1SO8A

Abeta-bound human abad structure [also known as 3-hydroxyacyl-coa dehydrogenase type ii (type ii hadh), endoplasmic reticulum-associated amyloid beta-peptide binding protein (erab)]
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
248
structure length
208
Chain Sequence
RSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTDPAEYAHLVQAIIENPFLNGEVIRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ABAD directly links Abeta to mitochondrial toxicity in Alzheimer's disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords 3-hydroxyacyl-CoA dehydrogenase type II
total genus 67
structure length 208
sequence length 248
ec nomenclature ec 1.1.1.178: 3-hydroxy-2-methylbutyryl-CoA dehydrogenase.
pdb deposition date 2004-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1so8A00
4EYEA 3AFNA 2C0CA 4D79A 1YJQA 4E5NA 1SOVA 2WE7A 3KVOA 5JDCC 2X5JO 3Q1LA 5I7FA 2JFGA 3JQ9A 4CM7A 4CM9D 1R16A 4WCFB 5IDWA 1ZSYA 4B7XA 1GQQA 1T26A 2HRZA 2W2KA 1VPDA 2J5QA 3BMNA 3TOXA 3WGGA 5JPIA 3VVCA 3IAHA 1LQTA 1O6ZA 2IRWA 1I0ZA 3HFSA 4UVGA 1NX6A 3CMCO 3P2YA 1Y5RA 1ZJZA 5B4TA 3BZUA 4BNLA 1XHLA 2Y93A 1T2AA 4JBHA 4MKRA 4BNJA 2I76A 1QYDA 4FFMA 2Y1GA 4DMLA 1RM0A 3ZWCA 3N74A 3PJDA 4RVHA 2R2GA 1D8AA 5AXAA 1D7OA 5JC8A 1LLCA 1UP6A 4G65A 3QVWA 4B3HA 3EK2A 3DZBA 2DQ4A 3E9QA 2TMGA 3WS7A 4CM1A 4J43A 4RZIA 5K6AC 3SJ7A 1XR3A 4KZPA 2R00A 4YB8A 1YJ8A 1HRDA 4GLOA 1I3MA 3QLJA 4FJ0A 1ZJYA 4KUHA 1EDZA 4J91A 4W7IA 3T4XA 3ZWVA 2NSDA 4XGNA 1YO6A 2DTXA 2Y1EA 2NLOA 3EHEA 3RUDA 4BV9A 4D43A 1ONPA 2PGJA 3ROKA 3SVTA 3H2SA 3TF5A 4GKVA 1Y8QB 1E3SA 1QXSA 2D0IA 2X4GA 3QVTA 3PK0A 4YACA 4CL8A 1J4AA 3BAZA 1V8BA 1GQYA 1E7MA 2X86A 3L6DA 1WDKA 1LLQA 2EXXA 3NT5A 2X7HA 4C4OA 3C3XA 2HRBA 4O63O 4ZQEA 3UVEA 3V1UA 1CERA 3CMMA 3HUDA 3KXDA 3BMCB 1LDGA 3RWBA 1QYCA 4G5HA 1NP3A 3GNQA 4RPGA 1NWHA 4FQ8A 4J4BA 4YQZA 1GADO 4HFRA 3PPIA 1FDUA 2EWMA 3B20A 5FI3A 5B37A 4Q3AA 2X23A 3MJVA 1MG5A 3DBLB 3KSUA 2DT5A 5IFLA 1ADBA 1DC4A 1EK6A 1MXFA 2G76A 2AQKA 2IODA 2QG4A 3UW3A 2NTVA 5G4KB 3CE6A 4K28A 2SCUA 4BNGA 2VQ3A 3HB4X 3QSGA 4XYBA 3TPCA 3AI1A 4GX0A 3F5QA 3ZWPA 2Y1OA 3QQPA 4ZVVA 7MDHA 4DVJA 5A02A 4L4SA 2FSVA 1JKJA 4DQUA 1ZMTA 5DT9A 5KNLA 1M6HA 5TC4A 3JQ6A 3ULKA 1G6KA 5G0TA 3WTBA 1U7TA 3B1JA 4BMNA 2X9NA 3ZNQA 3QA9A 1DIGA 4J7XA 4XDZA 2FPPA 3ZWWA 1EVJA 1GYQA 3TJRA 5JC1A 4NFSA 3IJRA 4CLOB 1OZAA 1ZK2A 3INRA 5A5FA 3QE3A 3Q2IA 3Q2KA 2DBVO 4MVJF 1KOLA 4CQMB 5CDGA 4LRSB 2VUUA 3TZQA 2VUTA 3FTNA 2YDYA 2UDPA 2X22A 3L6OO 3ZWYA 1P1JA 1K6IA 2RHRA 3VPHA 1E3LA 3DR3A 3BTVA 4GI2A 5U1PA 2O2SA 2GASA 2O23A 1ZEJA 1KEVA 2OBYA 3JQ8A 3VZRA 2QRLA 2X9VA 1FXSA 2E6UX 2X0RA 3D3WB 1R0LA 4WUVA 1DXYA 1ZK3A 3PWKA 3QIVA 3H2ZA 3U5TA 1NXQA 5DF1A 2AHRA 2PZLA 4GX2A 2BMAA 4YYZA 5G0SA 4EI2A 1U28A 1ZBQA 1IY8A 4HUJA 5EQFA 4TRNA 4AJNA 1PJSA 4YT4A 5DBFA 3FWNA 2W2LD 4EGFA 1E7YA 4DA9A 3HQ4O 1H6DA 1Y8RA 2VHVA 1HDRA 5L7TA 2GF2A 2Y0DA 5AYVA 1MLDA 2G1UA 1R0KA 2DTEA 3INTA 1WAMA 3ZW9A 4B3IA 9LDBA 2EGGA 4W9NA 3KUXA 5IDQA 4CODB 2ZYAA 2RH8A 1DO8A 4U7WA 3RQSA 4EUFA 1ARZA 2HK9A 3RC1A 4D3DA 4ID9A 2ZB8A 1GCUA 4ZD6A 3Q0EA 2EJVA 1GZ6A 2BGLA 1PJTA 1A9ZA 4BKRA 4CM3A 5JY1A 1P3DA 4FFRA 3I6IA 3UCFA 4YQYA 1XU7A 3WNQA 3PJFA 4MIOA 1SAYA 1FK8A 2FMUA 4XDYA 5FF9A 3F1LA 5BSFA 1ZCJA 1GZ4A 3OIGA 3GVCA 3OA2A 2GZ1A 4D7AA 3NYWA 1X7DA 1Z7BA 4Q39A 4ZA2A 1W8DA 3RC2A 1AUPA 3PHIA 4FOOA 3NDRA 5H82A 1KVSA 4FDAA 4YJFB 4TRMA 1EQUA 4WLEA 3JQAA 4CMCA 1R4MB 2DC1A 2HDHA 5FWNA 3ZV6A 3FPCA 1DLIA 1ZFNA 1I33A 5AOVA 3VPGA 2IE0A 4UVDA 4CR6A 2CMDA 3AOGA 2HSDA 3JQFA 4PLZA 3FNEA 5LCXA 1NWCA 1WZEA 3F47A 5DBIA 2YV1A 1VE9A 3ZNNA 1F14A 4FFOA 4CMIB 2AEJA 4BNWA 4LVUA 4GWKA 3DBHA 2PWZA 4TRJA 5CDTA 1F0YA 4NBTA 2DAPA 3LC1O 3OECA 1PR9A 3EDMA 4CPDA 1SZJG 2X0JA 5TRTA 2D2IA 2YQ5A 1LSOA 2CY0A 4MJLA 4O5OA 4NJOA 3CIFA 1JQBA 4TROA 2DPGA 1XIVA 4Z0HO 2EV9A 2EHDA 3O38A 5JO9A 4UUPA 1KBZA 5KJ6A 4BO9A 1EBUA 2CFCA 4L76A 5U4QA 1GTMA 3RVDA 1E5QA 3DFZA 2HUNA 3MOGA 4DPKA 3K5PA 1HE3A 3ROMA 4L0QA 1TB4A 4ROSA 3RUFA 3JYOA 1A4IA 4I5GA 4CJXA 3ZN2A 4ZRMA 4WLUA 1SMKA 2ZIZA 1LDEA 3DDNA 2PY6A 4AJHA 4IJKA 3UICA 1J49A 4ZGWA 2AQHA 4B4OA 3B1KA 5DOZA 1P0CA 1MFPA 3E8XA 3OBBA 3DOCA 3PFWO 4A73A 1VLLA 3GEDA 2HJRA 4CUJA 2VZ8A 1I2ZA 5ER6A 3QWAA 2B5WA 4RVUA 1CETA 3IS3A 3LDHA 1HE4A 4TKMA 3RKRA 4BO5A 1P1HA 4LISA 2G17A 2ZTLA 1P45A 4CM6A 1TXGA 4PLCA 3K30A 1BG6A 1GD1O 1XQ1A 1ZKMA 2R6JA 2PD4A 2J3JA 4RO0A 3IOYA 5I9LA 3AY7A 4L73A 2PGDA 2ZCVA 4XYGA 5CEJA 4II3A 4J6FA 1YOVB 2D59A 3UCXA 1Z75A 2JAPA 5F1KA 1UH5A 1VJ0A 2GGSA 3QWBA 1HT0A 1QYWA 1ULSA 4E2WA 4W82A 5ICMA 2EKPA 4RQTA 5JBIA 2X0NA 2UYYA 5T8KA 2X1HA 1GCOA 4J90A 3ZCXA 4YAEA 3WYCA 1DDOA 3BHMA 3ZHBA 2JCXA 5GZ3A 1UUFA 4BGVA 1N1GA 4UUNA 5TNXA 4HKTA 5FEUA 1YBVA 4BVAA 2WJPA 4A26A 3BXXA 3ASUA 1ADGA 3DO5A 4OXNA 3WGOA 1T2EA 2P4QA 2FZWA 4DMMA 3UXYA 2WSBA 2WWRA 2YV3A 4NBVA 1AN9A 1JN0A 4GX5A 5FFFA 5BT9A 3V2HA 1KC1A 1H0KA 2RHCA 3U4HA 1GQ2A 3C8MA 4R51A 5G4LA 2C2YA 2AQ8A 1LTHR 1XYGA 3KZVA 5DCYA 4IGFA 4IJVA 5ITWA 5C7IO 3DTTA 3O26A 1HSZA 4XIYA 3KOUA 3AWDA 4EW6A 2B69A 1UZLA 1QORA 4OM8A 1LUAA 2BD0A 1OI7A 5ENDA 4BGUA 3O8QB 4UVHA 4BOYA 3OM9A 3RBXA 4URFA 3RU7A 4YDRA 5KVQA 4M55A 1C0PA 3AUTA 3GEMA 4ND5A 3ZH2A 5BNIA 1BSVA 4Z3KA 1EVIA 3M1LA 1NM5A 4ZQHA 2P68A 1PJQA 1V9LA 2CNBA 2Q1TA 3DWFA 3QWHA 1XA0A 1HSOA 4LK3A 2QHXA 3GUCA 1I30A 2X5KO 1VKNA 3BTUA 4N54A 2F1KA 5T5QA 1ZSNA 2EW8A 4RPHA 2YUTA 4RVGA 3FNHA 5BR7A 4NMHA 4J3FA 4UAGA 1QR6A 1YGYA 2ZKLA 2NQ8A 2RAFA 4OSPA 3B70A 3GVHA 2WMDA 2NU8A 1MP0A 5T67A 3LC2O 4PRKA 5COQA 4RPKA 2Q1WA 3NKLA 2JD1A 3RC7A 1WDMA 2WYWA 3KYDA 1RM3A 4XCVA 3H9QA 4JIGA 3LT2A 3OEWA 4BKOA 3PGJA 4R68A 5BNTA 3PHGA 4MVJM 1VI2A 8ADHA 4UUMA 1JKIA 1DPGA 4QTZA 3G1UA 3W8EA 1H9BA 5KKCA 4LN1A 3TL3A 3W6ZA 1QYXA 3LZ6A 3PLRA 4N5NA 1IHYA 3N7UA 4NJMB 4ND3A 2QW8A 2HAEA 1A72A 4EBFA 1EFLA 5DP1A 4W7HA 4YT2A 5KJCA 4CL3A 4IY1A 1DFGA 2HMSA 1XDWA 1C1XB 3K73O 4K9DA 4EEXA 4R1UA 4AJEA 2DUWA 1ZUD1 1P33A 5L9AA 3JQ7A 2VNAA 3AOEA 2J5RA 3DHYA 4ILKA 4YJHA 4LGVA 3G49A 2DU8A 3ZWOA 4RJTA 1J6UA 4EZBA 4R5HA 5C7OO 1UAGA 4WASA 5DN9A 4RPJA 4F6LA 5IDXA 2OGUA 4I5DA 3MJSA 1HDOA 1GV1A 5JMWA 3ANLA 3HN7A 4RLHA 4IS2A 4ZQBA 2HQ1A 4MVJI 2DUUA 4INAA 1ZK4A 4JBGA 3HJAA 3NDIA 5A9SA 1TEHA 4BHTA 3GPIA 3LSYA 3QV1A 3VDRA 4OL9A 3RU9A 5ES3A 1MXHA 3JQAD 2ZB7A 3PYXA 1U7HA 1XCBA 2IXAA 4IM7A 2Q99A 3KYCB 2VWPA 4CM4A 1N9GB 3LU1A 4KP7A 3LT0A 3K2BA 3WMWA 3WX0A 1DJNA 1LQUA 3C7AA 1LC0A 4OJNA 3I5MA 3W6UA 1HE5A 1A5ZA 4DLBA 2BFOA 3TZKA 4AJ2A 3GMDA 1H6AA 5J23A 3HHPA 4CLXA 1TLTA 1LU9A 4PVDA 2E4AA 4Y9DA 3S8MA 4WNCA 2Z5LA 3W8FA 1OAAA 1Q7CA 5T64A 4XR9A 3WMXA 4QSMA 3E9NA 1ZW1A 5COAA 4Q3CA 4BNTA 4RVSA 2IDZA 4G81A 3WFJA 2PV7A 2D1YA 4WLOA 1PWZA 2YV2A 3ETEA 3WJ7A 2JKVA 4AJOA 1DSSG 2EGHA 1P1IA 1YRLA 5DBGA 1B7GO 1NPTO 2V6BA 2O50A 1AGNA 1E0DA 4HP8A 4BQRA 2B0JA 4H15A 4W6ZA 4P22A 5G0WA 4R4JA 3ANNA 3BTOA 4XD2A 3AW9A 3NTQA 4U6SA 1AHHA 1MB4A 8LDHA 3BTSA 1UDCA 3IUSA 1YB4A 3T7EA 4D42A 3V1YA 1B2LA 2OHXA 4CMBA 2PZJA 3A06A 1OMOA 3NJ8A 4B79A 4KWHA 4Y67A 4DTIA 4Q9NA 1S7CA 3R3SA 3U62A 2DKNA 2V65A 2E48A 5DULA 3I3OA 1TT5B 1LSJA 5KKAA 3GDGA 4C7KA 1UAYA 4YCAA 5I8ZA 4YAKA 4BKPA 4ALMA 3ZHYA 4NR0A 1R4NA 4I9HA 1ZIDA 1LRKA 1UXIA 2AG8A 2JL1A 2VRCA 3MJCA 1Q2XA 4UEJA 3WXBA 4JP3A 4B8ZA 4BMVA 3AUAA 3JQ9C 5IJZA 2P5YA 1GPDG 3OJLA 1K0UA 1KYQA 2B4QA 2Y05A 1N8KA 3RBVA 4A10A 3KLMX 2AEFA 5AVOA 5ILOA 3OFSA 3PQEA 4MDHA 2IZ1A 1V35A 4Y98A 4GMFA 4WCFA 1YDEA 3GN1A 3I9LA 2F00A 2I99A 3RUIA 3F4BA 4PIVA 4PLPA 3D3EA 4R1TA 2FR0A 2HLPA 3GZNB 4FN4A 1E1LA 3DAPA 3Q9NA 2UVDA 3PZRA 3WIEA 3C85A 5DCWA 1HDZA 5TT0A 1JVSA 3BYZA 3F9IA 3KHUA 4J1TA 1X13A 4I1IA 2P9GA 3FNGA 4BNZA 2GZ2A 4DC0A 2Q45A 4D41A 4YBZA 4YT8A 2YHIA 3LC7O 3ETGA 1LDYA 2Y99A 2IZZA 3EZYA 3HB5X 4OKIA 2FPIA 3NEPX 5FI5A 3RUCA 3SX2A 4ALKA 3DZJA 3M6IA 4ZU3A 4XIJA 4E2YA 1PGNA 1Y9AA 4GKBA 5JFOA 4ZICA 2GD1O 4OQYA 1EBFA 3JYNA 2Q1UA 4KTVE 5CG2A 2FSSA 4HXYA 1I36A 1EFKA 1IHXA 2I65A 1NVMB 2YZ7A 3KO8A 1R66A 4Y8VA 3GUYA 1PZHA 2VZ9A 1YB1A 2DM6A 1EUZA 1MUUA 1DIAA 3ZV3A 3ITKA 4XA8A 5U9CA 1FF9A 3LLSA 5CHEA 3GT0A 3GRKA 4CMEA 4Y6PA 3OA0A 4EJMA 4QX6A 4PLFA 1XELA 1Y8QA 4FCCA 5EL0A 1DB3A 1T2FA 4CLDA 2BGKA 1KY4A 4J2OA 2BI8A 3L4BA 4B7CA 1YBAA 5T57A 5CDSA 3WG9A 4PLTA 3GG9A 2VHXA 1Z74A 1N7GA 3V2GA 5CDYA 3M1AA 4M8SA 3STHA 2LDBA 4RCVA 1U2GA 4CQLA 4QFDA 2VRCD 3BMCA 4CLRB 3Q3CA 3GLQA 4PG6A 4BO6A 3GFBA 3RFXA 3ZV4A 3U4IA 4DRYA 1PJ2A 4MP3A 1KIFA 5AQ1A 1NYTA 4FFPA 4K1LA 1VSVA 4MVJD 4FS3A 1YONA 2BFAA 1BDBA 4DLAA 3DBLA 3OETA 4IIUA 1O8CA 2ZTUA 4BNMA 1XLTA 1UXKA 2VT2A 3I9OA 3PWZA 2GN8A 5L40A 4JLWA 4WE3A 5JDIC 3AY3A 3ONFA 2IEDA 1D1TA 2D4AA 3DZHA 5AXBA 1NQOA 1G1AA 4NHEA 4RVFA 1LJ8A 3K8ZA 2HMUA 5G4KA 4RGBA 2J3KA 1M2WA 3ZW8A 1PR3A 1LSUA 1MC5A 2H63A 2QRJA 3ENNA 1EZ4A 2IEBA 4IS3A 5KCZA 2Z1NA 3GGOA 4AJPA 5JO0A 2HK7A 4J2HA 3KTDA 1FDWA 4LRTB 1X1EA 1ZH8A 5F21A 4FFLA 5IN4A 2W4QA 3MTJA 3UCEA 1UR5A 4CUKA 5JW6A 3WQQA 1BWSA 2HCTA 2O3RA 2OORA 4GGPA 3FR7A 1AXGA 4WLFA 5JYDA 1X15A 2QRKA 3E5MA 1VL6A 2WYUA 4BO8A 3VOSA 3PJEA 4IPTA 4CLOA 2C29D 2V7PA 3LT4A 2NVUA 4M54A 1OC2A 4PRLA 1E92A 2OL4A 2Q2VA 3JQCA 3U3XA 3ZWBA 2Q49A 4IUYA 4OH1A 1B0AA 1KY5A 4BNHA 5HS6A 5TX7A 2ZATA 3ONDA 2EIHA 4NFHA 3DAFA 4BKUA 3O9ZA 4UREA 1E7WA 6ADHA 2OZPA 3JSAA 2BLLA 2GNAA 5K0ZA 4L8VA 4RV9A 3GNSA 4NFYA 1LEHA 4Z3DA 4II2A 1LI4A 3JQ8B 1Y5MA 2X6TA 1PL8A 3WBFA 1UZNA 1KEWA 3K31A 1A9YA 4YR9A 3AM3A 5A9RA 2A92A 1E1MA 1NTOA 3ZV5A 4ZRNA 4IJWA 4GL4A 1HF3A 4MIYA 3F3SA 1GUZA 3ZU3A 4J9VA 4S1VA 3P7MA 3ZWXA 1JWBB 3LYLA 5DCUA 2V6GA 1GZ3A 3QWFA 4E32A 3KYBA 4P4GA 5C3MA 4W4TA 2GR9A 3TZHA 1KC3A 3AM4A 1Y1PA 4LSMA 1UDBA 4CMHA 4CM8B 2JAHA 4FD3A 1VL8A 4XGIA 4DBVO 4PN3A 1U2DA 2UAGA 3G3EA 3D4NA 5CDUA 2DPHA 1BXGB 4CMEC 3DMTC 1LA2A 1FDVA 1HYGA 1YL7A 3LK7A 1P31A 1LRLA 1V6AA 3FPLA 1E3EA 4MVJA 4J49A 4DREA 3H6KA 4U8GA 2WE8A 3NDJA 5THKA 4ZQFA 1ID1A 1ZXBA 4QO8A 4W99A 4MP8A 1CWUA 2PD6A 5EINA 5GMOA 4MVJP 5KJ1A 1PL7A 4WPGA 1O0SA 5F1OA 3RI3A 4O6VA 1GDHA 1BVRA 4AJJA 1WWKA 2NVBA 1I24A 3O03A 1NQAO 4HFNA 4UVIA 2C2XA 2EG9A 3RJ9A 3U49A 4E12A 5JCJD 1R37A 4F3YA 1YDWA 4J16A 1VKOA 1D4FA 3GAFA 2Y1DA 5CP8A 3H5NA 2GSDA 2X0IA 5JNLA 3KV3O 4BNIA 1X14A 4H3VA 3ITDA 1JAXA 5K9ZA 1PJ4A 4BNNA 1NNUA 3BA1A 1I10A 4E5MA 5EQDA 2CVQA 5F5NA 2QYSA 4BO7A 1YQDA 4XYLA 3GHHA 1T2CA 5HWSA 3WTCA 3JYLA 1C1DB 4W9NC 1PL6A 1H93A 2W8ZA 2WDZA 1BMDA 2UV8A 5EERA 1SNYA 2YW9A 1PGPA 3OQ1A 2RIRA 4KDEA 4QO7A 5L4LA 3S2FA 3WGYA 3OEYA 5JAQA 3RCBA 1LBEA 1DC3A 3ONEA 4D3FA 3OJOA 2FZEA 3JV7A 1YB5A 2BF7A 2VTDA 1IL0A 3KM0A 4P4LA 4PG7A 2ZB4A 3IL2A 2EJWA 3TZCA 1WNTA 4GBJA 2CDBA 3AUUA 1ZEMA 4NK4A 3QVXA 4HFJA 3ENKA 3AY6A 1RYDA 3WWZA 3UF0A 3OMLA 3F5SA 3U9LA 4BS9A 5EN4A 4DPMA 3E9MA 1R15A 1SCUA 1MG0A 2C54A 1ZMOA 1EE9A 4MKXA 2CDAA 1B8UA 1E6UA 1PS0A 4R9SA 1SPXA 1GV0A 5L7WA 5C5IA 4ALIA 3DQPA 4TZKA 5HTOA 1A7AA 3RUAA 5ICSA 4JQCA 1FMCA 2WD8A 1GUYA 1N5DA 2C20A 2NU6A 3PZBA 5ER9A 3QW2A 5L3ZA 4XJSA 3PHJA 3GH3A 2AG5A 1U5AA 3S2IA 2FHSA 3L77A 2X9GA 2Y1CA 4J0EA 3GQVA 3MZ0A 4J7UA 1GEGA 4DGSA 5I7VA 1Q0LA 1Q7BA 3HFGA 4BV8A 2PH5A 5JXWA 3GDFA 1GPJA 1ADCA 4O59O 1O94A 1CYDA 1PS8A 1ADFA 5KVCA 1BXKA 1HTBA 1T4DA 4GWGA 1YOVA 2NNLD 3RSHA 5B4VA 4MOWA 3VH4A 4PLGA 3ORFA 1NVTA 4RF4A 2B83A 3DB2A 5JAIA 2A35A 3JQGA 2OP1A 5GZ6A 4YTEA 5JCJA 4BMSA 2JCYA 4AJKA 3KB6A 2Q4BA 1GFSA 2CUKA 1GAEO 3WICA 2YY7A 1AHIA 3HSKA 4D3SA 1GR0A 2OXIA 1MV8A 3GDOA 3WGTA 4LCEA 1QLHA 1LLDA 4C7JA 3D0OA 4CMAA 1SB8A 2D8AA 3DBVO 1C0IA 4HBGA 1UXHA 1DFIA 5A04A 4CM5A 2XXBA 1ENPA 1GEEA 4J1NA 3AI3A 1NASA 4CQMD 3JTMA 4J9UE 5KVVA 3BMQB 4OOEA 2CDCA 1WLYA 4IDDA 1E7RA 1PEDA 2NU7A 5HS4A 3GN2A 3OJ0A 1PGOA 3AM5A 4GVXA 1H9AA 4KUGA 4DBZA 2QZ9A 2XOXA 2YYYA 4LW8A 4BNFA 3UKOA 3F1KA 4JJIA 4Z0TA 3AOEC 5JAMA 3F46A 3IKTA 4E33A 4RVDA 1OBFO 1HDYA 3EVTA 3EAGA 2C7GA 3RC9A 2PR2A 5CEFA 5MDHA 1E1NA 1WVGA 1PTJA 2I3AA 3O8QA 1ONNA 2P9CA 2O3SA 2HMVA 2WD7B 4TWRA 3H8VA 1QRRA 2V6FA 2FN7A 1O95A 2I5PO 4Q3BA 1BVUA 4XQGA 1OC4A 4RZHA 4F6CA 1FDSA 3OF2A 5MGBA 1IUKA 4IMRA 1SEVA 5A3JA 1T4BA 2R00C 5HM8A 2YFQA 2FP4A 4BKQA 4S3MA 4NI5A 1YVEI 1G0NA 5K6AA 5IN5A 1RPNA 3I83A 4OO3A 4OHUA 4NPCA 3OICA 1WDLA 4KMSA 3WGHA 3H5RA 1DJQA 2LDXA 3U0BA 3PEFA 1NBOA 4CUZA 2VWGA 4MO2A 4XQ9A 4A27A 4AL4A 1EUDA 1UJMA 4ITUA 2AEMA 3VH3A 4BNKA 3VHRA 1DC5A 3UN1A 3HG7A 5DDIP 3NAQA 4YRAA 1RYEA 3PXXA 4WK6A 3BMNB 4DQXA 4E5YA 1WXDA 4AJLA 4BNYA 4DIFA 2FPGA 1E3IA 1OFGA 3GF4A 2PA3A 3FN4A 3SJUA 4MVJE 4RL6A 3AFMA 3GC6A 2O7QA 3HN2A 4CLEA 2ZTMA 1N2SA 2HKIA 2BFMA 4RORA 5B12A 1KETA 2DBRA 1LLUA 2OOSA 1AE1A 1BGVA 3VKVA 1I2CA 1RJWA 2J8ZA 2QX7A 3OJFA 2CZCA 4JBIA 4CLHA 2FWMX 1E7SA 3H3FA 3IQDB 1YE3A 3NJ4A 1YL5A 4IDEA 1U8FO 2UUPA 2C5EA 4R1NA 4M89A 3VPFA 4YA6A 1IE3A 1H2BA 2X5OA 4E2ZA 3KSDO 2FY8A 3B1FA 3PJGA 1DOHA 3HE3A 5DZSA 4R5MA 1BHSA 1ONOA 3A1NA 1Q0QA 4PG4A 5I8WA 1Z73A 1NR7A 3JQEA 1VL0A 1QMGA 3TWOA 2FRDA 3PIIA 1CRWG 4FFNA 5KWEA 5IZ4A 3RFVA 2VOJA 1Z6ZA 1Y81A 1N9GA 4J1QA 5F1PA 5I9MA 5G0UA 4KTTE 1P0FA 2VWHA 4YT5A 1EDOA 2WM3A 1YQXA 1BW9B 3ADOA 1NFFA 5T8KC 1U5CA 2DVMA 3NTRA 3DBRB 1Z7EA 2BI7A 2J6IA 2PD3A 2YQ4A 1ML3A 5TSDA 4OQZA 4L74A 3SBOA 3WWYA 3D1LA 1E3WB 1YH3A 1MFZA 2AXQA 1C0KA 1WP4A 4NBWA 4E4YA 5TJHA 3PI7A 2VNSA 4NQZA 4PZEA 1YWGO 2HU2A 4XR4A 4WLNA 1LX6A 3DMYA 4B7UA 1NQ5A 2O3UA 5EESA 2OMEA 1P1FA 2EP5A 3HNPA 3GFGA 2NACA 2VTEA 2Z95A 3JQDA 2NUAA 4MVJG 3W4KA 2GRAA 2B37A 1DRUA 4LMPA 1H5QA 2FR1A 2O7SA 4GQAA 5A9TA 2NU9A 3GGGA 1NFRA 3INGA 4YJFA 1PIWA 1R4MA 1V3VA 3JD3A 5CPFA 4MINA 4NNJA 3GY0A 4D0SA 3JD2A 3I6QA 2DBQA 4CMJA 4P4NA 4BO3A 4L9RA 4ZHSA 3MJ4A 2IYPA 3QRWA 4A03A 4OIMA 4M49A 3UGKA 1KVTA 3GHYA 5I7EA 1GYRA 1JTVA 3C1AA 2H5LA 2PZMA 4WNIA 4YJGA 1UP7A 3I52A 3FI9A 4IXTA 3DBHB 2ZJ1A 1B8VA 1PZEA 3FNFA 3H9UA 1NFQA 1QG6A 4ZJUA 2ZB3A 1V3TA 2DFDA 4A5OA 4XX0A 2BRUA 1ENYA 4FGSA 4OGWA 1GL3A 2PH3A 1SC6A 4BNVA 2VHYA 4E3ZA 3NGLA 2YDXA 1ZZEA 5KVSA 2VYND 4YRDA 1QSGA 5BSEA 3KBOA 4PCVA 1CDOA 3DHEA 3EY4A 3VAZA 1JA9A 1N92A 1I8TA 5FYDA 4FOSA 4CQMA 4E2XA 3PP8A 1LSSA 3BIOA 4KUEA 4IDAA 3VTFA 4A2CA 1U9JA 1LC3A 2O3QA 3FWZA 2EP7A 3DL2A 3FR8A 3MOIA 3VPSA 1XWFA 3JQFC 4EUEA 4IDBA 1EMDA 1ORRA 4ND4A 2A9FA 3GMSA 5THQA 2EEZA 4PLWA 3QWIA 4IDCA 3GZNA 3H9GA 1PZGA 4KOAA 3D3WA 3ZZNA 3WGZA 3ZWAA 2NQTA 1JU9A 3D7LA 1NAIA 4IIVA 4FJ2A 5BSHA 3I9NA 1HYHA 2YHIB 3CZRA 3EMKA 1QYVA 3JD1A 1U4OA 1MC4A 1XEAA 1U1IA 4R54A 5CFZA 4BO1A 2C5AA 2AQIA 2PZKA 1DAOA 1HDXA 3IP3A 1HL3A 2OBNA 4IQ8A 3CZMA 5A06A 1O89A 3DOOA 1HWYA 5TIIA 3IKVA 1SB9A 4RPLA 5JDIA 4A0SA 3RKUA 1PQPA 3MWDB 4GPD1 4RF5A 1ENOA 1GUFA 3FRJA 3QVSA 4TVBA 3RAJA 4E0BA 4EITA 3QVOA 3RJ5A 4HNGA 4WLVA 1RKXA 4M1QA 2B35A 3C1OA 3OHSX 4PZDA 1T1RA 3L9WA 4D46A 5LDGA 2PKQO 1L1FA 4RF2A 3EUWA 1K5HA 2CVOA 3MTGA 4LMRA 4R1SA 3P19A 4R3NA 1H6CA 4QXMA 1I3LA 4MP6A 1A27A 1NR1A 1IPEA 4AJIA 4JP2A 5EIOA 1IPFA 3SEFA 1HKUA 3UAGA 2QYTA 4I9UA 4OKNA 1DIHA 4G2NA 5ENVA 1U3WA 4QUKA 3G0OA 3H9JA 4IDFA 3ZI0A 1CJCA 2PNFA 4L75A 2CF5A 1U3VA 1JVBA 3PQDA 4XB2A 3MJEA 2V6MA 1ENZA 1C14A 2Q50A 3LVFO 2OP0A 1P1KA 4FPXA 3JQBC 5H83A 4IGEA 3JQAB 4BO0A 4BNXA 3E5RA 1DBVO 3RUEA 3K92A 5L45A 1ISIA 3VZPA 3UHAA 1I32A 4ND2A 3H65A 4AVYA 3TSCA 3WLFA 4RF3A 4B3JA 4IZIA 2P5UA 1ISHA 3KLPX 4CMKA 1DC6A 2VYVD 3BMOB 1DIBA 2DBZA 2VN8A 4N5MA 4CV0A 3PQFA 4D45A 2O3TA 4M86A 4WKGA 1A71A 4FBGA 4K26A 5BNFA 3ICCA 4JN6B 2WEKA 1K6XA 5KOIA 4BO2A 4FGWA 4YWJA 3E82A 1VJTA 4PVCA 2O3JA 1U8XX 1JLLA 1J0XO 3VKUA 4GGOA 3WIDA 3VZQA 1IZ9A 3V5NA 4YRBA 4PLVA 1X7GA 3IP1A 5JYEA 1S6YA 2C82A 2VHWA 3M2PA 4OXKA 1BTOA 1YQGA 3HDJA 3TDKA 1W0CA 2P4HX 4NG5A 4RDHA 4Y6SA 5F5LA 5IZCA 4DL9A 2GZ3A 3PRJA 4XWYA 4O0LA 5TT1A 3V2UA 4Y6RA 4PG5A 2I9PA 2W2KB 3VZSA 4CV1A 3H7AA 3X2FA 3X2EA 1NHGA 3PTZA 3I9MA 3ZDFA 1VM6A 2G0TA 4GX1A 4WCFC 5JE8A 1Y6JA 3L4SO 3JD4A 1B3RA 1WZIA 4JXKA 2G5CA 3E1KA 3COSA 3WOHA 5TGDA 5L95A 3S1LA 2TMDA 5CEEA 3D64A 2PFGA 4MIEA 4JJFA 1X0XA 3KEOA 2VYVA 2GN6A 2VWQA 4FSHA 1T2DA 1EVZA 3HDHA 4KQWA 1FJHA 1WW8A 2Y66A 1W73A 3C7CB 2FR8A 4ONEA 3WYBA 1UDAA 5IF3A 2B4RO 1K2WA 3H5AA 4BB6A 2JJYA 2VUSA 5DOVA 1RM4A 2YFHA 5KTKA 3WB9A 1ZO8A 3JQ7B 3I23A 4R41A 2JHFA 3TZ6A 4R69A 4XQCA 4AJ4A 4Q3NA 3RASA 3GG2A 3WFIA 4N7RA 5TQVA 3RUHA 2GO1A 2JCVA 3GR6A 4DQVA 2ILTA 3U4CA 2BH9A 3ST7A 3QHAA 3JCZA 3R6DA 3D5QA 3O4RA 3PVZA 2I66A 3E03A 4NK5A 3WQSB 1HYEA 4DLLA 2DLDA 1UXJA 2HO5A 5A5EA 1HLDA 7ADHA 3EVNA 3Q9UA 1I2BA 1E1KA 2JD0A 3C24A 4DIOA 1CQIA 1H6BA 3PIDA 2QIOA 1SBYA 2J3IA 3F4LA 4NBRA 5B4UA 2VZ0A 3SXPA 5JS6A 3DOJA 3W4IA 4YVFA 2RCYA 3AU9A 4BGEA 4PZCA 1P1RA 2D5AA 4R16A 3F6YA 4EJ6A 2QZZA 2NWQA 1LXCA 1ISGA 4GMGA 3VH2A 4EUHA 3OJEA 3U09A 3WSWA 2BGMA 5G2OA 1ISMA 2VHZA 4NZ9A 4OMUA 4F45A 4Z6KA 2B36A 3OIDA 3EGOA 4PLHA 4TKLA 3W8DA 3L07A 3S2GA 4E6PA 2H9IA 2NADA 1YL6A 4UEOA 4DUPA 3G79A 3CXRA 3FHLA 3DZIA 3NV9A 4D44A 1PZFA 4UUOA 2XPCA 4GVLA 4P8RA 3W4JA 4EJ0A 3KEQA 3OIFA 4Z9YA 3EZLA 1F17A 3GAZA 1ZK1A 4CM9A 1R0SA 4ESOA 1PQWA 3P2OA 1T24A 2BELA 4EDFA 3TQHA 4XKJA 1QV7A 2GCGA 3DONA 3TFOA 3WJAA 4AJ1A 1E3JA 2DTDA 4IMPA 4WGGA 4AICA 4M87A 4R01A 3GNTA 2ZQYA 3HWRA 4I8XA 4DYVA 1PJBA 2GDZA 3RIHA 5JDCA 2H1SA 1DIRA 4PG8A 4KDFA 4PGFA 2E49A 4IBOA 1G0OA 2P2SA 3KETA 3KYDB 4ND1A 1LDBA 1CF2O 5CAEA 5BSGA 2JD2A 1I3KA 5TF4A 4XQEA 4EEZA 3PYMA 4JNKA 4KQXA 3B6ZA 3FD8A 3DFUA 3AJRA 3ZNOA 3LQFA 2D3TA 3WGQA 3VC7A 1I01A 1CQJA 1HZJA 2YHUA 5L53A 2IZ0A 2OUIA 5T6BA 4DIBA 4J7CA 3BHIA 4H7PA 1TI7A 2AW5A 2ZTVA 4GSKA 3GRPA 2GYYA 1MGOA 3OH8A 3TL2A 2NV6A 3E6AA 4BL5A 1M6WA 2Q1SA 3PGXA 3VVBA 1LRJA 4WEOA 4OYRA 1EVYA 4XYMA 3T4EA 1JW9B 5EJ2A 4UEKA 3AU8A 1XU9A 5HBRA 4DC1A 1NAHA 4BIIA 2PGLA 1M75A 3MJTA 3SC6A 1P74A 4YAJA 1Q7GA 3FSRA 1YKFA 1SOWA 1PSDA 4E13A 2ZYGA 2WTBA 3PDJA 4GLLA 1W6UA 4I08A 4TSKA 3TNLA 4NBUA 3W1VA 3A9WA 4YPOA 1EE2A 3ROPA 1PGQA 5A9SB 5C37A 1ZVMA 1Y8RB 4ZN6A 1P77A 5A03A 3V1TC 3CEAA 5IAAA 3GA0A 1MA0A 2W90A 4NU6A 5TJ9A 4FW8A 4BNUA 5KJFA 1I3NA 3D4PA 3ICPA 1RM5A 1Z82A 3KYCA 4CM4B 1OOEA 3IC5A 3JQGB 3FBTA 4Z0PA 3PDUA 2Q46A 4WJZA 3LLVA 1M66A 3OSUA 1E77A 4XZ3A 5AXCA 3E48A 2J5KA 2QQ5A 1DEHA 4KWIA 3NT4A 2UUOA 2PKRA 2AE1A 3VDQA 1DAPA 3WSVA 5A1TA 2E37A 4U6QA 3NT2A 3L9XA 1ZNQO 4BGIA 3U4DA 1UZMA 4GAEA 1IB6A 4IINA 1F8GA 2O2YA 2ZQZA 5CPBA 4MPDA 2NM0A 2ET6A 2C59A 1ISFA 4QT0A 4U5QA 1C3VA 1H94A 3JD0A 1GY8A 2VRBA 3VH1A 4FC7A 4QFCA 1DRVA 3BMQA 4BQPA 4FIZA 1TVEA 1ULUA 2GLXA 3GK3A 3G1TA 3OQ6A 3PYLA 4IXWA 5BQFA 4NDNE 4CQLB 4J1SA 4YEDA 3HDYA 1PX0A 2J3HA 1XKQA 1K6JA 2VT3A 4QECA 5DP2A 1E6WA 2W2LA 3VTZA 4NIMA 4ALNA 2A4KA 2DFVA 5JMPA 5ITVA 3ZNPA 2D5CA 3NX4A 3I4FA 5A4DA 4YAIA 1IYZA 2WYVA 2NTJA 2WD7A 2ZJ0A 4P38A 3IIEA 4CMIA 3PWSA 1J5PA 2Y0CA 3ETDA 3DTYA 4ALLA 4Q3EA 1XGKA 3DHNA 1YXMA 3HDQA 1TT5A 3HZZA 1DLJA 2P9EA 5JLAA 1HXHA 2EKLA 1JDJA 1GYPA 3EC7A 4WEQA 9LDTA 1KEPA 5I9NA 1XSEA 1ZK0A 4MKZA 3G17A 1M67A 1R4NB 4D0RA 1AXEA 1B26A 3ANMA 4FB5A 3GZ4A 5DNAA 1U4SA 1K89A 1V0JA 2H6EA 2I6TA 2YJZA 2CD9A 1M76A 3ZWMA 4B4VA 4F46A 3OQBA 4Z9XA 1T25A 3UFXA 1IZ0A 4GH5A 4RQUA 2A94A 4HY3A 4HFMA 5GY7A 4UULA 6LDHA 3DZKA 1R6DA 2NVUB 1E5LA 3EW7A 4RDIA 4PLYA 4JJGA 2ZK7A 2HMWA 3ZU5A 2Q2QA 1X7HA 3S55A 3TOZA 5ILGA 3I9KA 1KERA 2EERA 5HA5A 5JY6A 3R0IA 3P5SA 3ZHZA 4Q3DA 4CR8A 2Q3EA 3GVIA 3H9EO 2Y68A 1F12A 4DXHA 4J0FA 4IQGA 4OAQA 2GERA 4JCOA 1NPYA 1XQ6A 1IOLA 2AA3A 4TRRA 2EW2A 5IZCC 2NTNA 3WGIA 5B1YA 5L4SA 2ZYDA 3LF1A 5F3RA 4CV3A 3K2EA 1ZXLA 4OXYA 3ADPA 1ISJA 1VSUA 3DEYX 5G0VA 1E7QA 1GU7A 4WOKA 5IXSA 5KJEA 4YXFA 4WECA 2ZCUA 1U3TA 2PTGA 3JYQA 4XRGA 3IUPA 3PLNA 1QKIA 4Z9FA 2G82A 3GVPA 1H2HA 4N5LA 4J4HA 1Y9EA 4MVJH 2I67A 3QJ5A 3ZU2A 1WPQA 1UXGA 4I9NA 4A7PA 2B4TO 1O9BA 1SEPA 3ZHXA 1BXGA 3ON5A 5JSFA 4YAGA 3HADA 3MWEB 4FC6A 1X0VA 3DXFA 3ABIA 3UH1A 1P9LA 1KS9A 2PKQP 5A05A 5COBA 3SLKA 3T7CA 4E31A 2Z1MA 2P91A 3PFFA 1BW9A 1EK5A 3I4CA 3DMTA 3ASVA 3DBRA 4JGBA 1CIVA 3JQBA 2VYNA 3SLGA 3CTMA 3I9JA 5IG2A 1E3WA 1PJLA 1IULA 4XYEA 1VRWA 5IXYA 4CLRA 5KIAA 3NUGA 4I5EA 1D1SA 4LCJA 4U0JA 3D5TA 1YS4A 3FCOA 3GPDG 1NQTA 1VC2A 3CKYA 2X58A 4HADA 1HDCA 1D3AA 2Q2WA 2Q4EA 3R3JA 5TS3A 1QLJA 4TZTA 1PWXA 3ZWNA 4B4UA 1KVQA 3R1IA 4WOJA 1ZSVA 4BUCA 2C07A 1KEUA 3VPXA 5HRUA 3BHJA 1DHRA 4LVCA 4E21A 4CMGA 4B4WA 3H4VA 1K3TA 2CF6A 1TT7A 1B3BA 5IDYA 1W4ZA 3K9QO 2PLAA 1KVRA 2Y67A 1C0LA 2I3GA 1WMBA 3IMFA 4YJGB 2C7VA 4NH4A 3GVXA 4QQRA 5LC1A 4X54A 1YBMA 4R3WA 2JFHA 3LF2A 4FR5A 4AFNA 4L4XA 1BRMA 4HNHA 4HX5A 3RROA 4IDGA 2Y0EA 5TLSA 3NGXA 1RWBA 3DZFA 1A7KA 1HE2A 4QEDA 4WCDA 2O4CA 3MEQA 2AMFA 2BKAA 1LNQA 1L7DA 1MX3A 2E82A 3CPSA 2NVWA 4NJMA 4CV2A 1X1TA 1JAYA 2OFPA 5H81A 2IXBA 4O1MA 3CINA 4DWVA 2BHLA 4RLSA 3SC4A 4E30A 3WBBA 1V3UA 3IDSA 3ZGYA 2X8LA 3WYEA 5A3VA 1WMAA 1B14A 4H16A 1C1XA 1DRWA 1N1EA 1N7HA 3AK4A 1HZZA 4JK3A 4TQGA 4UVEA 5AXDA 3IJPA 2IYOA 1I5RA 3GOHA 2OO5A 3WDSA 2HK8A 3ZU4A 3L6EA 3WQRA 1PQUA 3CSDA 2O48X 3Q6IA 4YJHB 3JYPA 1VJ1A 2JHGA 2Y1FA 4IZHA 1NVGA 3K6JA 4PFJA 4E5KA 2EF1A 2VOEA 4TVOA 1Y7TA 4XB1A 2B5VA 2FOIA 1HLPA 3RBZA 5I7SA 5JAZA 2CVZA 1HEUA 1PGJA 1PS9A 4B8WA 3A4VA 3MCVA 4N18A 4E5PA 4I5FA 5ADHA 1R12A 4J4TA 1F8FA 2EKQA 4HWKA 3DZGA 3TFQA 4CM8A 3FBGA 1LDNA 4DYDA 3FF4A 4YJDA 1EEHA 2XF8A 3L0DA 1UP4A 1BDMA 2XAAA 2AE2A 4NU5A 2CSUA 2POQX 4IJUA 4R9RA 1PJ3A 3L4BC 5L51A 3UUWA 1NPDA 4AG3A 4K6CA 3E18A 3WR5A 3NTOA 1B8PA 3I1JA 4XGKA 3QY9A 1DHTA 3Q11A 3H3JA 3KSZO 3WLEA 4L4RA 4BO4A 3RD5A 3WNVA 5C7LO 5GZ1A 4U0KA 1NHWA 4XRRA 2GN4A 4FJ1A 1SO8A 3QP9A 1HDGO 2GPTA 2W98A 4TMFA 4ZQGA 1PU2A 4GSLA 1U3UA 1A4UA 3DC2A 1T1SA 3DAGA 2PK3A 3AI2A 5EPOA 3CUKA 3C1TA 1DFHA 1FDTA 3GGPA 4XJTA 4LSWA 4HV4A 1JKFA 1LDMA 2GN9A 3AUSA 1TA4A 3UOGA 3FTPA 2BFPA 5CG1A 1QV6A 1QP8A 2O4UX 3K96A 3OP4A 1JWAB 1PJCA 1EUCA 1BXZA 1HETA 2VCYA 1EQ2A 3A14A 3KRTA 4OOFA 3TRIA 1XG5A 3S2EA 3V8BA 4JROA 3PHHA 3N58A 3LT1A 1E6EA 1Q1NA 3EYWA 3D4OA 3M2TA 4XEHA 1C1DA 1F06A 2RBEA 3BMOA 3NRCA 3PHLA 1Q0HA 4OSOA 1P44A 2XXJA 4DPLA 4CR7A 5EMHA 2JFFA 1O5IA 2HJSA 2GUGA 2HMTA 3ROQA 1KVUA 1L7EA 5L7YA 5LDHA 1B16A 2RH4A 3A28A 1Z45A 4K6FA 3GEGA 3TN7A 5JCXA 1B15A 3CH6A 4IQ0A 4BB5A 4JX8A 3RFTA 3C7DB 5L4NA 4ALJA 1CEQA
chains in the Genus database with same CATH superfamily
1EJ2A 3UJ7A 3GLGA 3O8DA 5FI1B 3G1WA 3QKWA 3TRHA 3LXXA 4DMUB 4I1SA 2EZ9A 4PZ0A 3RTDA 1YJQA 3HCRA 2BMEA 1U9CA 3PGLA 4MR7A 3H17A 4WZZA 4ZU1X 3VTKA 3WC4A 4E5NA 1T8TA 2GPBA 5LBUA 1KJIA 4N82A 5JYBA 5BXYA 2JFGA 3I0NA 1E66A 4FE7A 4CM9D 2AR7A 2FRXA 3DLBA 3DDUA 3T3DA 4B7XA 1GQQA 2OCAA 2E4YA 3VRHA 1VPDA 4H77A 3PV0A 4YV7A 4KB5A 4DJJA 5F52A 4Z1MA 1F20A 5JPIA 4EI9A 1AQIA 1PN3A 1QLWA 4OAPA 3HFSA 1CJSA 4RK4A 4K6HA 2HGSA 1ZNZA 1WDWB 5LP6B 5CFNA 3CWCA 1L3BA 2RHHA 4O4LB 5AO9A 1Y5RA 1GPBA 2I6XA 2YWDA 2F90A 3ZDBA 2BEKA 4BNLA 3ZHOA 1F48A 2Y93A 1Z34A 1G291 1T2AA 5MF6A 4OHMA 3SQWA 2J87A 2Y2UA 3U3JA 2I76A 2X19A 2OV3A 2DP4E 1KKUA 1IXZA 2O2JA 2O20A 3IPRA 4KL8S 3V2IA 4DMLA 2AUNA 3D6JA 1OD6A 1KDZA 1RM0A 4EG0A 2R2GA 4R2HA 1L2TA 2D1RA 2WW8A 4B75A 2HFJA 5AM5A 8ABPA 1UP6A 3I5AA 1QS0A 4C5AA 4G65A 1E2DA 3QVWA 3KAPA 4B3HA 1GGMA 4CG0A 1Z0AA 3DZBA 4R7TA 4CM1A 1Q0UA 2BMDA 3HKBB 3HMQA 2NO1A 3NWJA 4RZIA 1RZVA 3HM9A 4KC0A 4RC9A 1DG3A 1KI3A 2H2IA 4KZPA 5DBOA 4YB8A 1YJ8A 3BDAA 1JSLA 4GLOA 3U7QB 3H6GA 1RXEA 4KUHA 1NSYA 5D3MA 1O08A 5HYVA 2F1OA 5F33A 5CA1F 3DYIA 2G36A 5AK5A 4BV9A 5HOEA 2NLOA 3RUDA 1W0JA 1K86A 4CF5A 5CCEA 1P75A 2AI3A 3ROKA 1IWPB 1WEKA 3SVTA 1EFAA 2JLWA 1ECPA 2DHQA 5CM8B 4DLZA 4NG4A 3TJMA 2D0IA 3BQNB 3AIKA 2GJ8A 1SQ5A 2JBAB 2MINA 4HLNA 2VP5A 2P9FA 1V8BA 1GQYA 1XV5A 1VBNA 1E2PA 1Y8AA 4X9XA 1S02A 1T1JA 1WDKA 5IBQA 1XRRA 4YYEA 4HDNA 2Q9UA 2X7HA 4LNUB 2XXAA 2O0JA 3D3JA 4ZEWA 2EAUA 2OCGA 3M6XA 3V1UA 1K0FA 2ZS9A 1SFRA 2E4XA 3HUDA 3ICWA 5DNWA 5AI4A 3VI4B 4BE4A 5I9BA 3W3ZB 3WNZA 2PHZA 3CZQA 1M83A 1LDGA 3P9CA 1OIVA 5H9WA 2JFVA 2N75A 4Q4AB 4G5HA 3GNQA 4ED9A 3G8YA 3QBVA 1EINA 3G0CA 2YY6A 2QN6A 2BZGA 4N7BA 1E2UA 5DNDA 4N0DA 2ECQA 1FDUA 3IMGA 3DUFB 3R0VA 3KQOA 5SZKB 4Q3AA 3GAMA 1KI7A 3GDHA 1WPGA 3KSUA 5FOXA 2FQXA 2I3ZA 3NJRA 5NLLA 3WLOA 4DV1B 1J00A 4KBFA 4FWTA 2JG3A 3MPOA 4X24A 3LFUA 1MXFA 1CJKC 3PITA 3NVMB 3W5VA 5GJCA 5K3CA 1Z2DA 1KMNA 2HD4A 2P35A 4K28A 4BNGA 1VLHA 5IKXA 1L8OA 1N2OA 1Y3HA 4OH7A 2HRDA 3HB4X 1PNTA 4EG4A 3GRCA 4Q34A 4GX0A 1VBFA 2X9LA 4NLLA 3F5QA 4RK5A 5CJPA 3URKA 2AYXA 2H11A 4YIKA 1GGEA 5AJTA 5K0SA 2O2GA 3I5XA 3FKJA 3M6LA 1N2CB 3R5XA 5BQOA 1CUGA 1RWMA 2C9ZA 4YO7A 4DSAA 5L3SB 1PR6A 3CS3A 5LWQA 5JV5A 2XOKD 4IAOA 1ZL2A 2QDKA 1OV4A 2B6HA 1SKBA 3KWJA 3PS9A 1NU8A 4L4SA 2NYAA 2PS0A 5A02A 1JKJA 4KIFA 4CTNA 3EXEA 2PXCA 3O4IA 4Z4GA 5MFPA 1M6HA 4DJTA 1QRUA 2FQWA 1E99A 2FX5A 4A15A 3PKZA 1X9IA 3AHCA 3ENWA 3NI2A 1Q6ZA 2XZTA 1L5MA 2ZWIA 3C5CA 3LI2A 4PPYA 2Z6AA 1DIGA 3C41J 2VDWB 3D7MA 4XDZA 1K5GA 4F9EA 1QOPB 1CKEA 1W36B 5I7WA 2GEJA 2Z5VA 3UH0A 5JC1A 4CLOB 1XP8A 2J3MA 5LQRA 1EA5A 3AF6A 1Q7TA 3PL1A 1NLZA 2JAOA 1ZK2A 1YUNA 2UXDB 3Q2KA 4U7JA 1R2QA 3QELB 2HDNB 2DBVO 3IVRA 1KOLA 1FYDA 2ZJ6A 2VUUA 3TZQA 3PDIA 2VUTA 1T8UA 1MVOA 3HB9A 8GPBA 2YDYA 5FH9A 1L5HB 4LXYA 2YJ4A 3PTAA 2NW6A 2O5VA 3SZMA 1TRKA 2Z4TA 3FLAA 1PQ4A 2RHRA 4I3HA 4LV6A 2MSKA 2I3BA 3B9PA 3BJRA 2VT6A 2GASA 5ALQA 2O23A 3I73A 2V7EA 1LNZA 1KEVA 4REMA 2OBYA 4X84A 4GSYA 2ZSKA 3VZRA 3OWOA 1JNXX 1LK5A 3MWKA 4FZ5A 3D3WB 4ZGGA 2RB4A 4WUVA 3RSOA 3S0JA 1MZPA 2OC9A 1JR3D 3VR0A 1DXYA 5KI6A 4DMRA 1I4TD 1XCMA 2ZJ4A 1EZZA 1M7BA 5DF1A 3R9WA 5DGIA 1SCDA 1RHUA 4FZ3A 4MGZR 4PYMA 4YYZA 2UYCA 4GT1A 3RF7A 3P9PA 4EI2A 4RH0A 13PKA 1CHDA 1U28A 1WUKS 1ZBQA 3NVAA 5EQFA 3S5JA 5JISA 4NMLA 4AJNA 1BS1A 3C48A 3A4IA 4YT4A 3DDZX 2O2IA 3H5IA 4UTRA 5JAMA 2ORWA 1E7YA 5F77A 4DA9A 1Y8ZA 3VAAA 3HQ4O 1H6DA 3PPWA 4NZPA 1CP2A 1OLSA 2VHVA 2KLHA 5L7TA 2GF2A 1WPRA 5JNWA 4EW1A 3JWIA 5ES4B 5JJKA 3EIEA 1QQ6A 1WAMA 3F8SA 2OD7A 1NN3A 4IICA 3RYHA 2HOQA 3WSTA 5IVKA 1SHUX 1U5BB 4ZGBA 1F2DA 1V43A 4V3BA 1QWSA 2PLNA 1ZUNA 2FGKA 2QRNA 2DSNA 4G4SP 2RH8A 1DO8A 1MEEA 3FNRA 3SOPA 3DVLA 1WBJB 3PGMA 4BNDA 4D3DA 3CSSA 4HGRA 4ID9A 4K5QA 3EA4A 1D0SA 2VJBA 1KFBB 5DMXA 3DLPX 5BQXA 3OQPA 3Q0EA 4DR6B 4OI1A 2QP4A 3PUHA 3HXOA 2EJVA 3V4PB 1ZGAA 4TLCA 4DFDA 4KMMA 5JY1A 1P3DA 4FFRA 1LX7A 5GM1A 2IH2A 3I6IA 4YQYA 2DZDA 2G9RA 4HT3B 1FK8A 5FF9A 1TKCA 3F1LA 3FMFA 5TVKA 5C32A 2UVQA 3ID6C 3E9YA 3OIGA 4KXXA 4MEJA 3AB3A 1JQ3A 1YTLA 2JLXA 1Z7BA 4G5SA 4ZZ1A 1QH8B 1YZKA 4IIXA 3LCVB 4K86A 1AUPA 5JD6A 5H82A 3ADCA 3L1JA 3ACCA 4U39A 3V7YA 3EH1A 3MT0A 3QVMA 3OTWA 1HV8A 2WP0A 5IFKA 4CMCA 1R4MB 2HDHA 2JBHA 5LXTB 2WUWE 5FJJA 4CEIA 1MH9A 1PFKA 1ZFNA 2JA1A 1DV1A 4GOLD 1XPJA 1HFEL 2PGOA 3Q98A 4KLRA 1US8B 4LY9A 4UVDA 2VRWA 4ARBA 5CNMA 3AOGA 3IQWA 3LO8A 1NWCA 1QFJA 1QG4A 2IPXA 3DV2A 3BG5A 3ESRA 3G0GA 2A9QA 4BVKA 3HCCA 3RS8A 3PX3A 2CV1A 2JIZD 2PA0A 4IGAA 1GVNB 4QREA 2OFXA 2PUHA 5LQMA 4R8MA 1EXMA 1JAZA 3EUEA 4JJEA 1CS0B 3WRYA 3HPQA 3E9ZA 1KDYA 5CDTA 3FOCA 1F0YA 1RWVA 1XB2A 2J67A 2G7ZA 1PR9A 1UDXA 4HN4B 4JR2A 8MHTA 3UENA 3BGIA 5D86A 1ZLXA 4ARVA 1E1QA 4EA9A 4MJLA 3I8XA 4P3YA 4NJOA 1IU9A 2FN9A 3CIFA 1JQBA 4UE2A 5JHGB 2RGAA 4JXZA 2DPGA 4LFAB 1Z5VA 5A0VA 2KLBA 5LNK1 4MR8B 1YULA 1EBUA 2P67A 2H7YA 4US1R 2AFHE 3RVKA 4D98A 1ZISA 1GTMA 1E5QA 3B9RA 1A9XB 2J1LA 3K5PA 3PUWA 4L0QA 4UUAA 1VKJA 4KK3A 1FFDA 1TB4A 4PR0A 3UW1A 4Y2GA 3JYOA 2IWRA 4I5GA 3UFXB 4CJXA 4DQ0A 3TNYA 4MVWA 4NV1A 1A5AB 3MYRA 2EG5A 1AU9A 2Q3LA 1RI1A 4MUBA 2PY6A 4QGFA 4JBNA 4ZGWA 3LG2A 2LW7A 1CZHA 4RHYA 3SX4A 3B1KA 4B4OA 4LJRA 1X8LA 2P6PA 1MFPA 4WH0A 3DO6A 1VLLA 2VZ8A 2X6RA 1W34A 1GGVA 3I6MA 3IS3A 3R7NA 4TKMA 2XODA 3MTQA 2AG1A 3RKRA 3SZUA 3WWPA 2HB6A 2HADA 2NX2A 4D3ZA 2DR0A 5EHNA 1H3FA 2GK6A 3MWYW 4M0KA 3CLKA 1FFHA 5CLJA 1U99A 1XQ1A 5H70A 2RCNA 3LH5A 2R11A 3O1HB 1H42A 1RI4A 1XRMA 1DC7A 2NG1A 1Q11A 2IEIA 1WV0A 2XV1A 3FI0A 2N1MA 3R0XA 5EXDA 5KWJA 3AY7A 2ZCVA 5CEJA 2XUQA 2JANA 1ES9A 4J6FA 2D59A 4EG7A 4ZTZB 1AF7A 1Z75A 3TW4A 4C4PA 4RGQA 1UH5A 3RU2A 5JARA 1P5JA 2GGSA 4QOGA 3QWBA 2WU0A 1HT0A 2ZJ7A 4W82A 5IYZB 1IHUA 1TQ8A 4QUHA 2JFYA 3M6UA 6Q21A 4RQTA 5JBIA 2X0NA 3CH4B 2UYYA 2VEOA 5JJCA 3OKPA 2QL7A 1GG5A 2ZPAA 4WXPA 2X1HA 5ALHA 4D8VA 1LPNA 3ZCXA 4YAEA 2ZJBA 1PT7A 3QGMA 3S6JA 3T9AA 2C98A 1BQEA 3CNOA 4F1KA 4L85A 3TE7A 1KFEB 4GM0A 1ZA1A 1UKEA 4BVAA 4CEHA 4HMOA 1ADGA 2VC2B 1T0JB 3QYPA 3VOAA 3ZCRA 3KELA 2IXEA 2VZLA 4WRRA 4MO9A 4NBVA 5EKSA 1JN0A 4F3RA 5BT9A 3V2HA 2WQ6A 3BDIA 1HURA 2AFIA 3U4HA 4M7OA 4C43A 5F9MA 4R51A 1KI4A 1YIOA 3QYJA 5G4LA 2C2YA 4CF3A 4CVNA 1UPCA 1XYGA 3KZVA 3IVCA 3EW9A 4IJVA 1YFJA 4MS3B 1L7VC 1OREA 4Y1GA 4BAUA 2GBCA 5ITWA 1RQXA 3KCQA 2QP9X 3O26A 1HSZA 4V0ME 3KOUA 3MVEA 4LNHA 4XIYA 4ZO9A 4XVQA 3AWDA 1GUAA 4EW6A 1NVXQ 2EFYA 2XRMA 4YONB 1QORA 2X41A 5B1DA 3BRWD 1OI2A 4RYLA 1HG1A 2V7VA 3S27A 1U0EA 2B94A 3B7GA 4BB9A 2OV1A 4BOYA 3OM9A 3RBXA 2B0CA 2MYNA 1NI5A 5KVQA 5HKOA 5JLJA 4M55A 1C0PA 1S9HA 3EVBA 4YCLA 3Q2OA 1L5WA 3GEMA 5HX7A 5LPNA 1GG2A 5BNIA 3HYRA 3M1LA 4J2TA 1YQEA 4ZQHA 4FHCA 4RK0A 5J2UB 1IMOA 2Q1TA 1GZ5A 3OU2A 1A8PA 2JW5A 2C4VA 3UBMA 1PLLA 1NOKA 2QHXA 1OT5A 1RYYA 4BRSA 2BN4A 1RKUA 4BLSA 2X5KO 1VKNA 3BOSA 5KINB 5GINE 4Y7DA 3FETA 2WV9A 4RPHA 4YC7A 2YUTA 3HO1A 2OA0A 5MN5A 1Q15A 1DO0A 5L3RA 3SQNA 3IT1A 2ZKLA 4ZVUA 2R8PA 2ZI7A 2Y71A 1RVDA 1JJBA 4OSPA 3F5MA 5JTUA 1NT4A 4B76A 5IH7A 5EEHA 2F55A 1Z18A 2HA6A 1GOTA 4Z0NA 1ZLYA 4ZT5A 4J0QA 3SOZA 2Y6VA 5BN1A 2QJWA 4EMSA 3QXHA 4QWMA 2FZVA 3EGIA 1UK7A 1SUSA 4JIGA 1MOQA 4TQ9A 1Y98A 4DKJA 3T7RA 4YHHB 1WUHS 3LCJA 2OV6A 5T7BA 2DT8A 2YWEA 2VNJA 4Y2PA 5AW9A 4CCYB 4DDKA 2EJBA 3T7IA 1DPGA 2J4FA 2XSZA 4L3OA 2WILA 2YV5A 1T6NA 3AEQB 4PC2A 4S04A 2NPIA 4RY8A 2ACWA 3EG5A 3AF2A 1QYXA 1O95C 4QDTA 1T5OA 3N7UA 3IHTA 4NJMB 2A86A 4LHZA 1EP9A 2IIQA 4EBFA 1TA0A 3S1AB 1ZD9A 3BK1A 3MG9A 1F5NA 3G02A 4PFKA 4YLEA 5EJGA 1X1SA 2HMSA 4R1UA 4AJEA 1TO6A 3DSRA 4FYXA 2IHVA 4RACA 3ZKAA 4S1NA 1P33A 2XH8A 3S2UA 3VNQA 3PNPA 1PWHA 4UXJA 2C2OA 3M3HA 1PLJA 1T9GS 2J5RA 4FN5A 5KYUA 3BWCA 5JBNA 5HGXA 5B2FA 1V5IA 3G49A 1Q1BA 2HI0A 3OCVA 4EZBA 3PGA1 4G2TA 5C7OO 1L9XA 1ZOSA 4WASA 3I2KA 4BDTA 4F6LA 1QO0D 2BFCB 4I5DA 1ZKDA 4R1PA 4Q4LA 5G1OA 3KVRA 5C4GB 4NP6A 5IEJA 4NY1A 5BORA 1XXHB 4RHXA 4NZYA 4FMDB 1I3OA 5A9SA 5LYJB 1TEHA 4BHTA 1P5RA 4LJ8A 3WBKA 5CFPA 1VXOA 5CURA 4BVGA 2Q4OA 3PSAA 4IRXA 3FIUA 4GYJA 1VI5A 5ES3A 4DCSA 1RAHA 3AXTA 3T1QA 4RJIA 1ULBA 1XCBA 2PX6A 1VKRA 4RWZA 3SDZA 4B40A 1QC5B 5KHOC 2G09A 2GTIA 1VHJA 1YJXA 5HFNA 3SHTA 3A3KA 3C43A 4BFCA 3OPQA 1N9GB 3HB7A 3K2BA 2XADA 1E94E 2W2TA 4MUJA 1DJNA 4QDZA 2WM8A 1NVKA 1U2SA 2H08A 1BRTA 3L82B 3R6WA 1DKPA 1STOA 1A5ZA 3WLNA 4DLBA 4HAWA 3GMDA 1QWOA 1Z62A 1RMYA 3A6JA 1WBDA 5WRFA 3HHPA 3OE1A 2B7CA 4YJ2B 5EA2A 3CUWA 5LUBA 4Y9DA 4ESEA 4JEMA 1SWWA 4ZCMA 2HT6A 1L5GB 1UMBA 1JPVA 3C74A 2JGDB 2UYQA 2Z6QA 2FUG6 1Q7CA 4PO1A 1U7WA 1QHGA 5T64A 3QPBA 1GNRA 4ECAA 3I9V1 4LY3A 2P2GA 2QAGA 5ECDA 3LC0A 5FBWB 5JEEA 1BKDR 1ZESA 2HBRA 2PV7A 3JVDA 1RJGA 1EESA 2Z98A 1XTTA 2XB6A 3K9WA 1WXXA 1KI8A 4IIYA 5DBGA 1I6WA 3HEAA 1B7GO 1BEUB 2FG7C 4KYVA 1NPTO 4Y6GB 5C1PA 1L4MA 1JEQA 4HP8A 4XWOA 2B0JA 4MYCA 3OZ7A 4EHBA 1ST3A 4FI3C 1OWLA 2IYFA 3A31A 5I9SA 5C7YA 1DBSA 2BH2A 3TSYA 4X60A 5ESXA 4ZOCA 2P3QA 3NTQA 4U6SA 2NO9A 5AK0A 5BQ3A 4P31A 2JLQA 1MB4A 2KM1A 4WMLA 4D42A 3V1YA 1SCNE 4KPUB 4CMBA 1JIIA 3VR1A 4RD1A 3I1YA 3ZDXB 1NJ2A 3PFCA 2V65A 5EWMA 1KIAA 1O57A 4CIDA 3H1FA 1DWOA 4C7KA 1UAYA 5I8ZA 4CF6A 1W5TA 2C8KA 4ALMA 3ZHYA 1RRKA 1RXVA 1QVZA 2ZPTX 3AF0A 1QHHA 1R4NA 2GD0A 5H7XA 5K8VA 4BEWA 1GQOA 2FPWA 4QTYA 3AUAA 3JPYA 2P5YA 4JJ6A 4JVLA 4A8TA 5C18A 2Y05A 2ZE5A 1U3CA 1E0KA 2OXRA 4RZQA 1ZR4A 5F9HA 1FMJA 5IJ0B 2AEFA 1A5SB 1E2HA 1OILA 3EAFA 3OFSA 2O59A 3PQEA 1KARA 3FMVA 2G1AA 4BU1A 3LO5A 1V35A 3ZXYA 3PXCX 1ISPA 1R6AA 4HPWA 4RKYA 3I2IA 1ZGGA 3LRTA 4WCFA 3NIGB 2ETXA 3T1TA 5F35A 1GT6A 4YRIA 2F00A 3AYXB 1NTRA 4EY6A 3RUIA 3R7BA 3T7JA 2FETA 1GGFA 2I6FA 3D3EA 2VDUE 1W1WA 3OLZA 3PB3A 1QAOA 3N1UA 3NRBA 4PFQA 4R1TA 2GN0A 1CUHA 4L6CA 1KDVA 3T1YB 3GZNB 1N4DA 4TM7A 4FCWA 2H16A 3PZRA 3L0OA 4PYLA 1EVQA 1E9DA 1T3GA 5DCWA 5TT0A 1JVSA 1FX0B 1X13A 3JYHA 1WE2A 2R9VA 4I1IA 4INJA 3AT1A 3FNGA 1QHXA 4RAQA 5HTKA 5KC8A 4DC0A 2WJZB 4Y2SA 4CI0B 4L5CA 4NEHB 2H00A 4R0NA 4PRZA 3AR7A 5M04A 3L41A 1AV6A 1GFIA 1RPTA 4YJ3B 2JHCA 1BX3A 4OKIA 2BHRA 4OAOA 2IHUA 1RD4A 5DM70 5DNYB 4F2WA 1MPTA 1TCUA 1D8TA 1U8UA 2ZBUA 3CNNA 4ZU3A 1I5OA 4GKBA 5ERYA 3TAUA 4BVJA 4EH1A 4Z49A 1XWIA 2ZAMA 3UT5B 5EJEA 3LDAA 2Q4RA 3IP7A 4IHAA 4EOGA 5K01A 3K0SA 4XX1A 2FQQA 1R74A 1RW4A 1NVMB 3CX3A 1F2UB 2V3VA 2LWIA 1TGYA 3EDOA 1J5XA 2NO6A 3DAYA 1GN8A 2W93A 4TN1A 4WAUA 1T9GR 4XOIA 5DI3B 1KJNA 4LX0A 5CXSA 2DM6A 1EUZA 5JQWA 2GXUA 5E0KB 4QOEA 4UBJA 5F2EA 3TD2A 3ITKA 2Y6UA 1GZSA 1QZTA 4LUCA 1Y63A 5D5HA 5BWBA 3LGXA 5KZMB 1NM5C 2CL5A 4Y6PA 3ITEA 2A0YA 3ZCPA 2PUCA 1C8KA 1E61A 4UE3S 4PLFA 4M38A 3AKCA 5ARCA 4OXIA 5TV2A 2O7RA 2DUJA 2M6SA 4Q6WA 2UYGA 4FCCA 4HWPA 5EL0A 3KXLA 1FP7A 2YXDA 4QBFA 4TL8A 1T2FA 4DC9A 1ZPDA 3YASA 1P0MA 1UC4B 1QJ4A 2H1HA 4ZCTA 4CG2A 1TD9A 4QE3A 3VMMA 4K81B 1XN1A 1N7GA 1PFWA 3R76A 3V2GA 4D9JA 2VUHB 3QLUA 5AW2A 3B1VA 1KEKA 4RCVA 1HORA 4QFDA 2RJOA 2VRCD 2YY5A 3BMCA 3DEHA 3EWNA 3FRHA 1TM4E 1POWA 4PG6A 3SR4A 3NHAA 1PDOA 3IQFA 3P5BA 4BO6A 3CQ9A 2Q6OA 1YZNA 4FFPA 2O8DA 4K1LA 2FW1A 1H4SA 1YR9A 3BEDA 4FS3A 4I50F 2BFAA 1ODLA 1BDBA 2WSYB 2W4MA 2PEYA 4MWCA 2R1TB 2ZTUA 3GA7A 1UXKA 2WWVD 2GN8A 4LZPA 4NOJA 2R8XA 5AXBA 4OHVA 521PA 3ZQ6A 2WU3A 4R0VA 5BV8A 1GPH1 1Z07A 5F1YA 4JFRA 2G06A 4TKZA 4RGBA 1SR8A 2V7QA 3ZW8A 1Y1RA 1LSUA 4ZI7F 1U02A 3QTBA 3B78A 1VTKA 5JJLA 2Z43A 1YQWA 1A5TA 3K0BA 4HLUA 4IDOA 4IS3A 2FUKA 4TKUB 1JG1A 4HVTA 5P8WA 3UQYS 2Q5JA 2HK7A 3KTDA 1VKHA 1DJPA 2LCIA 1FDWA 1SQSA 2IFTA 1GAJA 2RHTA 3JQPA 4G1VA 4LRTB 1RWWA 3EH2A 1AHPA 3MTJA 4TT3D 3ANYB 1UR5A 2XA2A 3GJTA 4MYRA 4RIFA 4C08A 1BZYA 3FR7A 3TSWA 4CQJA 2XUZA 2AUTA 1XLUA 4G24A 5LQSA 1M7GA 1C2TA 2IVZA 3D4BA 3OP1A 5FPPA 2QTZA 3QQ5A 1VL6A 2WYUA 4BO8A 3VOSA 2PSJA 4IPTA 1GAQA 7REQA 1PF7E 1JDSA 4CLOA 1XL0A 3LRXA 3LT4A 3QX3A 4IFBA 5LZ4A 3UC9A 1OC2A 5TB5A 4DVGA 5BNZA 1UBHS 2JZOA 3K53A 1RZ3A 2H4HA 4KLNA 1T1GA 4IUYA 4LJAA 2XB4A 1AF4A 3F6BX 3X1DA 5E7JA 2QTHA 2RBKA 4BNHA 3I92A 1VL2A 3E3OA 4KDCA 3RE1A 4NFHA 2VTBA 3L8EA 1F0KA 4BKUA 1VGRA 2KBFA 1SUDA 1E7WA 3DW3X 2ABWA 1MX9A 2GPSA 3L93A 4GC9A 4IWNA 4LJLA 4V0NA 3ZKWA 3JSAA 2YJGA 4W5RA 5BQPA 3ZUGA 3R5JA 3OESA 4RV9A 5JOQA 1LEHA 2PBZA 1W87A 2UYHA 2CV2A 5EXEA 4M8NE 1Y5MA 5L6MB 1EP1B 3EXIA 1VZ3A 3ZX5A 1A9YA 2XGMA 2JGAA 2PS3A 3GGDA 3GPCA 3AM3A 2WJHA 4GYYA 4YR9A 1NTOA 1U2GC 2IY9A 1KMHA 5JMTA 2VAXA 1UBNA 3FOBA 2FG6C 3IKLA 4MIYA 5CA0F 1R0BA 2FSGA 2PZBA 3D9QX 4S1VA 2ATIA 2OKGA 1TCAA 1YS7A 3DMGA 4I4LA 4U9IS 1NYLA 2QNBA 3T0GA 4QNMA 1RKQA 2DUMA 3P9ZA 4P5PA 1II8A 2GR9A 2OQ2A 4Y2HA 4D9EA 3EN0A 3EWSA 1IN7A 1J21A 3LJKA 5SYMA 3STTA 4MPRA 1TYEB 1N36B 4AZSA 5FV4A 3TQSA 1C41A 3CVJA 2BLNA 4LC9A 4C4XA 4R6XA 2PX5A 1DKNA 4XGIA 4PN3A 3K0FB 1BVYF 2H5EA 2YZGA 3COWA 3KAJA 3ESQA 1O8BA 3FCUB 1QJCA 5BYAA 3G0IA 3RYHB 1BXGB 3RT7A 3WY9A 3DMTC 1LA2A 3TW8B 1HYGA 4LPSA 4OVKA 3GP8A 3CZCA 2PUVA 2ZIXA 2M6KA 1O9HA 2FZLA 1MO6A 1P31A 3K5WA 3CEJA 3LK7A 4JJKA 1E3EA 1NDUA 1TF7A 1ZGJA 1DGQA 2OB2A 3H9CA 3KQQA 2N3ZA 3MJHA 4DREA 2SBTA 3HP7A 1YC2A 4QQKA 5GJBA 2YWRA 2YFKA 3LUDA 2OBMA 3LUJA 3NDJA 4KQMA 3V1MA 5JCOC 5M29A 4W99A 3R4VA 1T9KA 1SUFA 2IZOA 2PD6A 3P4UA 2YIDA 5EINA 2ZU6A 5GMOA 4GGMX 3T7KA 1EIWA 3VOBA 3D31A 5IM5A 2E6KA 5EKXA 5ALDA 4IH4A 4O6VA 5DM60 4BJ3A 5HK9A 5J2TB 3A7EA 3SS7X 1KH3A 1U0SY 4R1MA 3RHFA 3WKEA 5K8LA 1ZIPA 1I24A 3O03A 4E12A 5JCJD 4I14A 3ER9A 2XYVA 5DYGA 1DUSA 3I5UA 2JFPA 2F8LA 2G9UA 2JAXA 3M33A 1CRZA 1D4FA 4KLCA 4TXNA 3RVQA 3A1UA 4C87A 3WNBA 2RJ3A 1CFZA 4B3BA 5JNLA 3EXG1 1XJQA 3N2GA 121PA 3AQIA 4Q93A 1QPZA 2P40A 3KKKA 2DFPA 1O77A 3PF8A 1FEZA 1E1CA 1EZ1A 2FRDC 3CEMA 4BNNA 1NNUA 3BA1A 3LZCA 4RS4A 4Q9HA 3OJWA 4E5MA 3ORYA 3PFHA 2WD9A 4HZUB 4IG4A 4UJ5A 1O87A 3MJDA 4JI5B 4MIKA 1M8KA 4ENUA 1GCIA 3GHHA 4AAYA 1NF3A 2AGVA 3AY0A 2HREA 3WTCA 2ZRQA 3UAXA 3NIDB 1E6LA 1H93A 1HBJA 1A9PA 2W8ZA 2WDZA 4BBAA 3FMPB 3EPHA 4HEHA 4OMDA 4QOSA 4RMIA 1SNYA 4UNNA 3ZYCA 4QO7A 1Y48E 2W11A 3H86A 4IKPA 4N8SA 3ZJVA 4C7XA 1MX1A 3RCBA 5J5AA 1XTUA 3JARB 4KKVA 2H1RA 1JIKA 3JV7A 3KM0A 1IL0A 2VTDA 3D8NA 3R44A 2CT8A 2ZB4A 5HJ2A 5K0CA 4YMTA 1WNTA 3L7AA 4B3XA 3S99A 1A0OA 5H16A 2C4MA 2XCRB 5JPDA 3QVXA 5CTJA 1DTSA 3ENKA 3R4CA 5JRJA 1EM6A 1P62B 2K2QB 1JJ7A 2Q0HA 3B1ZA 4MA0A 4Y18A 4CTJA 3VNUA 4BS9A 3E9MA 1A9XA 1XPUA 4U3JA 2ZTSA 2UZIR 3P94A 3RUPA 4TTPA 3NXKA 5EPUA 2C2ZA 1B8UA 3KQWA 3SIWA 1JU3A 3KSMA 3MGGA 4RCYA 3OT5A 4HX2A 3OPYB 1BNCA 1PKEA 4I6GA 3ZOZA 5TPZA 4YR7A 1KK1A 4J0IA 2QSUA 4YRRA 2J6BA 1Q50A 4QPJC 3EMDA 3EFHA 5AM3A 1OFVA 1XMSA 3LYUA 1N33B 3UWSA 1PFYA 1WHSA 4LWOA 4TZKA 4AZTA 5HTOA 4YP5A 4PAQA 3RUAA 1J7KA 1XTKA 6REQA 2JS7A 5ICSA 1QBKC 3D6TB 4FMBB 1N5DA 2C20A 2NU6A 3FZEA 1BCSB 1ISRA 3A9VA 4H6XA 1VHTA 1EFHA 2C5HA 3FPEA 2JVIA 2R97A 3HDVA 3GH3A 3PHJA 4L16A 4XJSA 2PRSA 4J8PA 4YRQA 1J1ZA 3T7AA 1UIRA 1ZMRA 2FHSA 2J7PD 3ISVA 3CZ9A 2OXEA 2V7BA 3L77A 2HWXA 1OTHA 2Y1CA 4L4UA 4ZYUA 1XP5A 3MZ0A 1QIDA 5BXQC 1WXIA 4XOUA 2FEWB 1IUPA 1XQVA 3HGMA 4HGPA 5JXWA 4JOSA 1G7TA 2XEDA 3PUJA 4O2BF 4UFOA 1CUSA 4A0HA 1A8UA 2WIDA 4Q48A 3R7DA 4JLJA 2GH1A 1T4DA 2Q6KA 3IXMA 5EUMA 3EIUA 1CTQA 2XRYA 3M49A 3R0ZA 3RT1A 4ZIRB 3VH4A 1E9AA 1JIVA 3ORFA 1NVTA 1JPUA 2ZBPA 2ZG6A 4IXDA 4PLGA 4OHCA 5EWLA 5IYZA 3JQGA 2OP1A 1JIUA 2VPWA 5FL7A 4XXHA 2HT1A 4YTEA 4INOA 1C5KA 1NBHA 4G09A 3I2HA 4EG5A 1MABB 2ID7A 2JI6A 2H07A 4KXYA 1RYFA 2CUKA 4FGUA 4RKFA 5HQTA 4DMHA 1MO2A 1G5HA 3IBFA 2W7TA 4C7BA 2CFRA 1F5SA 3F5DA 5B2ZA 1DV2A 2IYQA 3ZDQA 4GS5A 2OXIA 1IK4A 3GDOA 1NIPA 2FH5B 2JBAA 1I1OA 4GMDA 3D0OA 4F8YA 1S3FA 3DBVO 2EU8A 2MR5A 4EKEA 4AX4A 2XXBA 1ENPA 1XRQA 1QHNA 2HPVA 2W6IA 4X94A 3VV2A 2XXAB 3JTMA 2K7FA 5KVVA 5LU9A 3CA8A 1N32B 1QGED 2CDCA 1WLYA 2FN4A 3EJWA 4IDDA 5HS4A 2P69A 1DBRA 3OJ0A 2G3YA 4NRDA 1P9OA 4TYPA 4EIWA 1TTHA 2R8OA 5CMLA 2WSMA 4ZVRA 1UM8A 5KSPA 2YTZA 1T4CA 2YZKA 3B5IA 4BNFA 4C4RA 5CH5A 4L0CA 4JJIA 4Z0TA 3UKOA 3WMGA 1R4AA 4V39A 3PPYA 4HDRB 5ED0A 5F2KA 4NE2A 2CJWB 2CXUA 2B2XA 3EAGA 1TM2A 4M36A 4M1TA 3EUAA 1BEZA 4IHQA 5FORA 2ONYA 2G67A 4P7GA 3KWFA 4X1YA 2LCQA 5AHOA 4E3WA 5AVWA 1QMPA 1WVGA 3TBHA 5H3HA 1ONNA 2F6RA 2IC5A 2P9CA 2X9QA 3EVDA 4AF8A 2BEWB 2HMVA 4TPKA 5T6MA 4IIHA 3WMFA 1BVUA 4XQGA 5CNIA 4Z7JA 3ESCA 1GPUA 2QUHA 4XW2A 5DLEA 5MGBA 5C8DA 1EA7A 1P4GA 4R2IA 4CF7A 5FWYB 5K0LA 1T4BA 3ZYZA 2C4KA 5HCNA 4Q01A 4KBYA 4BKQA 5KYYB 4P58A 1CQXA 2FE1A 3BHNA 3DMRA 3NOQA 3QFTA 5D3QA 5I7AA 1CVIA 4OO3A 3JRXA 5EXTA 5DK4A 5IN5A 1XNQB 4AX8A 2WG1A 3AVUA 2FOLA 2X7XA 4KE9A 4ZCSA 3H5RA 4X44A 5KO2A 2VBGA 3WYFA 3PEFA 1NBOA 3EF3A 1T3TA 4AL4A 3LNTA 1Z6QA 1WSBA 2AEMA 3FLMA 4WL0A 3VHRA 2ZIFA 3EXAA 3UN1A 1LPOA 2FUEA 3BB1A 1IXSB 5J43A 4X6XA 1PJ8A 1O9GA 3AP2A 3EBOA 4LF5B 1HFKA 2Z5GA 1RYEA 1RABA 2I8LA 2DHEA 1DWPA 3IEMA 4LKOA 5JH7F 4MV7A 4DCUA 2V6IA 4DIFA 2P2ZA 2QVXX 1J8YF 1A9RA 5CT5A 1R8QA 1TVKB 3NHMA 3F97A 3FN4A 1MJGM 2GJSA 4RL6A 3S70A 4YN3A 2HJHA 4OA5A 3MUOA 1N2SA 2ZBGA 3I6ZA 2HKIA 3T35A 1QTQA 4MUAA 3QBJA 4RORA 3T0IA 2OGSA 5B12A 1KETA 4D5EA 2FKAA 3FG9A 4PYOA 1KOFA 2V59A 3HM2A 3PEUA 4D3XA 4DLNA 3LUPA 4KJZA 3ANSA 1QE5A 3R3VA 4G25A 3V4VB 3FW1A 4LXQA 4F3TA 2HCBA 3AIOA 3ZCSA 1E7SA 5GADl 4XPIA 2BM1A 1N7JA 4XWAA 2ST1A 5KOHB 1SD2A 3NJ4A 4FE4A 4UPVA 1TUIA 2QTMA 4IDEA 1U8FO 2UUPA 3WYDA 1OBVA 2A0XA 2JJMA 2EKZA 1NA5A 2XYRA 2ZRPA 4R1NA 5E4TA 4YA6A 1RLTA 3HZRA 1FNCA 4N01A 1H2BA 2PANA 2X5OA 4GRAA 4RY9A 3W5SA 3U4MA 5EC8A 4HEA1 4N48A 3NG1A 1EFRA 2VYQA 4QGAA 1TZJA 4C14A 2H29A 3HKBA 3BWVA 4A26A 3HE3A 1O1YA 1WMSA 2LZ0A 4HBZA 3P0RA 3U7QA 3KG2A 4YP7A 1NNEA 2O0MA 4HNVA 1NJGA 3ZVLA 1GQFA 1P4RA 3MTIA 1OH8A 4KX5A 3GCZA 1NVAA 2WMYA 1V2HE 3TWOA 4WBXC 3PIIA 4I4TB 4B81A 2O06A 1Z4NA 2YL2A 5KWEA 3BERA 2B1QA 3CLTC 3ENVA 3EGCA 3ZTTA 5JNVA 2HYIC 1QGYA 1N9GA 2E5LB 2RHLA 4BATA 1W5EA 3OCCA 3O9MA 4NBKA 5D5PA 2R4QA 3IPLA 1EDOA 3G9ZA 4DANA 1YQXA 2BEJA 2ZW9A 3L7NA 4COOA 3VPAA 5GTDA 2WYHA 3BRWA 3R8XA 1WQ1R 3GV0A 4GKJB 3DBRB 1Z7EA 4C3OB 2PD3A 2XBUA 3L1HA 3JAKB 1E3WB 1JT9A 2A6PA 2AMLA 2AXQA 3IVMA 4GOXA 4BRUA 4KR9A 2ZSHA 2PUBA 3PI7A 2VNSA 1M8JA 1V1JA 3C6XA 4XR4A 5KWIA 1LX6A 3DMYA 3QOFA 4G9GA 4RDCA 2C4UA 2H51A 1SXJB 3DVAB 4WFKA 2RMKA 1ZUIA 2OMEA 3HNPA 4BTVA 1JFRA 2C99A 5G02A 3WB1A 4C06A 3SY8A 2Z95A 1EX6A 1EK1A 4MVJG 1TK2A 1Q3HA 1XRLA 2N46A 4LG1A 1AKTA 1LPPA 1VLZA 1BFKA 1X1DA 5H80A 1EXWA 3DLCA 4I81A 5JNTA 3R9XB 2H5JA 2W0SA 3TD9A 4GQAA 5A3RA 1P9WA 2F1RA 4JI7B 3GGGA 1NFRA 4UHJA 3T0FA 4QXPA 5ALZA 4Y2RA 1W0KA 3G6WA 1U1DA 3GFPA 4Q1AA 1DTEA 1T3HA 1BQ4A 1AT1A 3LWZA 3RB8A 2VH2A 4M8LA 2BY4A 2E89A 1XZAA 3NWOA 2CC2A 3LRPA 4P4NA 4CMJA 3ZBPA 2VAMA 4ZHSA 4CNQA 2IYPA 2XBLA 4FXPA 4V1CI 5J47A 1QANA 3ED1A 4M49A 1YE5A 2OHFA 3GHYA 3SI7A 3U4QA 4JYZA 5I7EA 2P0YA 3U9SA 5L3SA 4TMZA 1AXRA 1PR0A 1Z68A 1JTVA 3AL2A 4ZHQB 3AH8A 3H1GA 1E6CA 3OLXA 1UP7A 4PIVA 2W9XA 4FFDA 1E9RA 3EG9A 4IXTA 3TD6A 1AMNA 2ZJ1A 4WHMA 2X0EA 3FNFA 3OQOA 3RKSA 1WB4A 1NFQA 2BUBA 4HF7A 1QG6A 1ZX1A 3DYVA 3ZE8A 1V3TA 5HZKA 4H1TA 3H5WA 1LK7A 4XX0A 3R7LA 1V96A 5K0GA 3HA3A 4D82A 1CY2A 4I55F 1SC6A 1E60A 2VHYA 5KVSA 1R0CA 4O33A 4D9GA 5JWRA 7GPBA 1N2ZA 3LL4A 5FPKA 2HX1A 1L4LA 3H1EA 2GXQA 4L9SA 1CDOA 4C2UA 3BH6A 4NF2A 2WF6A 3O8CA 3VAZA 1JA9A 2H7VA 4B74A 2VAVA 1DADA 2JAUA 1Q77A 1VG0B 4V3CA 3UV3A 4EGCB 1H2FA 1Y3IA 3QXJA 3BIOA 3CGGA 4KUEA 1O95D 2OO3A 4GKAA 4MR9B 3DL2A 3SCZA 3MOIA 5K8IA 3PUYA 3R2JA 1TJNA 4PAMA 1ZOPA 2X1LA 1M6YA 3RM3A 3SMQA 1XWFA 2R6DA 2X15A 4XD7A 4Z8YA 1AK2A 6GPBA 1EP3B 1I7NA 3W04A 4GOKA 1IY2A 2ZVJA 4I9GA 2G4CA 2XITA 1I9CA 3ZHSA 4IDCA 4HDSB 4G5FA 4DEVA 1D1QA 2CZQA 2AXNA 3MILA 4MS1B 4KOAA 3IVXA 2HV8A 3K1AA 5CNKA 5AI0A 5CX1B 3HH8A 4ZANA 3KSBC 1D2MA 2IITA 2NQTA 4WY8A