2LA 2EKLA 3QWBA 3ZHZA 4PLVA 3VTZA 3ADOA 1EQUA 4WEQA 3BMCB 1PGQA 3NAQA 2QHXA 1Z73A 3SXPA 3U49A 1P0CA 5CDSA 3HJAA 2J6IA 1I3KA 3FWZA 3AJRA 5IAAA 4FOOA 5TF4A 2JHFA 2QRJA 1EMDA 1P1RA 4YJGB 1QV7A 2Y66A 2Y1OA 3HWRA 4Y6RA 1X13A 3DL2A 2OMEA 3DBHB 5JDIA 1KC3A 1RM0A 3PJGA 1PL6A 2EV9A 2GSDA 3E18A 2X58A 3EGOA 3OIGA 3H3JA 4YQZA 2CVQA 3FWNA 3WBBA 1A9ZA 1MXFA 2VT2A 1LDMA 1X0XA 3ITDA 3W6UA 4UVHA 1HZZA 1MX3A 2VUUA 4RCVA 1WW8A 5FEUA 3ICCA 1SMKA 2UUOA 2TMDA 4PG7A 4NBVA 4DXHA 3WICA 4RQTA 1LEHA 3HADA 8ADHA 2YY7A 1N7HA 1F12A 3LLVA 4CV1A 4ZJUA 3OH8A 5J23A 3VVCA 2W4QA 1SEVA 5BR7A 4DQVA 3AI2A 4J7CA 3CINA 3DBLA 5COAA 5JO0A 4NK5A 4UULA 4BOYA 1YL6A 4KTVE 4MVJD 3AOGA 3N7UA 3PTZA 1PJBA 1YGYA 3LF1A 1OC4A 1Z75A 2HRZA 4RVFA 2X0NA 3D1LA 4N5MA 3RFXA 2IDZA 2WYWA 3ZWPA 1NBOA 3PHIA 3ZNQA 4J7UA 1O5IA 5A9SB 3JD0A 1A9YA 1X14A 3AM5A 4E33A 4IQ8A 5F5NA 4GLOA 1XG5A 4FR5A 3RUEA 3GRPA 3DOOA 2NU6A 2VRCD 2X4GA 2DTDA 4B4UA 1UXHA 3C8MA 1U3WA 3H9JA 3WBFA 9LDBA 4RDHA 3UXYA 4J3FA 4NBTA 1OFGA 3B70A 3ZU2A 2PKQO 2PZKA 4II3A 1R37A 1HWYA 1XKQA 1NVMB 1T1SA 1XQ6A 3TZHA 4UEOA 2JFHA 3OQBA 2VWQA 3L07A 4XQ9A 5AXCA 3ORFA 4NFHA 2W98A 3UW3A 5GZ1A 4BO2A 2DVMA 2I5PO 1ADGA 3ZHYA 1XEAA 1HEUA 1YBVA 4L9RA 2XF8A 4OOEA 3X2EA 2OGUA 5COQA 4UAGA 4XIYA 3U9LA 3VZQA 4DPLA 4EGFA 4XRGA 3C85A 4BV9A 5B4VA 2CY0A 4E5NA 1E77A 1NAHA 2C2XA 4G65A 4BHTA 2E49A 1K6JA 3JYOA 4BO5A 3VOSA 4XIJA 3NUGA 1FDTA 5DP1A 4BO1A 2Q1TA 1PGPA 2NACA 1WLYA 4YJFB 3D0OA 5JY6A 3PYMA 5CPFA 4B8ZA 1J6UA 3O8QB 3WR5A 3QP9A 5FYDA 4QFDA 3SC6A 1Z74A 2VHYA 1B8VA 2PK3A 1PJTA 4WGGA 4U0KA 4IS3A 1YDEA 1U1IA 2WJPA 5A1TA 3IDSA 2OL4A 4K6FA 4NBUA 1V9LA 4L4SA 4GSKA 4XR4A 2WWRA 1X15A 3S55A 2D1YA 1YKFA 1B15A 2O3SA 2YFHA 3LF2A 5G4LA 1DIBA 3LT0A 2EW8A 3OQ6A 3PK0A 1NVGA 1EBFA 4J1NA 4OSPA 1B3BA 2PD6A 2R6JA 3LVFO 4NU6A 3I9NA 2BMAA 3IJPA 1J49A 1QYCA 3OJOA 5TIIA 4W99A 4GX2A 2IYOA 2VWPA 3RJ9A 4Z3KA 3TJRA 1QRRA 4YJFA 4BNTA 4Z0PA 1GTMA 1VKOA 1ZEJA 1TI7A 2PNFA 3H4VA 4OQYA 4YJHB 4CMCA 3TWOA 4A26A 3PPIA 4RPJA 4W4TA 3KETA 4BKPA 3JQAA 1E7QA 1I24A 1RYEA 1ZK3A 1AXGA 4JX8A 2D4AA 3OP4A 2P4HX 1ADCA 5MDHA 4Z0TA 1T1RA 1VKNA 5ICSA 4CM6A 2WTBA 4HFNA 3DZFA 5COBA 1B2LA 1PR9A 3HDHA 3LT4A 3TL2A 3BTSA 4NBRA 5T8KC 2G76A 3HB4X 4MP3A 1IE3A 2OORA 3NTRA 1H5QA 3WXBA 2DTXA 4OSOA 1E5QA 3GVCA 1QR6A 2AG8A 1E1KA 1SBYA 2D59A 3H8VA 4GWKA 3ZW8A 3KB6A 4RQUA 1PL7A 1ADBA 1NXQA 3IIEA 2Q1SA 3MJCA 4LISA 3SJUA 2VYVD 2CZCA 4YAJA 4C4OA 4HNHA 5TNXA 2PFGA 3JQ7A 5A5EA 4LSWA 3AI1A 2CDBA 3GNTA 4J9UE 4BVAA 5A06A 3NTOA 2X9NA 4OHUA 4R1NA 2JD1A 1NASA 2E48A 1VSVA 4PLPA 3ETGA 4CUKA 5I7EA 1JKIA 5DZSA 4ID9A 4JQCA 4PG6A 5LC1A 4LK3A 5JSFA 4WLNA 1MUUA 1H9BA 3TN7A 3ZHBA 4BNGA 1P31A 4GVLA 4OXKA 4M89A 3D5TA 2I6TA 1PWXA 4CMHA 5JC8A 2DUWA 3DBLB 4CR8A 5ENVA 2X5KO 1VJ0A 2DLDA 1OAAA 4J6FA 2HMTA 4IZHA 3E82A 2GYYA 1FK8A 2NUAA 3JTMA 1UXIA 3PGJA 4XA8A 5JCXA 1H94A 1YB5A 4LW8A 2EHDA 4WPGA 2VHVA 1PWZA 1PZEA 1ZW1A 4JJIA 1D1SA 1I33A 3ZU4A 1UDAA 1TEHA 4D44A 3K30A 3JYNA 4JN6B 2C82A 4MKRA 1Q7BA 2Y1DA 3MWEB 3QWFA 1ZMTA 3WLEA 1YO6A 2X7HA 3RBZA 1DRUA 1LQTA 2GZ3A 2WD7B 4RPLA 1G6KA 1PTJA 2Y1EA 4PVCA 3DWFA 3WQSB 2SCUA 4KTTE 1R4MA 3HQ4O 3UN1A 3DR3A 3JD1A 1I2ZA 2BGLA 2OOSA 3B20A 3OJLA 2BGKA 3ZV6A 5B1YA 3GVIA 5L4NA 4CMEC 1P45A 1NTOA 5C7LO 3VZSA 1A27A 1NQOA 1GUYA 1Y9AA 2BKAA 2E6UX 5CAEA 2FZWA 3DAPA 3GHHA 1QV6A 2PD4A 4YT2A 1E7YA 3GPIA 3ZWWA 4CUJA 4CJXA 5LDHA 2I67A 1TB4A 3NDIA 4ZA2A 1LSOA 4L4XA 1JU9A 4BO9A 1YL5A 2DKNA 5DF1A 1XWFA 1Y9EA 4TZKA 3H7AA 3EVNA 4E5KA 2UDPA 5IDXA 4XKJA 1CETA 1CERA 3ETEA 3I5MA 4RVDA 1V3UA 1GCOA 4A10A 4YT4A 4FC6A 4GI2A 2HDHA 1LLCA 3DBRA 4NH4A 3EHEA 1UP4A 4TRRA 4IM7A 2B69A 1JKJA 1LSSA 2DM6A 2GDZA 1GZ6A 4MKZA 4I08A 3OSUA 2EKPA 3H9UA 2ZB7A 3C24A 3K9QO 1O95A 5F1KA 3GUYA 4WOKA 5EQDA 1PS8A 5H82A 3ZH2A 2P9GA 3I52A 4TWRA 4BB5A 4QTZA 5KTKA 1NHGA 3E9QA 1P1KA 2HU2A 4OXYA 5A3VA 3VAZA 1JAXA 4NFSA 2OP0A 1LQUA 3GAFA 5H83A 2WD7A 1ULSA 4H16A 3DZHA 3RCBA 3VTFA 4PN3A 3ZCXA 1D7OA 2GPTA 3GDFA 4BO3A 4D46A 1GV0A 1MGOA 4DC1A 3QVWA 4OH1A 5CG1A 1PQWA 1UZMA 1QG6A 3V1TC 5JDIC 3FRJA 3IMFA 3A1NA 2C29D 1XSEA 4MVJI 1H9AA 4TKMA 4OM8A 2B5VA 3W1VA 4B8WA 1BXKA 1XGKA 5JAIA 1E1NA 3T4EA 4D43A 3LT2A 1NHWA 2FP4A 2A4KA 1O9BA 1UXGA 2QRKA 4KUGA 1BRMA 1T2DA 1ENPA 5JY1A 1HTBA 2QYTA 4D0SA 1T2FA 1DDOA 4A03A 1VI2A 1Y7TA 3GVPA 4HY3A 3KUXA 3I3OA 3KLMX 4XGNA 1KERA 1VJTA 1Y81A 1CRWG 4GAEA 4ZQHA 4L0QA 3UUWA 2A35A 4BO7A 5L7TA 4IPTA 1GEGA 3RJ5A 1E3WB 3IS3A 3W8DA 3JQ7B 3HUDA 1CJCA 4E5PA 3DXFA 4L74A 4Z9YA 3ZV5A 5KJ1A 3IKVA 1UAYA 4FN4A 5L53A 2EGHA 2EP5A 4G5HA 4I5GA 3JQFC 5KJFA 3CMMA 3VHRA 5CDGA 2ZB4A 1CIVA 4TVBA 1ZFNA 5HTOA 4TZTA 3BMQB 4J91A 2P4QA 3DBVO 3GPDG 2IZZA 3ENKA 2XXBA 1NFFA 4FFPA 2C7VA 2JCYA 1XA0A 5IJZA 3FI9A 3ZGYA 4KMSA 4ZRMA 4CLRB 1B14A 2E82A 4E0BA 2FRDA 3GLQA 1E6WA 4PVDA 1KOLA 2EJWA 4J90A 4YWJA 1T2AA 3ZWNA 2DBQA 1L1FA 4F3YA 1UJMA 4YRDA 3UOGA 1ARZA 1XIVA 3U4IA 3ABIA 1WAMA 3C1TA 1OBFO 3U4HA 3ANLA 1HF3A 4AJPA 4PRKA 4Y9DA 4E3ZA 5G4KA 3KSUA 4EUFA 1JW9B 5HS6A 2J3HA 4AG3A 1MV8A 1GQ2A 4Q3BA 1LDGA 1P0FA 4BMNA 1HXHA 1T26A 2ZKLA 1E5LA 3HDJA 2UUPA 2W2LD 3GEMA 3GR6A 5B4UA 2EXXA 1NM5A 4BNLA 3BMNB 1Y8QA 3QVOA 4GX5A 1Q7GA 2BFPA 1BTOA 1NP3A 4WLEA 4LN1A 4BNNA 3E9MA 1QXSA 3F1LA 5GZ3A 1EFKA 2LDXA 4TRNA 3U5TA 3AUUA 3NJ8A 3NYWA 5TT1A 3ZN2A 4AJLA 3AFMA 1ZK1A 2IXAA 3L4SO 4DQUA 3GN2A 1LRKA 3H2SA 1IULA 5U1PA 7MDHA 1HDRA 1AN9A 1B0AA 2J5RA 2PH3A 4XCVA 3LT1A 3AY3A 3QVSA 4YVFA 4J2OA 2QZ9A 3IJRA 3ZU3A 3WG9A 4B3JA 4MDHA 5JLAA 2ZJ1A 1NQTA 3WGZA 3B1KA 4NI5A 4PLYA 3SBOA 1XELA 3D64A 4WK6A 2AXQA 4TQGA 2GCGA 1IL0A 4K6CA 2DTEA 1VRWA 2I3AA 3INTA 3GZNA 3MJEA 3WGGA 1SEPA 3I83A 2QX7A 4J4BA 5BSEA 5HRUA 1FJHA 1SOWA 4PRLA 1BDBA 3QHAA 4J0EA 3PZBA 4XWYA 3VDQA 3PIDA 1LA2A 1LJ8A 2UV8A 1L7EA 4A0SA 1GZ3A 4ZD6A 4CQMB 5L4SA 1IZ9A 1GDHA 2EJVA 5IN4A 4E12A 2EEZA 3F3SA 6ADHA 3OICA 3NGLA 1ISGA 4R69A 1RM4A 2AE1A 2DQ4A 4XRRA 5CPBA 3EZLA 3QVTA 5GY7A 2W90A 2O3QA 4PZDA 2PZLA 1NQ5A 1NQAO 4XDYA 1H6BA 2D8AA 1FF9A 1RM5A 1MG0A 1N2SA 3MJTA 4RLHA 3S2GA 4J1QA 3SJ7A 3WS7A 4WCFB 1T4BA 2AQIA 5MGBA 4BNWA 1CEQA 4B4WA 3LYLA 5KJEA 5F3RA 4LMRA 1YQDA 2NSDA 1YQXA 3VKUA 1X0VA 1EK5A 3P7MA 5TQVA 4ZRNA 2G0TA 1LSJA 3FNHA 2YQ5A 3JYLA 2PKRA 5DBIA 3KYCB 4IIUA 5JDCC 3ZWYA 2FR1A 4U6SA 5T5QA 4OKIA
chains in the Genus database with same CATH superfamily
2HHCA 4XUDA 2HF8A 4X0EA 2G1UA 2FTKE 1RI4A 1TF2A 1IXZA 4ZAZA 3TTWA 4B35A 2VF7A 3H9EO 4C08A 4B6SA 5HW0A 1ONPA 4FZVA 3JRNA 4RAQA 1FMJA 1C5KA 3HRKA 2GK7A 1T0IA 1M2KA 1XU7A 2XRYA 3WTBA 5LP6F 5JYBA 2IHUA 1IH8A 3MS2A 1GGKA 2D4HA 1FSFA 2X23A 3AW9A 3D4IA 1WNFA 4JUCA 4L27A 3AFNA 3FFXA 3VVMA 3O2SB 4YHHB 1MB2A 3BBLA 1F0KA 2AZ4A 2TYSB 3JQGA 3S29A 2ZE5A 2ZJ3A 3INNA 3V5NA 4D79A 1WUKS 1S8NA 2EQAA 3S2EA 3WIOA 1NRJB 2OZVA 3B1XA 4C07A 4YV2A 4RHFA 1DIRA 1RQGA 1IXKA 3SYMA 2ZXUA 4MUKA 5TMEA 1N0HA 1JDUA 1SIOA 2Z5LA 4KGDA 4MV6A 1OYOA 5EKTA 2CUZA 4X3OA 4WD3A 1YJBA 4YP1A 4UNRA 3GEPA 4Y9SA 5TEWA 4A8PA 4Q93A 1ZGJA 3RVKA 3TLYA 3ASYA 1XLTA 4UD6A 5C8XA 1NLFA 4WKBA 2ZM6B 1K66A 5BV0A 3D2BA 3TTVA 4LE0A 5FOSA 5KYNA 2AG1A 1Z4PX 2VI5A 3OCXA 4HQOA 4XOUA 4Z5XA 1R6AA 4DIMA 4WWHA 1E5TA 4AQDA 1AKMA 5FO0A 1KK1A 3SZUA 4XM1A 3IKJA 1B1AA 3HGQA 1XMXA 4TSFA 2LXNA 1ZJYA 3M49A 4G5XA 5EI5A 5B7PA 1UODA 2XIQA 3MUEA 4MPTA 4WVFA 3X44A 4Q39A 2W2KA 3FVTA 3L0CA 4MA4A 4DSUA 1Z63A 3VTAA 1R8QA 4V3CA 2PUJA 1E94E 1YAHA 5EJGA 3V48A 1JHYA 3EXEA 4URFA 4XQCA 2CLFB 4J2HA 3RAJA 3WLFA 5LQNA 2SCUB 1X42A 2PVSA 1EZ4A 5AHWA 5L3QA 1NXXA 3UKOA 3JWIA 2XB2A 3AF5A 4ESVA 2E1RA 2I3GA 1YFJA 3LUAA 4CRWB 3NEJA 3PUKA 4FLEA 2NO4A 1JHZA 10MHA 3OZTA 1W7AA 1B42A 3I2FA 4Y7CA 3BTUA 1DWQA 4K3UA 1FE8A 4L0CA 1PEAA 4KPUA 4CTJA 1XVIA 1OA1A 2C9BA 3PT9A 1C1DB 4XX0B 2J5QA 1MC1A 4KNWA 3GPLA 1H2BA 1DI0A 2W6PA 3I2JA 3UGQA 4GT1A 5JQGB 4MGKR 4C0XA 1JFFA 3HYRA 4JNKA 1UJ6A 4J3JA 1CRQA 1L8LA 5GONA 3AGQA 4R9RA 2A1UA 4UQPA 3O92A 3I6ZA 4B44A 2ERCA 2C07A 5A2GA 3JVIA 1DEHA 2DWOA 1R0BA 1PS0A 5F2KA 2OXTA 1PWHA 5CAEB 3RTGA 1MIOA 3VPHA 2CYCA 3EF1A 3TXAA 4DBVO 1UBCA 5BWCA 1NF9A 4XFDA 3LUFA 5BVHA 3DMGA 2PKQP 4AVYA 3U7QA 3JQ9C 3AUAA 4MYDA 2LVBA 2A5DA 3EDYA 3KQLA 5ALMA 5IPFA 1ZI9A 4ZIRA 2VUHB 4EENA 5CM9C 5I45A 2GXAA 2J0QA 4L4UA 4KXUA 3HU5A 1NVVR 3OF5A 4YRNA 3VPXA 1RJ9B 3I9V1 4EUHA 2GN8A 4HF7A 1ABEA 4TWAA 2G0NA 1YJ8A 3ZNOA 4B6JA 4G56A 1NOJA 2WTNA 4LDQA 5AM4A 3IDFA 5FWAA 3S2IA 2FI1A 3PDUA 4J4TA 1YZTA 3NKLA 3QXJA 4EQ6A 1XL0A 1ZNYA 3IBCA 3LTEA 3SQOA 2CYBA 3WK5A 3WGQA 4MVJF 2JJ1A 4BEVA 5DLPA 5CBPB 1KR5A 5C32A 1XQ9A 3X1KA 4QNMA 4AXXA 3IBTA 2Q2VA 5E4FA 3TRHA 1C29B 3CE9A 4J16C 1LPOA 1Z7GA 5ICCA 2H2IA 4S1NA 5F33A 3GP8A 1TUIA 4PC1A 4WBNB 3OQIB 1KFKB 3IQWA 1AS2A 1WSWA 3LO5A 3KLPX 1C50A 1P17A 4GVXA 1M6WA 3TZ6A 2D2IA 1Q44A 2BFEB 3MGKA 3CVWA 2EEPA 1Z5UA 5CD1A 1P9LA 2Q41A 1YS6A 2WM3A 4W5HA 3SWWA 3II6X 4RPGA 3BDAA 3JARB 3ZIUA 1U4SA 4KXMA 5FDFA 2C61A 2HQOA 4OJNA 4DLKA 1O77A 1P4SA 4D3DA 4IIGA 5HCIA 3ZDCA 4H6WA 1NC3A 2XCOA 3R23A 4AULA 3P5SA 3WLQA 5CVTA 5AXDA 1UADA 1RI1A 1ST3A 1UMCB 2HAEA 2Z6AA 5F1PA 1GG2A 2Q07A 4UNPA 3SNKA 1VFPA 4GR9A 4KU4A 2BELA 3SC4A 2UUBB 3PLAE 2FDXA 1WPQA 4YJGA 4URVR 1JG6A 1I4OA 3KYCA 4LY9A 4MGHA 4JH0A 1EEHA 1SXJA 3NWPA 4IOMA 5LB4A 3WB2A 1ENZA 1KS2A 1CRPA 5K3OA 2XB8A 2ISQA 2H2WA 3N70A 3HFRA 4HDMA 3EPKA 4TL9A 3LVQE 3KQUA 1SXQA 3DMTA 1P5HA 3OFJA 3T1TA 1D2MA 1O5TA 2NTNA 1NT4A 4JXKA 1W5BA 3SAJA 5A5GA 1J5EB 2VSNA 4OQ4A 1MEJA 4XJXA 3R7WA 3WQHA 5F4ZA 3G9XA 5C8DA 4UNNA 2J0VA 2ATVA 2B4QA 3EEFA 3K16A 3QFRA 2QI9F 3RBAA 4L0MA 5FJIA 4B09A 2YJ4A 2BR4A 2OMKA 1QH0A 2OO5C 4JIMA 4BQRA 1LSUA 1ECJA 5F2OA 1Q6ZA 1WQ4A 5CVCA 5LQAA 1KWKA 3VR5H 1OIVA 4AJKA 1PFKA 5J58A 3W7AA 3AHDA 2CB9A 4RHEA 4ZO6A 3OM9A 4GLFA 5IVIA 1Z4KA 1KQFA 3ZCRA 3HJCA 1M73E 4LXHA 5REQB 1T4MA 1OVMA 4BZQA 1QHIA 2YZ2A 3A9CA 4GBJA 4WY2A 1I36A 1X94A 2FSHA 3MZ0A 3C7AA 5CTAA 5K6TA 2J85A 5KQPA 2XUGA 1YKSA 1QP7A 4S3MA 1FSSA 2B35A 3I34X 4KWHA 4FFRA 1KZYC 3HG7A 2CVFA 4GOND 3QSYA 3OJEA 4A8JC 4D1YA 3PWSA 4OYYA 4PAOA 1J42A 4BVGA 4LXQA 3L7LA 4MS1A 5KSPA 2ORWA 1NF2A 2FKNA 4KRXA 4ARSA 4Q9AA 1SHTX 2Q5JA 3R3ZA 3R9IA 4EB6A 2IX3A 2D13A 1M7BA 1ZK4A 1T8WA 2QTBA 2UYQA 3O2QB 4ZAVA 5JWOA 1QX4A 2YZKA 2QN2A 3QH4A 2J09A 5KJ6A 3I28A 4QNRA 4UTOA 1RLTA 2G80A 1Y1TA 3N2NA 3ND5A 3Q0IA 4N5IX 5JCJA 1CS0A 2YXBA 3N0XA 3NALA 2I6SA 1J7JA 2BDUA 3Q7SA 1CUJA 4GMKA 1XZGA 2V6FA 3TAHA 4CT4B 3EC7A 3ER9A 2FH5B 4GE0A 1GU1A 1GFWA 1NAIA 3SQDA 3DEHA 1IZZA 1GL3A 3KVYA 5H7XA 1MMFB 4B3DA 1ZJ4A 1JFRA 1F06A 1OLUB 2PS3A 4CF6A 1SQ5A 3O4VA 2P9EA 4KQ6A 3Q7EA 4MRRA 3JYQA 4AICA 2C8KA 2ZRHA 3PQ5A 4KP7A 3D1VA 4N82A 9LDTA 2C4HA 1DWPA 4QVIA 1DCTA 1U99A 4LE2A 4Q3KA 5ICMA 4TX1A 1ICIA 3PFHA 4RVSA 3KSMA 4RK7A 2ZS8A 2C1EA 2OE2A 4MB2A 3VYWA 4DA0A 4E15A 2HMSA 1IXSB 1PV4A 1F0PA 5TGTA 5BN5A 2WNHA 4MQLA 3OAAA 3EXIB 3PQ3A 1G7RA 1W5EA 2W2KB 2HJGA 4ND3A 4GZ3A 4BMOB 4DV0B 3DG9A 3B5EA 3L7YA 2FR8C 2GUGA 2QQ5A 3QMPA 3ZD7A 4CEJB 2VJDA 3C3MA 4HVAA 4C6RA 4EYKA 1DL5A 3B60A 4RNCA 3I58A 3IP1A 3OC6A 4ASUA 1CY0A 5K0EA 1F6BA 2D1FA 4XDGA 2E18A 3HJBA 3HVUA 2CW5A 2QTWB 1NYLA 3G2NA 8AT1A 5IZCC 1ADFA 1EGQA 1QQTA 1XTTA 2PL9A 4FBMA 1P72A 3ABZA 5ILOA 2WLSA 1H6AA 3UK0A 3MQ2A 3AVQA 1WMDA 2BGIA 2LDBA 5SY4A 3W5JA 3ZQUA 3H0KA 5HF5A 3A6EA 1LY1A 3QVJA 2PZ8A 2QL6A 2Q0HA 4LJYA 1NN3A 4P38A 1G3UA 2XOKD 4TQAA 4ARZA 1QRAA 5C18A 1GPDG 2FQXA 4K6OA 3UICA 4XWGA 1S4QA 3UG6A 4B9EA 4D8TA 5B12A 5IF3A 5KOJB 1ZY2A 1EX7A 1WG8A 2E6KA 4ZT3A 3JPWA 3SHVA 1DOAA 3HUEA 3Q3VA 4ZWNA 3BJRA 3BL6A 5A6VA 5C53B 4H7EA 1FFDA 3PXGA 1NMSA 4DDMA 4PNEA 3TZLA 2O2XA 1V45E 2M9MA 3L2OB 5EE1A 2FAXA 4EMUA 3KTDA 3ZCPA 3A4NA 5DGIA 4MYUA 5KNDH 3N6RA 3HFGA 5K0BA 1XEFA 2B2NA 2B8JA 2QROA 3FMIA 2RH9B 2AFHE 1U8ZA 4LV5B 3VKGA 1VLJA 1H1TA 2CLDX 3HNOA 1P4RA 4P4SA 1B00A 4QIHA 4WRRA 4MUJA 5GAJA 4U1RA 4CKEA 2IYEA 5HVNA 1FZQA 5A3QA 3MNFA 3OE4A 4QE3A 1YASA 4RADA 2CLIB 1R0YA 2HC9A 2GXUA 2G25A 1K4KA 4GM1A 5JH7F 2A57A 3FGNA 5SY6A 4NVRA 4X8LA 3X1DA 821PA 1GQFA 1OAOC 1P5FA 4TTQA 4J0QA 3OECA 3U13A 5C51B 3MT0A 3BWXA 2PTGA 5BT9A 3RIHA 2IUSA 2B1RA 4BVEA 1A9SA 3R77A 1U80A 4FS3A 3OCWA 2I9KA 1AZWA 3W2IA 2BBSA 1SXIA 3R9XB 3PE3A 1JHAA 1NF8A 1CBUA 1OB2A 4G0VA 2QAGC 2H8KA 3AGPA 4YB8A 3DE4X 2J3KA 3N2ZB 4ZT6A 1OI7A 4XPIB 1E3JA 3DULA 4IHKA 4CMEA 4A15A 2R2GA 1S4MA 2XECA 3LY8A 4H4EA 5A4KA 3O8NA 2GNOA 2JBAB 2Q3CA 1EK2A 2QIOA 3N58A 3EC1A 3TBFA 2ZZNA 4JS0A 4AJNA 3HUTA 1FRFS 3G13A 2C5BA 2DWPA 4GQBA 1RR6A 4RHYA 4I1VA 4L7VA 2OV4A 2EFEB 4IBOA 3H4TA 2ZR9A 3N53A 4AT1A 1A97A 1OILA 3M9LA 1P8AA 4P7BA 3SS7X 3H9QA 1UBSB 5F98A 4J4HA 4P4GA 4ITRC 2Z2ZA 4R9UC 3TB6A 4CKCA 4QGHA 2NUTA 1A04A 5I5EA 3H5AA 3DWEX 5HTKA 4R81A 1C9KA 4AJJA 3KWFA 1MENA 6REQA 2WU0A 1BKYA 1TA4A 1B8PA 3KJIA 3L1JA 3N0RA 4U7PB 4EI8A 4ZYUA 5FPKA 4X3PA 2OBYA 3ESAA 2O54A 3COVA 2V98A 3KEFA 1FFWA 4UBNA 4POOA 3M6FA 1N32B 4ZTBA 2EBHX 4OGFA 4IHQA 1HDZA 5CT6A 4OO3A 5LP6C 4L07A 2PBLA 3EPRA 2C78A 1T6BY 3TTUA 2RD2A 3D6NB 4DSAA 1RYHA 1T3LA 3OPYB 5AT1A 1C7ZA 1J4AA 1QQ6A 1GD1O 1NLYA 2JGAA 3RK0A 3URKA 4O08A 1DBIA 3GG2A 1MR3F 3GAAA 2RC6A 3ESZA 3K4PA 1ZM9A 3PL5A 3VDRA 3THXB 3QRWA 3VR1A 2VOEA 4RABA 4DLLA 2IHJA 2EGGA 3I9MA 3LT5A 4P8RA 3Q2IA 1U8EA 3B7GA 3DJFA 3P4XA 3QVGA 3ZY5A 4GMFA 2Q2OA 1KAMA 4HGYA 5ITWA 3R6GA 3FSRA 1VJ5A 1CY4A 2AJDA 3OT1B 2VF4X 3R5KA 1A4XA 4R0MA 1RI5A 1TYZA 1VIMA 2X6QA 1U7ZA 1Q74A 2B37A 3NUZA 4PC3A 2ZRJA 1UWKA 1M74A 2WTXA 3KJGA 2ARKA 2HQ1A 4LHYA 5CB4B 4E07A 2O8DA 1DFHA 2QVLA 2GN0A 4G85A 5EHXA 4PV7A 4M38A 4NX2A 4M4SA 6GPBA 2H7CA 4DVGA 2QTAA 3RFCA 1PJ4A 2VP0A 3F3KA 1LFDB 5HCNA 3EG9B 3ETDA 3RIGA 1TGYA 1U81A 3CQ9A 4HAOA 4E88A 4JK3A 3DMNA 2H63A 1YDGA 3H9GA 2XNSA 4D0RA 2V54A 3ONEA 4EYEA 5AHRA 3ZDBA 1EA5A 4EZBA 2HU8A 3C3WA 2R7MA 3BMNA 3KIPA 5ALWA 1ZH0A 1HNXB 4HFJA 2COKA 3OUUA 2YN0A 1UXOA 1T1IA 3PYLA 1B8NA 1IN5A 2CFRA 2YTZA 4EMTA 2BTQA 5IASA 2C2HA 1EUCB 2OV6A 3H04A 2A88A 1MN6A 1P61B 2M2IA 3CF6R 4QWWA 3A6PC 2C4WA 2ZRCA 1E9AA 1Z3CA 2JAWA 3DFIA 3LIPA 3Q9UA 4J0GA 1QQ5A 4P81A 4X7RA 1U8XX 2HJVA 3K2EA 5AI4A 1JJAA 5JZVA 5JS1A 4A27A 1Y5NA 2IUEA 5ALDA 3P52A 1EFTA 4M0MA 4QUHA 1BQ3A 5B3AA 1HL7A 2WE7A 3FMPB 3UHOA 1K8RA 2V3CC 2XZLA 2Z58A 3HVKA 3AUYA 4IDAA 1VJCA 1XZBA 2C4VA 1R88A 3LLCA 3C4JA 5LZ8A 3AJEA 4MO9A 4CL8A 3SKVA 3AEZA 1P33A 2XUZA 2HPZA 4BASA 1TVKA 2R1ZA 5LNK1 3OIYA 1J39A 1LK7A 4MWCA 4WI1A 3LVRE 5FULA 3ZV7A 3AVTA 2IYVA 1WB9A 4ALNA 4FFBA 4W9NA 1J0CA 4ND1A 1T5HX 1IHYA 5C1PA 1B26A 3WO0A 2Q5OA 3PZRA 1L7DA 1UPUA 1NN0A 2BRUA 3QW2A 5B6PA 1TQDA 2WK1A 4XGIA 2CF6A 2VDPB 4K9MA 2P2SA 3UJ3X 4BJ1A 3PJEA 3AVYA 3H0EA 4MR8A 3KZVA 3LD9A 4DCPA 1Z0IA 1KC1A 2PH7A 4ZVMA 3G88A 2WMNB 4L9SA 4NDZA 3RYFB 4G5QA 2DJ5A 3OETA 3UJCA 4D3FA 1DCMA 5JS8A 3LECA 1M1UA 3OQJA 2DRIA 1KI8A 3FHJA 3W3AH 3IUJA 2ZIUB 5E0OA 5L3RA 4Z8XA 1P9NA 1AZTA 3COJA 1ODTC 3OIVA 3FYSA 3V2IA 1Y7HA 4ZVVA 3W6PA 3QJYA 1YDWA 1S5PA 3RHFA 1QZTA 1J90A 1N2HA 3I42A 5C8YB 3N07A 1GQRA 3M6XA 4GGMX 4B71A 1PZMA 1GPAA 2DC1A 4L8FA 5CIWA 1SURA 1NI4B 2H07A 1KJIA 4EA8A 3G9UA 3W8NA 1B0PA 2VTDA 1TT7A 1TUBA 2YQ4A 4MHOA 1KQNA 4BYMA 2JLUA 5F5LA 4UM5A 5LMZA 4KJZA 4JR1A 4GICA 4QFBA 5LP1A 3T9BA 2GLUA 3ADKA 3KC2A 3KCQA 1R6DA 2MYPA 1E2UA 4ZZ1A 4W1SA 2D1SA 4Q9IA 3SQLA 5BMOA 2FEXA 3Q8MA 1DJLA 2C99A 1K5HA 3A26A 2GAIA 3NEPX 4GUAA 4MCAA 4QICA 4PPNA 4LRSB 3TSCA 3S4YA 4Q21A 2EJTA 3QNWA 2I7CA 2DSNA 2ZQ5A 3CV3A 2G4CA 4EDFA 4GL2A 2R11A 2XCTB 4BL5A 1HORA 1TMGE 3EZ7A 4MKGA 3ZCSA 5I8WA 1YT5A 2XNJA 3DXXA 3LE8A 4XUCA 3AUKA 3L01A 4II2A 5ELMA 4MULA 5I5GA 2P8SA 3DOCA 1GNPA 3LQFA 3ZU5A 5EHNA 1QRUA 2G82A 3H5IA 4GO1A 4UU7A 5EMHA 1E6UA 1JALA 3PDIB 1NVWQ 3LX8A 4WX2B 4TV8B 2PGLA 1MTZA 4EBFA 2X14A 4CLOB 2WAXA 3BSSA 4MUYA 4GPZA 4JD5A 4FS8A 1WE2A 2WOOA 1WCV1 1QVRA 3L05A 4CEIA 3M6WA 5B37A 4W1PA 2J87A 2BMEA 3FJ1A 5JFGA 2IEAA 3GMTA 3NBQA 4EMSA 2CEAA 1KZHA 3TQSA 1ESCA 3C1OA 3Q5EA 4A6DA 5MHTA 1F2TA 4DZZA 1M1YB 7ADHA 1VE9A 5TV2A 3HKEA 3TRJA 2DUMA 3N0VA 3OAAD 3JQ8A 3NT5A 4PX3A 2QTLA 2ZUBA 2XQFA 2IV7A 1G9XA 4GL4A 3E05A 2EW2A 2JFUA 4KQFA 4ND5A 3M2TA 3D4LA 3O3OB 1YR3A 3LQYA 1D8AA 2CFCA 2WYOA 4MRAA 5CVUA 4YAGA 3N2YA 4LRTB 1MFZA 3FWKA 1LBSA 4JVSB 3AW8A 5JC1A 4DV2B 5K3SA 3RSZA 4F8JA 2H29A 2VWGA 1H65A 2WU1A 4I9UA 1HLDA 5ANRB 3RGWS 4CKWA 1XCBA 1USGA 4RIGA 1XN4A 3LDUA 1OWNA 3B48A 5TXGA 2PV7A 3ORSA 4UM9B 1NWHA 4Q0MA 1EDOA 1IBMB 1K5DA 4CZ2A 2VZLA 3EW9A 3EISA 3THOA 2ZUSA 3VA7A 1SIUA 1MRZA 2HQRA 2YR0A 5ALLA 5KREA 3B6ZA 5EWJA 1D6SA 3A4VA 4FW8A 4OQPA 4KE9A 2JJ1D 1EE2A 4PINA 5FA8A 2FR8A 4D96A 4TVSA 4M60A 1DRVA 4G1FA 4MV9A 2JEYA 4PTLA 2AR0A 3MG9A 4G67A 2DR3A 2J41A 4D98A 1Q1NA 3GRYA 5A1JA 4PAGA 1UM8A 4Z4QA 2CDAA 1DINA 2FX5A 2P40A 4ZEXA 2IJGX 3VPFA 5BUQA 4RPKA 5KUTA 1HZZC 3C6YA 5AQEA 1PK9A 5F9HA 5ITZB 2J07A 2NZ2A 1PEDA 5FADA 5SY9A 3NH9A 3JD4A 3N2LA 1JHXA 3QGMA 3FE2A 4QOJA 2O50A 4X66B 4RQBA 4DOMA 1AO3A 3AR8A 1STOA 1SZCA 1WUJS 1C3OA 3MWEA 2C3MA 1M0SA 2R5NA 5HIJA 2VTBB 4EG7A 1XJ5A 4DEVA 1WDLA 1OZHA 2Q49A 4BGEA 3IFSA 4BNJA 3SJBA 5MN6A 2W93A 1ST2A 1PR4A 3VZRA 3IILA 3SHOA 4YCSA 1YOVB 2FWAA 2WKRA 4LHVA 3AESB 2DGDA 3EZFA 4XEUA 4QPDA 2F1HA 2JI8A 3AY6A 2QJWA 1SAYA 3U61B 3D6VA 2HMWA 1JIJA 1T5OA 1ZBQA 2FWRA 3IR6A 4TTRA 3GP3A 4IO1A 4CM4B 3QXCA 4ME6A 2W48A 4UPDA 1USIA 1XROA 3DFUA 3OTHA 4DUGD 3FNEA 4NU5A 1MOPA 2IZOA 4PHHA 1L4HA 1PJ3A 4OQMA 1KJNA 1YQTA 1RYMA 3UF0A 4DY4A 5C8VA 3SVTA 4XGKA 1WX1A 3BGDA 2FMIA 3P2JA 4S2UA 1HDGO 4ZDIA 1GARA 4Z8YA 1EVLA 1QKJA 1XHLA 3LAWA 4FDTA 4Q9NA 3T7KA 4RKWA 2JFXA 2GBLC 2R5FA 3P26A 4GW3A 1VIVA 2HO5A 4KAAA 3SNHA 1P19A 2Z9CA 1QYDA 3KSAC 3SYKA 3U4AA 4CQLB 1PFUA 4EI2A 1GNVA 3K7EA 2Q5CA 1E9SA 3O2JA 2ZI4A 4BZXA 2VBCA 1DXOA 1K0FA 1HSZA 1XEXA 1RYZA 2VLBA 2BGGA 1IOLA 3VNSA 4YAEA 4K40A 5EVCA 2GUWA 5LR6A 1YE5A 2YCLA 4ZHSA 1GYQA 4R1LA 1C3LA 1N8KA 5KYKA 3IE2A 3S5UA 3PHJA 2HWUA 3ICPA 2GEJA 3SZMA 1GN9A 2GARA 3KHKA 4YDSA 3AZQA 3WHKA 2C2MA 4C4ZA 5L40A 3N9IA 4B76A 1M1XB 3A2MA 3FYDA 3FX2A 3RM3A 1PJZA 2YBDA 3MA0A 3PVSA 1HH4A 4DWJA 3NYRA 2O3UA 2HKIA 3ESYA 4LJ7A 5IEJA 1RXEA 1NYQA 1W6UA 2C31A 2ZRDA 3CTMA 5CD9A 1LX6A 1TFUA 2J30A 1LWOA 2J4FA 4KQEA 5DX0A 5EA2A 2JZCA 3VKWA 5KKCA 1IEXA 3O3NB 3RWOA 2BGTA 2PYDA 4EQZA 4EARA 2IU3A 1EFRD 1TT5B 1Y42X 1W0KD 3K2QA 4IIXA 2FPOA 3PXCX 4NR0A 4MI1A 5G1OA 3AR4A 1GUZA 2LZ0A 3O1HB 3OU7A 5ADVA 1X1EA 4OQEA 3JYPA 3RYHA 3SKYA 3UYLA 4MP8A 1ZSNA 2GHTA 4UHHA 1CXZA 1SK8A 4DSTA 2AXNA 4HCJA 4DDUA 5E8JA 3CEHA 1MLDA 1XR3A 2FUCA 2V7XA 3EYWA 3FVRA 5D3MB 3OOYA 4IINA 4FJ2A 1DPFA 1NQXA 3I9FA 3I23A 3OQHA 3CRNA 3DLAA 3NZEA 5J2UB 1W73A 4DMMA 4X64B 3ER6A 1LK5A 1CZOA 4N3BA 4PHTA 1BO6A 1N75A 4MS4B 1VLMA 4WY8A 5HUQA 2RHOA 1W25A 4AJHA 1AMOA 4A7PA 3GROA 2LE0A 4PLCA 2R0QC 3MWKA 1HQCA 3GOQA 5THKA 2IYXA 3ZQJA 1OROA 3VPGA 5JI3E 1A9PA 5TGDA 3W5UA 1I4EB 3DTVB 3IR5A 2FF5A 2X8JA 3NP9A 4GKBA 4JBIA 3SLKA 3UAVA 1L5ZA 2IDJA 3FOEC 1FFXA 1YUNA 2H48A 3CSSA 1CDOA 1PFWA 3QV2A 4HXFB 4JC0A 3TIIA 1Z0JA 1P3DA 5E7IA 3OEWA 1EINA 1Z12A 4AM8A 3I09A 4CMKA 2P77A 2Q9CA 5C1BA 1PJCA 1NE2A 2BZSA 2I62A 1MZVA 1BHSA 3BMQA 3NBUA 1ZXXA 3AR3A 1JBEA 3BSFA 1GPMA 4H6XA 3UMSA 5KEIA 1D2CA 4ISBA 4YMSA 1DAFA 1V3TA 2KI5A 5IBRA 4H4DA 5IZCA 4TKZA 5BQFA 1KWGA 3EC2A 1QYWA 1KMCA 3V7YA 3DC2A 5AW8A 4DL9A 1C8KA 1QHFA 4HZUA 5BXQC 2NVBA 1XZPA 1ACJA 2XD4A 2Z5FA 4YP5A 1G2IA 1W4LA 4UMFA 4J7XA 4EPWA 4UD2A 5KKAA 2BM8A 4OBEA 4CLRA 1P4GA 1ESNA 1NVEA 4HDOB 2A9FA 1KEWA 1G0OA 3PGVA 5DASA 2BI8A 3DVLA 2PLWA 2PA3A 2O52A 4NJEA 3KKNA 3MW8A 2C3PA 2H7XA 4X8OA 3W2HA 4EJMA 4XZ3A 3O1LA 3NATA 4K6HA 4M6WA 1YVEI 3VC1A 4DPMA 1Z3IX 1VMKA 1XRRA 2LUOA 1E62A 1JEDA 3D3KA 2EWVA 3BFXA 3EMKA 4M86A 5GOZA 2AXPA 3SEAA 4HX9A 3O8QA 3AR5A 3COZA 3HP4A 4IMIB 4PRZA 1EVJA 2NV2B 4LDNA 1ZZGA 3RFFA 2GN4A 4G24A 1BQEA 1Z7EA 4HRVA 4EVRA 4O6VA 4OGGA 4IDBA 2VR1A 5A4JA 2JHCA 3PF9A 4IQFA 3QXSA 3L49A 1HE8B 3HHEA 1HRDA 1QH8B 1PUJA 2X5JO 2YXNA 3HFSA 3QKIA 1VJDA 3OLCX 5JBNA 1Z6ZA 2QWXA 3GCWA 3NP7A 2NX2A 2O1XA 3RIEA 2QE7D 1JXMA 2JZOA 3MB5A 3G5UA 4PYQA 4KIFA 4LJ9A 1ESMA 3ADPA 1LDYA 2IYNA 5B55A 1F7UA 3WP0A 1K9VF 1N6OA 1QK5A 3JAKA 1JZQA 4JI0B 4DLVA 1JHRA 3W3AA 5KC9A 3NBXX 4CFZA 4P9NA 4FGSA 3QK7A 1OZGA 1X7YA 1YBMA 2F9MA 3FPHA 2PUDA 2J48A 4OH7A 2JBAA 2WAMA 3FWYA 1B1CA 3BOSA 4KMOA 5E3JA 9ATCA 3F71A 2QGFA 1QM5A 3GFOA 4CEHB 1F0NA 2QAGB 5E9QA 2PUAA 4XYMA 2H1SA 2QMOA 4HDQB 5FX2A 1BEZA 1QGOA 1P80A 1U2EA 3T4XA 2I7VA 2JCSA 1FPQA 3OLZA 1C1XB 4GH5A 4EHNA 5B30A 4DV6B 1G5QA 2IEYA 5BNTA 4MV0A 4DMUB 1GZ7A 1ISRA 1KZ6A 3GJQA 1JL3A 2H0QA 4HR7A 2PG3A 4YMTA 2PMKA 5AVRA 2BSXA 1KETA 3NV9A 4DQLA 2VFAA 5DNVA 4AYXA 4DG5A 2IOQA 1GADO 4EY4A 3HHPA 1AE1A 3R1IA 4WZZA 2FN9A 4EEXA 2Q5HA 3S5JA 3SN6A 1CYDA 2CDRA 1QG2A 2G07A 4IQGA 3BHMA 4PS0A 3ND7A 4L3VA 4RV5A 1K97A 2F90A 1TUEA 1P77A 2FP4B 3ROZA 1CUUA 1JLMA 5FTNA 1HRKA 3W8RA 3OZBA 4O4HF 5AK5A 5JRDS 2CC2A 2CHFA 3EX7C 1A2OA 4ZGGA 3OZIA 1WSDA 4AWXA 4D5GA 3GARA 4UUBA 4AROA 4Q3NA 1XJWA 2C2YA 2Z1MA 4H7DA 4HN9A 3IPYA 1PVOA 2FK7A 3ZDDA 4KK3A 3WKAA 3Q3CA 2C7GA 4DXAA 1D9XA 1PJSA 1XRJA 2WKPA 3QUSA 4RYLA 3DTVD 5U4QA 2GT1A 3SFVA 2P79A 5LP6B 1N7JA 3IIMA 2G88A 4FFNA 3EBPA 2VBGA 5CX4A 3KJZA 3M6LA 3NTQA 5DVZA 3WRXC 1T1JA 4IWYA 1E3IA 2I7DA 3K31A 5EL0A 4MUGA 4GQIA 4DYDA 1GDTA 3THYA 1H2FA 1NX6A 2D0IA 1PR5A 4MUAA 3FPKA 4J8PA 1QMGA 3I1JA 1UOPA 2VSXA 4F86A 3MJDA 5FPSA 1W35A 2NTYC 5K6AA 4LYYA 4CM5A 5FNVB 1ENYA 2BEKA 5A0VA 4KLRA 1EE1A 3CH6A 4CDGA 1KEUA 4C88A 3C3JA 3G0HA 3GBVA 1VB3A 3DKKA 1DX6A 1NJ1A 1TYBE 2J3MA 3M8KA 3NPMA 4JI6B 4A73A 4R41A 3SSNA 3I6IA 1S89A 4C89A 5LN1A 4OF4A 5NLLA 5DGHA 3PUXA 2YWGA 4DWVA 3CG0A 3ZI7A 2ZAIA 2GD6A 1YSCA 2IW3A 1N9KA 4V02A 3Q10A 3SXUB 1O9HA 2RAFA 4H1VA 2QSUA 2ZM5A 2ZROA 3M4JA 1E1RD 1K3FA 2H6EA 3LXUX 5FHRA 5DM2A 5GPBA 3JQGB 1K2WA 2XTNA 3AM1A 1EUCA 1EGAA 1NUTA 2FGKA 2XTMA 4IF6A 4L72A 3RYHB 4B3RB 2YWBA 3PNLA 3MCWA 2ECOA 1O96A 1UFQA 4X6XA 1RZRA 2PANA 1M8GA 5J2TA 4KO2S 3ZHOA 4MW0A 2XJ9A 2A92A 3PRYA 1C8BA 4U5QA 1ML4A 2J46A 4MYHA 5HMLA 4BMSA 5DB4A 4F12A 2WABA 5AKHA 2NNLD 5LZ7A 2R1UA 4I9HA 3TL3A 3ZEIA 1Q0QA 4MEBA 2H17A 2VZ8A 3AYXB 5BRNA 1BYIA 2Q45A 4MPRA 4D9GA 3IJEB 4KIWA 2CMFA 1W4CA 1AKVA 3HI4A 3AETA 3JZFA 3GUZA 4OVKA 4P92A 5EE3A 5EKDA 3S2YA 1XTRA 2YJGA 1A72A 3N87A 4GSLA 3A05A 5DFAA 2JC3A 4NEHB 4BEJA 2DAPA 1QQBA 3LXMA 5BOVA 1IM5A 1P3JA 3LY5A 2IRWA 3QIAA 4EAAA 3T7IA 2QTHA 5C3MA 8LDHA 4JP2A 1Y4SA 2BHNA 2V4UA 1IJBA 3Q9NA 3SC2B 3V8NA 1RTKA 3GJ0A 2GBCA 1W75A 4IFBA 1YB2A 1Y8RB 3EXFA 3AY7A 2QN8A 4JLKA 5DTJA 2Z2IA 2I1QA 1L3CA 4KR9A 3HEAA 3MTGA 2O5VA 4BJ6A 4F5YA 3K8QA 1A2BA 4RY0A 5BT8A 4UOQA 3T1OA 3OQOA 3F3MA 1HZJA 1WDTA 4Y1GA 4KXLA 1ACMA 2J9XB 4DNXA 4Y98A 1AY0A 1X7HA 2E85A 2GPSA 4RK0A 3KYDA 3VUEA 5JROA 1H3EA 3ULKA 3PFWO 2VHUA 3MJ4A 2P2ZA 2WVGA 3D3JA 4K6MA 5G02A 1IEWA 3X1JA 3EXG2 4J0CA 1MB9A 1OOEA 1B4DA 1T13A 1XMPA 2BCGY 2D7JA 2OYSA 4W1RA 3T38A 3VSCA 4LAFA 3RAEC 1DCFA 3PEVA 3PNVA 4G01B 2P41A 2O3RA 1Z5OA 3SJZA 3GVXA 1A0OA 5KQGA 1KEEA 3OZEA 3KJQA 4F91B 5JJKA 3CPJB 1ZIDA 3CLTC 3U9SA 2PGJA 1IXRC 1KDTA 3FDIA 4NYMR 4PLTA 1Y6ZA 5DRYA 2XRZA 3AIIA 2I65A 3E7FA 3ZTYA 4BPRA 3ILXA 4P80A 4A2QA 1UBTS 4A9AA 1KFJB 1CDDA 4GMGA 3OJCA 3IT3A 2C88A 4IV5A 4EPTA 5JARA 2ZCJA 1IPHA 5B1YA 4GEKA 2R8ZA 4UM8B 1KKMA 1E2BA 5KKNB 3OX3A 1FMFA 3DAGA 4I5EA 4C29A 2J33A 3LDAA 1BZYA 4F5DA 1PQYA 4R5MA 1T6XA 3BRWD 2A3RA 3SQMA 1QFMA 1MNQA 4YALA 2DBYA 2AJ8A 1ND6A 1IBSA 3ZVLA 5LU9A 1MOQA 3ESCA 4Q1FA 2YDYA 3U9TA 5CIYA 3V6MA 1H2WA 1R15A 1TZBA 4FE3A 4LECA 4OL9A 3TQHA 5LZ4A 3R0XA 2ZTVA 1ULHA 3VJLA 2YMMA 3C5HA 2ZU6A 5IK2A 3W34A 3WKDA 3ETNA 3G9ZA 5LCXA 3TDNA 1KQ3A 3ITKA 4MB6A 4LNUA 4ZXFA 4ZZ0A 4LDRA 3VO9A 3JZMA 1JMVA 3PI6A 4WUTA 3BZUA 1ISHA 3GJSA 3KB2A 5EZYB 1KI4A 1HT2E 2NQTA 4U63A 1E61A 5B7NA 7AT1A 2XVXA 4YJ3F 4XB6B 4U9HS 4DRZA 3UA3A 1G21B 3PC4A 1DJQA 3QJ5A 2OPHA 4E13A 1GLNA 3R6LA 4URYR 5L45A 2GEVA 2O2YA 1KBQA 3OM0A 1S3IA 3NHAA 3RU9A 3VU1A 2RE8A 4M0EA 2X5XA 5GIOE 3KT8A 1ZC4A 3DZJA 1SUFA 3HC7A 4W7SA 4ZV7A 4PE5B 3S2UA 1Y5MA 4ZT2A 3QU2A 2A84A 1FFYA 3ILHA 1U2GA 3SHTA 5FTLA 5FLXA 2W43A 3QU5A 4CMJA 3U62A 1CNMA 2BCJQ 1HYGA 1UWVA 3DDNA 1U5CA 4GC9A 5KNBA 3RS4A 1P7VA 3GRUA 1VL6A 4YAFA 1UJ4A 5C5DA 4E21A 1NMYA 2JFOA 4N7MA 1V8BA 4NMLA 1V71A 2JKVA 2PWAA 5FL7D 2PMFA 3UW1A 1RKUA 2FMXA 2I1WA 1FLAA 3HCAA 2X40A 4OBXA 5CA1F 3QPBA 1G20A 2WZDA 3IXMA 4TMVA 4DLAA 4ES6A 2B98A 2DUJA 5I6DA 3ZDRA 4Q82A 4WFQA 4WESB 4OQDA 1P1FA 2GD0A 4G6ZA 1NSYA 3VDNB 1SBQA 2ZETA 3SIWA 2A8YA 1IEQA 1U0TA 2WJ3A 1T0PA 4MCJA 2K87A 2ZT7A 4R51A 3V00A 2VA8A 3WLRA 2NXCA 4J0IA 3FI0A 4OQZA 3Q8LA 1EB9A 3N8GA 1Q2XA 2BKUA 2VXYA 2ORED 1XEWX 4TRMA 5JPCA 1PX0A 3EH2A 3EGCA 3CNEA 1KBZA 2QENA 3U4DA 2BY4A 2G4LA 4OI4A 3KL2A 4MAMA 4NF2A 4KLAA 1W0JD 1YMUA 2O23A 1MC8A 3LYUA 5ULLA 3GEDA 5DHAA 4AL4A 3BN3A 3SVLA 3P1JA 4FSDA 4MVJE 5CRIA 1E2IA 521PA 4O8CA 3T95A 1A95A 3QBTA 1BA3A 4I6EA 2WYVA 3R3SA 1JVBA 4DDTA 4BX9A 5HFNA 3ZHSA 2B8TA 5FPQA 4NCHA 3DHYA 4EPYA 5LOVB 3IKTA 3ZS8A 1Q84A 4MR9A 2EKZA 2I2DA 1XCGB 2IEBA 3K1TA 4P3YA 1VE5A 5SZHB 5CLGA 3GBPA 4IOLA 1UPXA 3CRMA 3PXBA 4OLFA 5JT1A 3BZWA 2NZ8A 4RSRA 1QNLA 5JISA 2H4XA 2E37A 5CJ2A 2E5LB 4M98A 1Z29A 4YA6A 4ZVKA 2Z6QA 4S12A 2UZ0A 5THXA 1DAOA 1TPZA 1Y89A 3Q11A 3TMYA 2ORIA 4FD3A 4C3OB 3IBYA 1SFRA 3EARA 1QGUB 1UJBA 2BEUA 4BQPA 4EJSA 5HSGA 1F0YA 3HYLA 4F85A 3MJHA 2FHSA 3IXQA 1MC4A 4H1HA 1JDZA 1MU0A 3AUTA 3TVYA 1X74A 3GELA 3EQ9A 3OTIA 3P2IA 4E1VA 1EGMB 4GKJB 1H2HA 1LNQA 1G0NA 4BFVA 1VHDA 3GHYA 4F1WA 1IPFA 3OQ1A 1MGPA 1TC2A 1DTWB 4BLSA 1LGYA 3ROKA 3VYSB 3X2FA 1IUOA 2O1SA 3FHOA 4PBSA 4B2PA 4P08A 4A82A 1MAVA 4EOGA 2GFHA 2B92A 1OLUA 4FGJA 3LJKA 1SELA 2XUAA 4ARBA 3ORRA 2NU8A 2NU7A 3TXXA 3ST7A 1QKIA 1R4NB 4R01A 1E0SA 2AFVA 3TEMA 1U3UA 3AETB 4LBYA 4Z9XA 1ZCAA 1R66A 2P3QA 1WW3A 3IBFA 1FXUA 2G40A 2WVAA 4RZHA 3UGTA 5KDDA 2XQJA 4AYWA 1R6BX 3E8XA 3PKIA 5JBIA 5KHLB 1S2GA 2CJWA 4UDYX 1ECFA 1U31A 3GDGA 3GFFA 2WIJA 1W4BA 3GZNB 2PDAA 2QVGA 1RLMA 2ZSHA 4AD8A 5ADHA 3YASA 1AK9A 3RDPA 5IAEA 5H4HA 5CJPA 4Z86A 1H1LB 4YPOA 1AHNA 4NFYA 5AVTA 2P0AA 4EITA 3Q5DA 2G63A 4H60A