1SO8A

Abeta-bound human abad structure [also known as 3-hydroxyacyl-coa dehydrogenase type ii (type ii hadh), endoplasmic reticulum-associated amyloid beta-peptide binding protein (erab)]
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
248
structure length
208
Chain Sequence
RSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTDPAEYAHLVQAIIENPFLNGEVIRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-hydroxyacyl-CoA dehydrogenase type II
publication title ABAD directly links Abeta to mitochondrial toxicity in Alzheimer's disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 67
structure length 208
sequence length 248
ec nomenclature ec 1.1.1.178: 3-hydroxy-2-methylbutyryl-CoA dehydrogenase.
pdb deposition date 2004-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1so8A00
3GZ4A 3W8DA 1YBAA 5AYVA 4P4GA 5DCYA 4PLHA 1XELA 4R3WA 1DPGA 4E33A 4Z0PA 5KJEA 3UAGA 3PQEA 2IEDA 3WB9A 2G17A 3WGHA 1HDZA 2IODA 4QTZA 5ENDA 1JVSA 1ZW1A 3W8FA 2EXXA 2BI7A 3TOZA 1EUZA 1LUAA 3G0OA 4LMPA 3I9NA 3VH4A 4CLXA 4YR9A 3JQFA 5ER6A 3OEWA 3WSWA 4KZPA 2ZTVA 1T2FA 2VUUA 5BQFA 4XQCA 5JC1A 2AG8A 2X6TA 4RVFA 1XLTA 4XZ3A 3R3SA 3C1TA 4MVJF 4HFNA 3GY0A 5C3MA 3JV7A 4BMNA 1HE2A 4PRLA 1B2LA 1FK8A 4CQLA 1XIVA 4BMSA 5L4LA 3KETA 1NTOA 1UP4A 3LC7O 4IQ0A 4AJ2A 4IXWA 1U3WA 1LEHA 1SB9A 2G1UA 8ADHA 4ALMA 3R0IA 4PLPA 3ZDFA 2YFHA 1ARZA 2Y68A 1QLJA 4GX5A 5I9LA 3BZUA 5FWNA 4CMGA 3ETDA 1I10A 4E2XA 3PZRA 3SXPA 3FD8A 4ZVVA 2C59A 3PWZA 1BWSA 2Y99A 3ENKA 4WECA 3TWOA 1MA0A 1ZSNA 5CDGA 2FPPA 4AVYA 3BYZA 3FRJA 3JQ9A 3DWFA 3WICA 2RHCA 1TT5B 1JTVA 5A5EA 3DFZA 1ZEJA 1KS9A 4DTIA 4NBVA 5ILGA 2W90A 3WLFA 3FBTA 3FBGA 2CF6A 3ZU4A 2NADA 3VH3A 3RCBA 3DMTA 2CSUA 2DQ4A 5JAMA 1R0LA 1QYXA 1WWKA 4GAEA 2WJPA 3Q11A 4IJVA 5G4KA 4WUVA 4PLZA 2G0TA 3U0BA 3K2BA 5IFLA 1TLTA 3GVHA 1GU7A 3CINA 3KRTA 3Q2KA 4UEKA 1R4MB 4YAGA 3DBHA 1KETA 3PQFA 1QYWA 3NT5A 3P19A 4J1SA 1C1XA 3GMDA 3PI7A 1EVIA 2EKPA 1N7GA 2IXAA 1MG0A 3IUPA 3UF0A 3PLNA 1VPDA 3E8XA 4FSHA 4CMAA 3TDKA 4ZGWA 1GQYA 2OHXA 5CDTA 3KEOA 2Q3EA 4BO9A 2OL4A 4U5QA 3X2EA 1M2WA 1AGNA 2V6FA 1VSVA 2Q46A 2P9CA 2I3GA 1I3KA 2VYVD 3LT1A 4IDBA 1A5ZA 1CRWG 2E4AA 3S8MA 2GZ1A 2B37A 2I3AA 4EEXA 1Q0LA 2XXBA 1A4IA 4HBGA 3OA2A 1MB4A 3EGOA 1CDOA 3TPCA 1VE9A 3CMMA 2Q99A 1HLDA 4E21A 1U4SA 1MV8A 1UZMA 3BMQA 4RVGA 4DBZA 1MC4A 1SZJG 1WW8A 3GEGA 4YJHB 5KCZA 1GQ2A 1NX6A 4YJGB 4CLEA 1TXGA 3A4VA 4TQGA 1SC6A 4J4BA 4MVJI 2PNFA 2O3SA 3PLRA 4NNJA 2X86A 4BNGA 1T2DA 5TJHA 2P91A 4P38A 2NVUB 3PDJA 3I9JA 3O26A 5DULA 5A4DA 4L73A 4OKNA 4IDCA 1B0AA 4DLAA 1Y1PA 2I9PA 3HZZA 4IDAA 3UGKA 2VZ9A 2WD7A 3D4OA 4IDFA 1M6WA 2DBRA 3ONEA 4IDGA 5JY1A 1DDOA 2JJYA 1LDMA 1MGOA 3CTMA 4LCEA 2C20A 2EP7A 4FFNA 4ZQFA 3RASA 1P1JA 3AM4A 1NPTO 4RGBA 1V0JA 3V1UA 1V8BA 3I83A 3IAHA 5A3JA 4DGSA 1KEUA 4NK4A 4E12A 1H93A 3PGXA 4QT0A 1OMOA 3JQ7B 1LC3A 3NRCA 1ONPA 2GD1O 3EY4A 1WMAA 5KJFA 1CWUA 3Q3CA 1PZEA 3COSA 5DCWA 4KTTE 1Y8RA 2B83A 3JD0A 4P4NA 2PD6A 4AJEA 3KXDA 1NXQA 3MZ0A 4JROA 4D79A 3LSYA 4R4JA 1UXKA 3QWIA 1E1LA 4HV4A 3MJ4A 5F1OA 3H3JA 3IKTA 2OGUA 2IYPA 3QVOA 5U1PA 4BNZA 1LDNA 3RBZA 4DA9A 1OOEA 3LF2A 1N1GA 1EK6A 1I0ZA 5AXBA 4DXHA 1DFHA 5IF3A 2GPTA 1ENZA 1DIAA 4DQXA 2C07A 4D0SA 2PLAA 3KB6A 1HWYA 1DC4A 1HZJA 1XHLA 4PLWA 3RROA 2JD2A 3GVXA 4JGBA 4OAQA 1E7WA 3WBBA 2DFVA 3JQAB 3VTZA 1F8GA 2IZZA 3HDYA 4PG5A 1J49A 2ZYAA 4E6PA 3L0DA 1EE9A 3F5QA 5I9MA 4K6CA 4EBFA 1ZBQA 4B8ZA 5HS6A 1JA9A 4EUFA 4OIMA 4CODB 3D4PA 2O2SA 3TOXA 3MOGA 2O3TA 1H6CA 3RC1A 2X22A 4WCFB 5A9RA 3WFJA 1E3IA 1KVUA 3ZGYA 5I7SA 2A9FA 3ZCXA 1GTMA 4MJLA 2Z95A 1YQDA 1K6XA 1YQGA 3BTOA 1IULA 4OJNA 3X2FA 2RBEA 4GVXA 5JW6A 1ADFA 4IIVA 5DP1A 3WGTA 1PJSA 4BNWA 3FWNA 1DFIA 4FBGA 3GVIA 4IY1A 1D1TA 3LT0A 3AK4A 3PGJA 4FFOA 4HFJA 3V1YA 1C14A 3D5QA 3K2EA 5ICSA 2DTEA 3Q1LA 4Y6SA 2NWQA 3E6AA 3WGQA 5EINA 1VJ1A 3QY9A 3VPSA 3GVPA 1ZK1A 2WTBA 3OETA 1A27A 3IP1A 5DT9A 1KYQA 5A1TA 2AQIA 3ZHBA 1LX6A 2OP1A 5JY6A 1I2BA 4WLVA 1JAXA 2EEZA 2EGGA 4LRSB 4KWIA 3AI2A 2EIHA 5AXDA 1TEHA 2AA3A 2VHYA 2ZB7A 2IRWA 4IJUA 4R9SA 3JQFC 3GDFA 3H2SA 3S2GA 3WFIA 1GCOA 3WTCA 1UUFA 5KVSA 5TNXA 4YBZA 3WGGA 1YXMA 2HK9A 4XGKA 4LISA 1P44A 1YB1A 3BHJA 1UDBA 4GGPA 1NAIA 4J2HA 8LDHA 4NJMB 4WPGA 1A72A 5BSGA 4ZRNA 3EW7A 3T7CA 1RYEA 2J5KA 4ZICA 3IP3A 4RCVA 3KSDO 2P5UA 5HRUA 1AXGA 3A14A 1GR0A 1T2EA 4JJGA 3H9QA 4FIZA 3PIIA 1DJNA 4C7KA 3TSCA 3WNQA 1Z73A 3H65A 1R15A 4OH1A 2NU9A 2VYVA 3BIOA 4UVIA 3PIDA 2VHZA 2OZPA 2Y66A 1YBVA 2J3JA 2J8ZA 5G0TA 5CP8A 4J49A 3JQ9C 1P33A 1V3UA 3ONDA 3KYBA 5DCUA 4AG3A 1HTBA 4E30A 4IINA 1P0FA 5G0VA 4OQYA 1U8FO 3HE3A 1D8AA 1D7OA 1ZK3A 4FCCA 2Y1CA 4JP3A 1YS4A 4L8VA 4YAEA 4QUKA 4B4VA 3GRKA 5HM8A 4WJZA 1NM5A 3VZRA 4BNLA 3DMTC 3HJAA 4TROA 5TSDA 4QFDA 3OQ1A 1UJMA 1AUPA 5T6BA 4UVGA 2X9NA 3OIDA 4PLTA 4BO7A 5CEJA 3BMCA 3FHLA 1ENPA 5KKAA 4W9NA 3K6JA 1WMBA 4MKXA 2HKIA 2XXJA 3AJRA 5JCJD 1RYDA 1Q0QA 3ZNPA 2ZB4A 1QRRA 5L3ZA 5T8KA 5CPFA 3I52A 1MFZA 3NV9A 2XPCA 1QXSA 4MIOA 4Q3NA 2BF7A 4NFHA 1Y9AA 5FF9A 3LK7A 4MPDA 3U4IA 4UREA 4ALIA 4ZQBA 3RUHA 4QEDA 3ZW9A 2DC1A 4DYDA 3AUAA 3JYPA 4YRDA 2HQ1A 2YW9A 3GPIA 4TRJA 1DSSG 2FZEA 4TRMA 1O8CA 5COQA 1NHWA 1SNYA 3JQGA 1E6EA 1KC3A 1QV7A 3I4FA 3MJEA 4H15A 2X9VA 3M1AA 3ICCA 4BO2A 4BNUA 2DBQA 5IN4A 4E5YA 5A04A 4XKJA 4ILKA 3RC7A 4YPOA 2I76A 1PGOA 1QYCA 5GMOA 3RUDA 3A1NA 2IDZA 4Q39A 1ZXLA 1Y7TA 5B4VA 3BAZA 4I8XA 3RC9A 3KYDA 1SOVA 4NR0A 2I6TA 5HS4A 3ANMA 1P77A 1ZNQO 4AJ1A 4GBJA 1Z74A 4O59O 3RFVA 5JPIA 3BTSA 2GN6A 2R2GA 4XGIA 4IUYA 4OHUA 2FRDA 1I2CA 3DMYA 5F21A 3KTDA 2NTVA 3GG9A 3N74A 3WGOA 4CUJA 1BTOA 1U1IA 2YQ4A 1X15A 3ROMA 4KTVE 4CV3A 4YAKA 3PJDA 5F1KA 4CUKA 5AOVA 4ZHSA 4AICA 2OP0A 1XCBA 1PJ4A 1KVRA 1VRWA 1CYDA 5A9SB 3RUCA 4L76A 3FNEA 4C7JA 3VKVA 2PKQP 3ORFA 3V8BA 1D3AA 4KUHA 1H6DA 1PR9A 2VN8A 2FN7A 4BKQA 1HSZA 2VWGA 5I8ZA 3U9LA 3V2HA 3RSHA 4MDHA 4ND4A 3G1UA 2VNAA 3D0OA 3CSDA 3B1KA 2NM0A 2Q2WA 4UUOA 4CM4A 1R37A 5CPBA 1EE2A 1JWBB 2ZATA 1GPDG 4QFCA 1NQAO 3DB2A 5B1YA 2WYWA 3EUWA 1NPDA 2Q1SA 3WWYA 1UP6A 2DTDA 1CJCA 3L6OO 3ANLA 4OM8A 4BNIA 5BNTA 1LLUA 5MGBA 5BSHA 4WLNA 4PRKA 4GKBA 3KUXA 4DREA 4E3ZA 2HK7A 2YHIA 4W7IA 4XYGA 4GSLA 3TF5A 4PZCA 3QVSA 1I24A 4CM9D 4AJOA 4PVCA 4TRNA 4QX6A 1Y8QA 2PTGA 3KSZO 4CM1A 1YDEA 5CG1A 4KP7A 3QVXA 1ONOA 5KNLA 4IIUA 1G6KA 5I7EA 1C3VA 1ZIDA 4XQ9A 1I32A 1X7GA 3OJ0A 4DPKA 1LNQA 2V6GA 2OBNA 1BXGA 2H6EA 9LDBA 3WSVA 4AFNA 1S7CA 3GUYA 4K28A 2PZKA 2VZ8A 1W4ZA 3ZWMA 1E92A 1LLQA 4F6LA 4Z9FA 4E5KA 5LDGA 4ONEA 3AI1A 4AJPA 1NAHA 3D7LA 1WLYA 5JLAA 3GNQA 1R4NA 1R12A 3I9LA 3DBLB 1TA4A 2IXBA 3AUTA 5DBFA 4D44A 4XYLA 3RJ5A 4XB1A 5B4UA 3RAJA 1NWHA 1BSVA 1C0KA 4NFSA 2HMSA 3CZMA 4UUNA 5JSFA 1DLJA 4CL8A 2ZCVA 4Y67A 3HNPA 5L9AA 1O5IA 4R01A 4U0JA 3UH1A 2ZK7A 1HF3A 3KZVA 1F8FA 4RL6A 1RM3A 5F5LA 3S2EA 1C1DA 4A03A 4MO2A 3OECA 5L51A 1FDTA 1GQQA 1N5DA 4CM3A 3IL2A 1LQTA 3AM3A 4YDRA 3NT4A 1HYEA 1E5QA 3OJLA 3KYDB 5BSEA 1QG6A 4YJDA 4BNYA 1A4UA 4XD2A 1HDRA 4M49A 2PZLA 4JBHA 4CLRA 4FJ2A 3WYBA 1H0KA 1ZKMA 2FR8A 3QV1A 4L4SA 3JQBA 1PS9A 3U4HA 1EZ4A 5A5FA 1MC5A 3ZV3A 5JCJA 4QECA 3TZHA 2YY7A 2UV8A 1TI7A 3DZGA 1DFGA 3AFMA 3DZHA 2NNLD 5T67A 3KBOA 3WXBA 1H5QA 3DZBA 5JAQA 4PG7A 2YUTA 1LI4A 1I33A 1KVQA 1WXDA 1G1AA 2BFMA 3SEFA 1JKIA 4ZU3A 3PYXA 1PS8A 4BGIA 4S1VA 4GX0A 1Q2XA 2Q45A 1ULUA 2IYOA 3KYCA 1BVRA 1U7TA 1NVGA 3PDUA 4GVLA 1SBYA 2FOIA 2FP4A 4OOEA 4L0QA 3JD3A 1LSOA 3D1LA 3DZIA 1V3VA 2UYYA 4R16A 4RORA 4RPJA 2DU8A 4CV2A 4LMRA 4CM4B 2ILTA 3G3EA 3UCFA 2EGHA 1ISFA 3DO5A 2C29D 3WYEA 4J1QA 1KOLA 3R3JA 1ML3A 1NQOA 2FY8A 4XDYA 4JLWA 4F45A 3EC7A 3QWFA 5BNIA 2CF5A 3RKUA 2CNBA 1ONNA 3DZKA 4FFMA 3VDQA 4YJFA 5HBRA 1P74A 1UH5A 3ZW8A 5KJ6A 4H7PA 1GUYA 2DAPA 3KVOA 5J23A 4JJFA 4DIBA 1Y5MA 1EUDA 6ADHA 2DLDA 3H5AA 3QLJA 4QXMA 1E3WB 1MLDA 2Y0DA 3O8QA 2PD3A 2AQKA 3NT2A 4CMIB 4J3FA 4W4TA 4W9NC 4R3NA 1O95A 3P7MA 1Y8QB 4W99A 1IE3A 1ZMOA 2I66A 3H5NA 3ZWYA 2NLOA 4IBOA 4CPDA 4ALJA 1FMCA 1Y9EA 5T8KC 4XQGA 3BTVA 4XRGA 2VWHA 3PXXA 1ADCA 2D1YA 1LJ8A 3Q9UA 4JK3A 4MVJG 4BO1A 3EYWA 2I65A 3GDGA 5IG2A 1UXJA 1E3LA 1YJ8A 4NDNE 1NPYA 1OC4A 4MKZA 5IDQA 2BGKA 2NTJA 3F47A 4L75A 1GAEO 3I23A 2Q2QA 2P68A 1ZJZA 1ZVMA 4IM7A 1R4NB 2VNSA 3RIHA 3LLVA 5A05A 3ETEA 2CDCA 1ZMTA 3NJ4A 4S3MA 2HK8A 1XQ6A 3AUUA 4U8GA 2F00A 2UDPA 1P1IA 3AFNA 1NASA 4MOWA 2JCVA 2OO5A 4MVJH 4DPLA 4I5DA 1PJCA 4B7XA 3ICPA 5F5NA 4B7CA 2FPIA 2UUPA 3NAQA 4A26A 3W6UA 2EG9A 2QZ9A 2NVWA 2YDYA 3SLGA 4PN3A 3CMCO 4WLFA 4I5GA 2F1KA 1T26A 2HO5A 5GZ1A 1NBOA 2CVQA 2QIOA 4PLFA 3WJ7A 4B7UA 4CV1A 6LDHA 1BW9B 4CM9A 4TSKA 2V6BA 1U4OA 4YCAA 2NU6A 3FNGA 1DB3A 3JQ8A 1YJQA 4ZN6A 3DBVO 3QWHA 3R1IA 4BMVA 3LYLA 5IN5A 3WGZA 3SBOA 5C7OO 4UVEA 1GADO 5JDCA 5KTKA 2DTXA 4BVAA 4OXKA 3LT4A 4IXTA 4DIOA 1BXZA 3A28A 2JCXA 2EJVA 5C37A 4YXFA 5ENVA 2O3UA 3L07A 3ZU5A 3L6EA 2WD8A 3C7DB 3TNLA 1H6AA 4CMBA 3BMNB 3F6YA 4D7AA 1U28A 2B0JA 3OSUA 3Q6IA 5JFOA 1SMKA 3DTTA 3IC5A 2QRKA 2H9IA 2X5KO 1R0KA 4PG4A 4TKLA 2XAAA 5C7LO 1NR7A 3ZWBA 4NQZA 4GWGA 3JQDA 3OJFA 4JQCA 4OXNA 2CUKA 4BNVA 4YAIA 1C0IA 3STHA 4P8RA 3P2OA 3H9GA 1PU2A 3HB5X 4KUEA 3RFTA 3MCVA 2YDXA 4J91A 4N54A 5I8WA 3K5PA 2GLXA 5B37A 4WE3A 1EDOA 2WMDA 1RKXA 3IJPA 1SEVA 3W4KA 5KVVA 3HQ4O 4XR4A 4CQMD 3ROPA 3C3XA 4UVDA 4M86A 4CR6A 2ZB8A 3FNHA 4M54A 2XOXA 5DNAA 5FEUA 3PK0A 3DAPA 5EL0A 5TT1A 4CV0A 3O9ZA 1DOHA 2XF8A 2E6UX 4BNJA 1I30A 2NQTA 1H2BA 3SLKA 3RUIA 1DC3A 3F4LA 2ZKLA 3VZQA 4E5MA 2CDAA 4BIIA 3L4BA 2C5AA 4Q3EA 1H9AA 1MXHA 1VL6A 3CXRA 4R69A 1GZ3A 2DKNA 1DO8A 3T4XA 4CLDA 2GASA 2YV2A 3G49A 1PZFA 3L6DA 4FFRA 3D5TA 3D3WA 4TVBA 3JD4A 3SX2A 3WG9A 1T2AA 2V7PA 4E31A 4GLOA 3HN2A 1H9BA 3MWEB 4OSOA 5IDWA 5BR7A 1D1SA 1U7HA 1LLCA 2CVZA 3OH8A 5L4SA 4ROSA 2JL1A 1P1FA 4WOKA 4NBTA 4TZTA 1E7RA 4GQAA 1J4AA 4FC7A 3TFQA 2Y0EA 1TB4A 4CQLB 1DRVA 1I5RA 1NNUA 2C7VA 4AL4A 1U2DA 2X58A 1OI7A 4R1TA 3PRJA 2ZTUA 2FWMX 1TVEA 5EERA 1K5HA 1UDAA 3ZH2A 4MINA 3KEQA 4PIVA 1HE3A 2DM6A 3PEFA 1DJQA 3H2ZA 3M2TA 3SC6A 2ZB3A 4ND5A 4J4HA 4KDEA 3GUCA 4CM6A 4DC1A 3K96A 2ZJ0A 1WZEA 1B26A 3H9JA 1LBEA 1LRJA 5L53A 1B14A 1LC0A 1Z45A 1X13A 4AJ4A 4WEQA 3L77A 3NX4A 1X1TA 2Y1DA 3JQBC 3AY7A 2X0RA 1M76A 3JQ8B 1FJHA 3O38A 3EMKA 1B15A 3LT2A 3KHUA 1IPEA 5DP2A 5FFFA 1FDVA 1MP0A 1EUCA 1V6AA 1IZ0A 5G4KB 4ZJUA 3HDQA 5L45A 1YDWA 1BGVA 4QO7A 2YQ5A 3SVTA 3ZV5A 3IS3A 3VAZA 3E82A 2DPGA 3ADPA 3GF4A 1LSUA 3OIFA 3KSUA 3ST7A 1W0CA 4XB2A 2D5CA 4B4UA 3HUDA 2EERA 4RO0A 1EQUA 1YOVA 2VHXA 3IKVA 4MVJE 4GL4A 2ZIZA 3HB4X 4WEOA 3T7EA 3DBHB 5G4LA 3E5RA 5H82A 4D3DA 4J1TA 3EZYA 3RQSA 2BLLA 2AHRA 4D43A 1C1XB 5K0ZA 2HAEA 1UXIA 1WAMA 1E5LA 1PQPA 2IEBA 1K2WA 1IOLA 5I7FA 3BXXA 2CFCA 4UAGA 1UXHA 1UR5A 2BKAA 5L7YA 2VQ3A 2ZYGA 5DZSA 3OP4A 3ONFA 3ZV6A 3OM9A 2NTNA 1GDHA 3GA0A 3ZU3A 4IDEA 3ZHYA 2HJRA 2VHVA 3QRWA 1DRUA 3DOCA 3GGOA 3I9OA 3VPGA 3RUAA 2JHFA 5AXAA 3C1AA 4DIFA 3FWZA 1U2GA 3BMQB 4BKRA 5TIIA 1B8UA 1WZIA 1HT0A 1WDMA 3AY6A 2PD4A 5G0UA 2W2KA 2VUSA 2WE7A 3DDNA 4FGWA 1Y6JA 3HADA 1ULSA 3RUFA 5CDYA 2YZ7A 1XR3A 5LC1A 2P9EA 3ZWCA 4LW8A 1HDXA 4BV9A 1NVTA 3DTYA 3I6QA 4J7UA 3TN7A 4W82A 4XYMA 5B12A 3VOSA 4ND1A 1XKQA 2QW8A 4NI5A 2PH3A 1Q7GA 4LK3A 2B36A 3HHPA 2O3JA 4MIYA 3K30A 5AXCA 3QW2A 2WD7B 4RDIA 1X7DA 4BO5A 1W73A 3C7CB 1DHRA 3QWBA 4N7RA 4LN1A 5ITWA 2WEKA 2HRZA 4JN6B 4JX8A 4RLSA 1E7QA 2HMWA 2UAGA 1ZCJA 3R6DA 5FYDA 1IL0A 5TX7A 4BHTA 1NFQA 1ADBA 3DXFA 3GC6A 1M75A 2D3TA 4J7XA 4BKPA 4Q3BA 2DFDA 3B70A 3VVCA 4E13A 1ZO8A 3A9WA 3Q0EA 5KKCA 3NTRA 5BNFA 5JS6A 2BELA 1GZ4A 3B1FA 3M2PA 2Y1FA 2VRBA 1I01A 1NWCA 1Y8RB 2BMAA 1HE4A 1X14A 3EK2A 5ES3A 4CQMA 3DAFA 3ZN2A 1E0DA 4PG6A 5DF1A 4KDFA 2AEJA 4NFYA 4IJKA 2BI8A 1EMDA 1T4BA 1PJLA 5CEEA 2BH9A 2VT3A 4H3VA 1U3TA 4EW6A 4YVFA 4A5OA 1EVZA 2NV6A 3PFWO 4TRRA 2PH5A 5L7WA 1L7DA 4PCVA 4OMUA 1AHHA 5JDCC 4B3IA 1P1HA 3VZPA 2BD0A 1KEPA 1R66A 4BQPA 4Z3KA 7MDHA 3ADOA 1F17A 2H5LA 5FI3A 4A2CA 5F1PA 4IMPA 5IZ4A 2C2YA 3I4CA 3NTOA 2W2LD 4XA8A 1XA0A 1DXYA 1N92A 5TC4A 1JKJA 5EIOA 1E1NA 4BO6A 4EUEA 3WJAA 1Z7BA 3FPCA 2EHDA 3PYLA 4I9HA 4IZIA 3D64A 3F3SA 3GAFA 4MP3A 4WGGA 5IJZA 1D4FA 1SO8A 2Y1GA 2JFHA 3DBRA 3EVNA 3F9IA 1LDYA 2JD1A 5KOIA 3H8VA 4QSMA 1QSGA 4KWHA 4CR8A 5KJ1A 2B4QA 9LDTA 1HLPA 4BV8A 1PQUA 4DWVA 4GMGA 4NH4A 4RV9A 4K26A 3TZQA 1Z6ZA 2I99A 3BMOA 4B3JA 1YL5A 2O50A 2D5AA 2PA3A 2GSDA 4Y98A 3FN4A 3C8MA 3MJVA 1NHGA 4XDZA 5L7TA 5JDIA 3TZKA 5L95A 5A02A 2DPHA 4D3SA 2J3KA 2QRJA 4HNGA 5FI5A 4NJOA 3RJ9A 3WS7A 3UUWA 1NFFA 3DAGA 1UAYA 3W1VA 3ZV4A 3G1TA 4CM8A 5IZCC 5JAZA 4MKRA 5LDHA 4XCVA 3L4BC 3H3FA 1NVMB 1HRDA 4L4XA 4PLVA 1Z7EA 2Z5LA 3IJRA 1GFSA 1QYDA 4FR5A 1Q7BA 4A7PA 1GYQA 1DIHA 4Z9YA 4ALKA 3UCXA 1U5AA 2IZ1A 4RVUA 2OOSA 1YB4A 5G2OA 3JD2A 2X0JA 4WLOA 3G79A 2NQ8A 1BMDA 4RDHA 3QVTA 1PGJA 2W8ZA 1Y81A 1PWXA 4MVJD 4IZHA 4OYRA 1HEUA 2BFPA 1ORRA 1L1FA 2OXIA 2X23A 3DFUA 5L4NA 1IHYA 3ASVA 4CR7A 3U4DA 4R5MA 1M67A 1O89A 1P45A 4C4OA 5JYDA 3OF2A 3I9KA 1VL8A 4CMHA 1F12A 4M87A 4O1MA 3ZNNA 2UUOA 5B4TA 2VUTA 4UUMA 3GT0A 2AG5A 4GSKA 4CLOA 4E5PA 3U5TA 1LRLA 3JQCA 5JAIA 1N9GA 3P5SA 2NACA 5TJ9A 4L74A 4CUZA 4PFJA 4CMCA 4MIEA 1CEQA 4M8SA 1GCUA 4CM7A 5EPOA 3CUKA 3QHAA 3OICA 3H9EO 5JE8A 3E1KA 2AE2A 4KOAA 3GDOA 4FOSA 1YBMA 2TMDA 3MTJA 4XJSA 1C0PA 4TKMA 1HL3A 1VM6A 1V35A 2AEFA 2BHLA 3RU7A 3FR7A 2D8AA 3TRIA 4PG8A 1GYPA 1PGPA 1KEWA 1WP4A 3WDSA 2QHXA 2C54A 2O3QA 3OFSA 1KVSA 1KY4A 1WDKA 2NSDA 1DC6A 3BMCB 3PJFA 1YB5A 3WGIA 1VC2A 3GFBA 3JTMA 4RVDA 2Q4BA 3I9MA 3PQDA 4WLEA 4BB6A 5C5IA 2GN4A 1AXEA 5A06A 1LTHR 1UDCA 3L9WA 2J5QA 3ZNOA 4YT8A 4EZBA 2E49A 3I3OA 1P1KA 5AQ1A 1CIVA 3GFGA 3OQ6A 4IGFA 3VC7A 2VOJA 3F46A 3KLMX 5A3VA 1BHSA 3QQPA 4GWKA 5T57A 2WDZA 1PGQA 2X0NA 5L40A 3PPIA 4A10A 1E1MA 5TS3A 1LDGA 1P0CA 3IQDB 4P4LA 3UFXA 3W4IA 2GN9A 2J3IA 5JBIA 2VZ0A 2HU2A 3RBXA 4BB5A 4DQUA 4IQGA 5JNLA 3JQGB 1J6UA 4UVHA 1A9ZA 1U3UA 4GMFA 2BGMA 2J3HA 4J16A 4Y8VA 4ITUA 2C7GA 5ICMA 2PZMA 2QQ5A 1T25A 4FQ8A 2Q50A 4YTEA 2VRCA 1OZAA 4E4YA 4BO8A 3TZCA 3JQAD 2X4GA 2DUWA 2SCUA 4CM8B 3CKYA 1MG5A 3E03A 1HDGO 2BFOA 1F06A 1XSEA 2ZQZA 3MJSA 3PHJA 4NIMA 4U7WA 3DC2A 4FD3A 4Z3DA 5DBGA 2POQX 5I9NA 4BNMA 2W4QA 3NYWA 5IAAA 1B8VA 4HWKA 3UKOA 4DLBA 3ZWXA 4BNKA 4AJKA 1LDBA 3ZHXA 1PZGA 1KIFA 3DQPA 4FW8A 3H7AA 1LDEA 1GYRA 1B3RA 4KQWA 2W2LA 2AEMA 1IYZA 4J9VA 3K8ZA 1SPXA 4YA6A 1Q0HA 1I3LA 3N58A 1DIBA 1R6DA 2B35A 2YV3A 4E2ZA 4P22A 1Z82A 4DYVA 2HUNA 4F3YA 3ZU2A 1IUKA 1BDBA 3CZRA 2AQHA 1ZUD1 4GKVA 1U5CA 3GZNA 3GN1A 1DBVO 4TVOA 3ZZNA 4WNIA 2ZTLA 1EDZA 3B6ZA 1RM0A 1PX0A 2QYSA 4O6VA 3M1LA 1ISMA 2A92A 4DRYA 4PZEA 1LSSA 4OXYA 1EQ2A 1HYGA 2X7HA 2EKLA 4OO3A 1YGYA 5ITVA 2GR9A 2UVDA 2GYYA 2NU7A 1OAAA 4JBIA 3JYQA 4J2OA 3OMLA 1HETA 1IZ9A 4QQRA 2C5EA 3V2UA 4XGNA 2WYUA 4A27A 1HZZA 3QP9A 3QA9A 3AU9A 2VOEA 4ID9A 4EITA 3ZWPA 3ZWAA 1R4MA 2VTDA 4YRBA 4BUCA 4XEHA 3GPDG 3PTZA 4N5NA 4ZQGA 5F3RA 4X54A 2YHIB 3TL2A 3LC2O 1BVUA 3UHAA 3C24A 4EYEA 2WE8A 1Y5RA 3FTNA 4O5OA 4FDAA 3DHEA 3AOEA 4YT4A 1DC5A 1R16A 3EVTA 5A03A 2GDZA 3HDJA 2DBZA 2DT5A 4UEOA 3ITDA 4M1QA 1BDMA 3I5MA 4MVJA 1HE5A 4NMHA 3TL3A 4LVUA 1BXGB 1JAYA 3LC1O 4EGFA 3QWAA 3B20A 1NFRA 3K73O 4RPGA 5T5QA 5JYEA 1LQUA 4GLLA 4B3HA 1EVJA 3OIGA 5U9CA 1YVEI 4HADA 2I5PO 1JU9A 3WNVA 2JAPA 1O6ZA 3P2YA 4WOJA 1JQBA 4NK5A 4YJHA 4ND2A 2CD9A 1LSJA 3UVEA 5BSFA 4QO8A 4CL3A 4BL5A 4YJGA 1KY5A 4DC0A 1X7HA 2C2XA 3LLSA 4PLGA 1BRMA 1IPFA 5JDIC 4WKGA 2DVMA 1I3MA 1RJWA 1PJ3A 5KVQA 3VH2A 2NVUA 3OHSX 2EW8A 3NGXA 4L9RA 3ZHZA 3PHGA 3VKUA 1AHIA 3LF1A 3WTBA 1PL7A 1C1DB 1JN0A 4IGEA 1RWBA 3F5SA 3DHNA 4HXYA 1F14A 5IXSA 1C0LA 4FPXA 2FR1A 4FB5A 4LSMA 2NUAA 4BKUA 3MJCA 5GZ3A 2ZYDA 3GN2A 4Q9NA 5A9TA 1G0OA 1EK5A 3DHYA 1LU9A 4GI2A 2QZZA 4RLHA 1ISHA 4CLRB 4CMEA 4B4OA 3RU9A 4F46A 2ZCUA 2HMVA 3JYOA 1OFGA 2FZWA 4R1UA 1EBFA 4YACA 2GO1A 1FF9A 2Y93A 3E5MA 4JP2A 2O4UX 4IDDA 1IHXA 4O63O 1FDSA 1VKNA 4XIYA 3UCEA 4HFRA 2V6MA 5GZ6A 3JQ7A 3S1LA 4NPCA 5CFZA 4RVHA 4CM5A 5EN4A 2O7SA 5AVOA 4CMJA 3GZNB 3AW9A 4FC6A 3KV3O 3FPLA 4K1LA 1YKFA 2B4RO 1GEGA 1YE3A 2VCYA 4B8WA 3H9UA 4UEJA 5DOZA 4XX0A 2E37A 4RPKA 3NJ8A 3RD5A 1M66A 5H81A 4Z0HO 3C7AA 3KYCB 3C85A 3MTGA 3RWBA 1EFLA 3VZSA 2GN8A 3VHRA 2C82A 1T1SA 1XU7A 3L4SO 1YL7A 1HDCA 3W6ZA 2GF2A 3NGLA 4D3FA 4E32A 1NQ5A 3PHHA 4I5FA 2AQ8A 3ABIA 3AUSA 4YQZA 4Z6KA 4ALLA 4R5HA 4N5LA 1OC2A 5JC8A 4XQEA 5LCXA 1H94A 4YJFB 3JQAA 1O9BA 2WM3A 5KVCA 1EFKA 5TT0A 3T4EA 3O8QB 2HDHA 4KQXA 1X1EA 3LDHA 2QYTA 1Q1NA 4JJIA 1BG6A 3NKLA 2CVOA 1PTJA 7ADHA 4ZQHA 4WCFA 3ZNQA 5GY7A 4GX2A 3GMSA 2E48A 2GCGA 2EV9A 3DEYX 4DBVO 5IZCA 1AE1A 1PL8A 5K9ZA 4R1NA 4AJJA 2HJSA 1I8TA 2Q1UA 3BHMA 2HMTA 3F1KA 1A7KA 4YYZA 2PK3A 1SB8A 4U6QA 2BFAA 3INTA 1GD1O 3OQBA 3FCOA 3BTUA 4J4TA 5CG2A 3ROKA 4NBUA 1RM4A 4D41A 2O7QA 3Q2IA 2WWRA 3NEPX 4AJNA 3FR8A 4BO0A 5COAA 2I67A 4NHEA 3JQ6A 2Z1NA 2Z1MA 2OFPA 4IPTA 5THQA 4INAA 3WR5A 1KEVA 2GRAA 5JCXA 2Y05A 2FHSA 4G81A 5G0WA 4DMMA 1GUFA 4XR9A 1JVBA 1UZLA 4DPMA 5HTOA 1PQWA 2Y1EA 2R6JA 2RAFA 4ZRMA 3TFOA 1E3SA 1J0XO 2P9GA 2RCYA 3PP8A 2J6IA 1FDWA 3L9XA 4N5MA 4RZHA 1DAOA 2FPGA 4NBRA 4PLCA 4URFA 4CLHA 5JXWA 2X5OA 1U9JA 3HFGA 5EMHA 1YL6A 2GNAA 2Y67A 4II2A 2P4HX 3IMFA 2EF1A 4HUJA 1KERA 4IJWA 2LDBA 3AU8A 3FSRA 4NJMA 1ZJYA 4O0LA 4PGFA 3CE6A 4A0SA 1VSUA 4UUPA 1VJ0A 1ZSVA 4HX5A 3ZI0A 1Q7CA 2HCTA 1JLLA 2D59A 4EEZA 3HSKA 1PWZA 3AI3A 3G17A 3GOHA 2PZJA 1JWAB 2CDBA 3QVWA 4TMFA 1OBFO 1UXGA 3EHEA 3GHHA 2PGDA 4TWRA 1NYTA 1P3DA 3LQFA 3CH6A 1RPNA 1HXHA 3LVFO 3HDHA 1YO6A 3UICA 4HY3A 1FXSA 4D45A 4RF2A 1O0SA 2G76A 2OUIA 2JFGA 4R1SA 2X8LA 3CEAA 3GLQA 4BNTA 4E5NA 3K31A 3K9QO 5DN9A 2YV1A 4HNHA 4W7HA 1A7AA 2GERA 3GK3A 3WQRA 3RVDA 1XDWA 2Y1OA 4OOFA 4PLYA 3QE3A 4Q3CA 1HSOA 2J5RA 4KUGA 4OKIA 4E2YA 1B16A 4J0EA 4BGUA 1B7GO 2H1SA 4YT5A 2AE1A 1X0VA 4RVSA 4ZD6A 1XEAA 3GAZA 1PIWA 4PZDA 4PVDA 4E2WA 3GHYA 1QV6A 4YAJA 2G5CA 3UN1A 3VPXA 1I36A 1SOWA 4FFLA 4J90A 1K3TA 1WDLA 5ER9A 3RC2A 2O3RA 4R54A 1LRKA 2OORA 4BS9A 2X1HA 3QSGA 2ZTMA 3DL2A 2H63A 4EI2A 1K6JA 4JCOA 4YT2A 4MVJP 2RH4A 4MP8A 2PGJA 2VWQA 3NTQA 3WIDA 3AOEC 3PHLA 5JO0A 2HLPA 3SJ7A 3ON5A 1T2CA 3PJEA 3PJGA 5K6AA 3NDIA 1YH3A 1H2HA 3S55A 1VKOA 3ROQA 4R51A 3JYLA 1L7EA 3D3WB 1SAYA 4I9NA 1E7SA 1K6IA 3AOGA 1N8KA 4G2NA 1CQJA 2B4TO 2RIRA 1E1KA 5TF4A 4BKOA 2A94A 5TQVA 3D3EA 3AWDA 4ND3A 1I3NA 3FF4A 1W6UA 2JKVA 1W8DA 2YFQA 1S6YA 2Q1WA 3PYMA 2RH8A 1PSDA 3JD1A 1ZZEA 5U4QA 3GG2A 2X9GA 2CMDA 2EJWA 4D0RA 1N1EA 4WCDA 1VLLA 3HFSA 3O03A 3S2IA 5ILOA 3DZFA 3B1JA 2P4QA 4Q3AA 4OSPA 4FGSA 2BGLA 2D2IA 5IXYA 2O2YA 1CF2O 2GZ3A 1T1RA 4EJMA 5THKA 3MJTA 2AXQA 3GR6A 2QRLA 1VL0A 4NZ9A 1XWFA 4JXKA 5I7VA 5KJCA 3W8EA 4II3A 3VVBA 4FJ0A 2VRCD 2EWMA 3PVZA 1UZNA 4CMEC 4ALNA 4CMKA 4E0BA 3LU1A 3WMXA 3JSAA 4BNFA 5A9SA 4XRRA 4RF4A 4YEDA 1F0YA 3I6IA 4HKTA 3JQEA 1QORA 1XYGA 1SCUA 1ZK0A 2FR0A 1AN9A 3PZBA 2B5VA 3FNFA 3OJEA 4XYEA 4BO4A 1V3TA 3GNSA 1Z75A 3GEMA 3U09A 2R00A 3TJRA 5TRTA 1YQXA 2D4AA 2NU8A 3WQQA 1UAGA 1VI2A 1LXCA 1X0XA 2EKQA 5EQFA 4K9DA 5MDHA 1KC1A 3U4CA 2VYND 1RM5A 4J43A 4MVJM 1PJQA 2VHWA 1YOVB 1PR3A 3ZWNA 1EBUA 3E18A 4XYBA 5EESA 3E9QA 1E3EA 1E77A 4DLLA 3F1LA 2PGLA 5G0SA 4BGEA 4YQYA 2VTEA 2TMGA 1IY8A 3ZWWA 4NBWA 2GZ2A 3HWRA 2VT2A 3VPHA 1GZ6A 5DDIP 4OL9A 1ENYA 5C7IO 4IQ8A 4BO3A 2JFFA 3GEDA 3WGYA 3ASUA 3E48A 1CERA 4D42A 1NR1A 2YJZA 4GX1A 1DAPA 2Q1TA 1GV1A 1M6HA 5BT9A 5CAEA 2HSDA 1ZK2A 5JO9A 4ZQEA 4EUHA 1E6UA 4K6FA 3F4BA 2W2KB 4OQZA 2A35A 3INRA 3N7UA 2GGSA 4G5HA 4WCFC 5IDYA 3KM0A 1P9LA 4B79A 3M6IA 3ETGA 1DRWA 3DOJA 3KLPX 1U8XX 3RI3A 3BHIA 3FTPA 4AJHA 3SJUA 4FJ1A 2O23A 4RQTA 3WLEA 2CZCA 3UXYA 4UULA 3DBLA 3GH3A 5CDUA 5EJ2A 5DOVA 1PGNA 5TGDA 1B8PA 4KMSA 1R0SA 2PWZA 3V1TC 2HRBA 4Q3DA 4FN4A 4WNCA 4GGOA 4U0KA 3WBFA 1DIGA 1WNTA 2WYVA 4Y6PA 3OEYA 2ZQYA 1HDOA 4A73A 3GGGA 5JMPA 1MFPA 4DMLA 3OBBA 2FMUA 3KO8A 2PR2A 3RFXA 3WOHA 4J9UE 4RZIA 4Y9DA 3IIEA 3NDRA 3TQHA 4YB8A 1EEHA 3IUSA 4NU5A 1GEEA 3WMWA 4DVJA 3S2FA 4DL9A 1H6BA 1N2SA 1CQIA 1FDUA 2JAHA 1VJTA 2OMEA 2PFGA 1KVTA 4XWYA 1JDJA 3CPSA 4IS2A 4L4RA 2DBVO 3WYCA 1E7YA 3HN7A 4R68A 1ISGA 3ENNA 3GQVA 4CQMB 5CEFA 1A9YA 3MWDB 1K0UA 1JKFA 2C0CA 4WASA 1XGKA 2Q2VA 2RHRA 2JCYA 3D4NA 3UW3A 3Q9NA 3WWZA 1QKIA 3QIVA 1J5PA 3EAGA 4LGVA 3E9NA 3PWSA 3WIEA 4EDFA 1LLDA 1GPJA 3OA0A 4F6CA 2DUUA 1BXKA 4LSWA 4LCJA 1PL6A 1HYHA 4R41A 4BNNA 1XU9A 1QR6A 1MXFA 1PZHA 3VDRA 4BNXA 2PY6A 2P2SA 4LVCA 5COBA 1MUUA 4R9RA 3GNTA 3ULKA 1V9LA 3INGA 3CIFA 4LRTB 4Z0TA 1QYVA 5HWSA 4M89A 1GY8A 5CDSA 3U3XA 1E3JA 4I5EA 2A4KA 1NQTA 3DBRB 1E3WA 2Q49A 3RBVA 4RF5A 4AJLA 3MOIA 4J6FA 4IS3A 3I1JA 4WK6A 4CMIA 3NUGA 1QP8A 1ID1A 2IZ0A 3BMOB 3H4VA 3HG7A 4G65A 4M55A 2FSVA 5CHEA 2AW5A 3ANNA 1A71A 1K89A 4J7CA 2O4CA 1ENOA 1ZEMA 3ITKA 1ZFNA 2X5JO 1TT7A 4H16A 2NVBA 4I08A 3OJOA 1G0NA 4FOOA 2QG4A 5H83A 1PJ2A 3AM5A 4FFPA 3RUEA 4AJIA 1KBZA 3VTFA 4BOYA 1PJTA 4I9UA 4J1NA 1ISIA 4RPHA 1NP3A 2IE0A 4TZKA 3E9MA 3PFFA 4YWJA 1QLHA 4BQRA 1DLIA 5K6AC 2JD0A 3BA1A 3ZWOA 3A06A 1PJBA 3ZWVA 4XIJA 5DBIA 4ZA2A 2WSBA 1U3VA 2CY0A 4W6ZA 2HMUA 4BNHA 5JMWA 3K92A 5EQDA 2G82A 5KIAA 4N18A 4D46A 2VWPA 5IDXA 3IDSA 2VYNA 2JHGA 2Y0CA 4RJTA 1YONA 3PWKA 4J0FA 2EW2A 2PV7A 3O4RA 3FI9A 3TZ6A 1YWGO 1GL3A 2X0IA 4RQUA 3GGPA 1IB6A 2B69A 4Z9XA 4HFMA 1PEDA 1O94A 1PS0A 3NDJA 3U49A 3DZJA 3C1OA 2B5WA 2BRUA 3DR3A 1P1RA 4YRAA 1TT5A 4B4WA 1BW9A 3H5RA 3KOUA 4IMRA 1UP7A 3QJ5A 4NU6A 2EP5A 1ISJA 4CLOB 3H6KA 3IOYA 3VPFA 1N9GB 2GUGA 5HA5A 1WPQA 4OGWA 2E82A 1HKUA 1SEPA 4DUPA 4MP6A 1I2ZA 2ET6A 3EZLA 1DEHA 1B3BA 2QX7A 1JW9B 1HDYA 2P5YA 5TLSA 1ZXBA 1T4DA 4GPD1 4NG5A 4WLUA 1GV0A 1P31A 3V5NA 1QMGA 4JIGA 5T64A 1ADGA 1DIRA 3AY3A 4FS3A 4CJXA 2YYYA 4U6SA 5KWEA 3SC4A 3BMNA 4Y6RA 1E7MA 3EDMA 3GRPA 4GH5A 2YHUA 2PKRA 1GUZA 1CETA 5ADHA 4ESOA 2D0IA 2ZJ1A 2R00C 3W4JA 4I1IA 3MEQA 1N7HA 3LZ6A 4JNKA 1MX3A 2OBYA 3DOOA 3U62A 3V2GA 4EJ0A 1EVYA 2Q4EA 1ZH8A 3DONA 3WQSB 1ZSYA 4BGVA 1E6WA 1XG5A 2AMFA 2W98A 4RPLA 1YRLA 1T24A 4XJTA 4RF3A 1ZK4A 3VH1A 1DHTA 1XQ1A 2LDXA 2O48X 2FSSA 2V65A 3PHIA 1LA2A 3JYNA 3GVCA 4HP8A 2PKQO 3RKRA 3WX0A 3JCZA 4JBGA 4DQVA 1WVGA 4EJ6A 3UOGA
chains in the Genus database with same CATH superfamily
1W34A 1YBAA 3W8DA 5LZ8A 5AYVA 1GARA 5HFAA 2Y3IA 2JGNA 1G291 1ZRSA 3BXGA 3COZA 3L7LA 2OBXA 3K1ZA 1VPEA 1S2GA 4PLHA 4TYPA 4KACA 4EKNB 1XELA 1KI6B 1T9KA 2IT1A 3BE8A 1W2GA 2O14A 1QFXA 3GMIA 3HY3A 3NH6A 4HLQB 4W1PA 5D1NA 4MWSA 3TLCA 4Z0PA 4JLDA 4F71A 3SWWA 1EEXB 3NHMA 4EGAA 3SQWA 5B2ZA 3PQEA 4DY4A 2A58A 1RAAA 3FVRA 1KMIY 1HDZA 2IODA 2GKOA 3L8MA 3WGHA 2O2XA 1BYUA 1JVSA 2BKEA 2JA1A 2IHBA 1U3GA 1GTVA 2PBLA 2NZJA 2QP9X 1Y4SA 3SHOA 4MUYA 1JR3A 2CLSA 2D5LA 1LV8A 3RYTC 1DEAA 3WSWA 4CU2A 3GPLA 3LUJA 1N33B 4FHFA 2VUUA 2BEWB 4H7JA 4RVOA 1NQVA 4XQCA 1SD2A 4AURA 4L3VA 2PUCA 1HFJA 5B3AA 3BRWD 4IH4A 4XZ3A 4LZJA 1R5OA 2Y0PA 3GY0A 1XT6A 4DSOA 3HCEA 3JV7A 5C3MA 3PKIA 2HWUA 4PYIA 4UHDA 4Q9KA 4ZOLB 3GUHA 2ANCA 3IALA 2BZGA 1DAGA 1AV7A 1EJ6A 1NVUQ 2P4EA 3F9CA 3NWBA 1FTQA 2ADFA 2ISCA 3M83A 3PCXA 3BL6A 2HJGA 4KO4S 3R0IA 2P5SA 4J0QA 1CVLA 1F9EA 2JCGA 1J7JA 2YFHA 2Y68A 4HGZA 4QDUA 5AKZA 2LTAA 1QLJA 1EWYA 1P62B 1QANA 5WRFA 4BLRA 3OU2A 2R47A 3WSTA 3BN3A 3DR5A 5FJIA 4E2XA 1EB9A 1CX9B 1P0IA 3E2MA 3FD8A 4N4AA 4LDPA 2JK0A 4Q1AA 5FWYB 1UJ2A 2BGRA 2JFUA 1BWSA 1COWD 1XZLA 3ROTA 4KFSA 2PS9A 3ENKA 3V1LA 5JSZA 5DVZA 2BHNA 4RC9A 5AICA 1US8B 5HIJA 5CDGA 5KDDA 4AVYA 1DUVG 3JQ9A 4ZALA 3WICA 2Q5CA 2Z9DA 5HNKA 2Q0XA 5CNJA 3DFZA 4KXNA 3F5FA 3BRCA 3BFKA 3RRFA 3HY4A 1T2NA 3HRHA 1U63A 3L6UA 3H8SA 3ZU4A 4FBMA 3ONVA 3YASA 1J0BA 4NBKA 2WB2A 4V3CA 3VH3A 3RCBA 1KI8A 4LQ4A 1PHRA 2CSUA 3QBTA 4MICA 3QKSA 1QYXA 4GAEA 4IJVA 3Q11A 4BCCA 3D8RA 1RABA 1VIMA 5DHQA 3GIWA 2IY9A 4NCHA 3U0BA 4BAUA 3K2BA 2BUCA 4PZLA 2PKCA 4MS3B 3SYRA 4QU9A 4B6JA 1BA3A 1GU7A 1QX4A 2ZJ3A 3FCSB 4AZ3B 2EJBA 2AD1A 3Q2KA 4B0OA 2RCNA 4L8FA 2DOKA 1DRJA 1OTXA 3IAUA 1E1CA 1P2UA 1WCYA 4IJMA 1XFAA 4JJ7A 1NVVR 2DSNA 3WA6A 4RKRA 1YUBA 3DLHA 1Y8ZA 3FHJA 3PQFA 4OMDA 1QYWA 2SECE 3SYNA 4EA7A 1EK0A 2ZUWA 5THXA 3IAXA 3ML1A 4GECA 3BM5A 1XEWX 2GARA 1Z36A 1A9OA 3E8XA 3EQ7A 3GP5A 4WXYB 4QIHA 1GQYA 1ND6A 2ID7A 4WZZA 4RXUA 5D5PA 2OK7A 1JQ3A 1V25A 3QVJA 3BDAA 3X2EA 3IO3A 1GPWB 1TJYA 3INYA 4G0QA 2HLDA 2Q46A 2ZU0C 4Z99A 3TLYA 3EVFA 4H1HA 1IMOA 3ELDA 3D6VA 1J0EA 2EFDB 1UWCA 2IXEA 1KSFX 2ZANA 3O2NA 3G0IA 1VKRA 2B37A 4IG9A 4K9QA 4OI0A 1Q0LA 5GVRA 3OA2A 1MB4A 1Y9ZA 3A3PA 5LNK1 1VE9A 3WAJA 3C8ZA 5D7NA 2I1QA 1JJAA 2Q99A 4WMLA 1IZ8A 1M10A 3BIWA 5AH0A 3ZYCA 4E21A 5JQGF 2BF4A 3U7JA 1JEQA 2P30A 3GEPA 3HCNA 4DBZA 1IHUA 1ZI6A 2C92A 2JK1A 4DIMA 1F0NA 1MC4A 1M34A 2BEUB 1QQAA 4GXRA 1BEEA 1O5TA 1ZCFA 1MAHA 1Y6RA 2WKPA 5SV2A 5TQ0B 4WTOA 1U8ZA 1UEJA 3KKKA 1P3Y1 2OEPA 3ENQA 5D5HA 1TK9A 4CLEA 1DAHA 4Q1DA 1SC6A 3RVMA 3PFCA 5HKKA 2DR3A 2PMFA 4RHYA 5F23A 1JXOA 4NNJA 2BMEA 2H57A 1T2DA 3MD0A 3N2NA 2HTFA 5TJHA 2ETVA 5HRAA 2YC4C 4ITRC 2LV8A 5GPBA 3H6HA 3I0MA 3OF5A 4JFAA 4OKNA 4ZKEA 1X39A 2I9PA 3AIKA 1MB0A 1T9AA 2ORYA 3L1HA 4FDTA 8OHMA 1O96A 2QR5A 3PR3A 4GP7A 4MUEA 3S1AB 1G8SA 2A5LA 2VPXA 1ZI8A 3LUBA 4PO8A 5FXMA 1OD6A 2EX1A 1DDOA 3FPKA 3KV1A 1AKMA 4ZTZB 3IAEA 1K97A 2WTEA 5KEIA 4L2IB 4BEBA 5ELLA 1E0KA 2FSFA 2J46A 3IMEA 4BJHB 4QEZA 1VE3A 1YV9A 4LHEA 3AM4A 1T8UA 1NPTO 1KPIA 1YAJA 4RGBA 3V1UA 1ULBA 2V3CC 4BX8A 1ODTC 4LXQA 3QU2A 2XE7A 4DNPA 3AB3A 1WXWA 1KEUA 1W9MA 4NK4A 4TT3D 4CKXA 4BFZA 2QS9A 1YASA 3JVEA 1GKKA 5ICFA 2VH5R 3JQ7B 3PXGA 3UTCA 1LC3A 2XUOA 1ONPA 4PYMA 4C4RA 3ZBTA 3A6GA 1MC1A 5HHTA 5DIZA 2WWVD 4BQEA 5BURA 3AESA 1IRXA 1JIIA 2IL1A 3AJ8A 4QULA 5DCWA 7YASA 4K5QA 4YS6A 4YRGA 4AJEA 3GROA 4QOJA 2IF2A 3KXDA 3PXUA 1NXQA 4LNUB 4EI9A 2F7SA 4ZAWA 4D79A 1FNCA 3ZE8A 3LSYA 3TAUA 4MRRA 2HHCA 3RAFC 1QTNA 2HCBA 3DC7A 3TW8B 2WWGA 3MJ4A 3T0IA 5J59A 1AHNA 4CG2A 3H3JA 1DRKA 2OGUA 5ARCA 2ZDHA 1RPZA 2IYPA 2ORIA 3LUPA 5DI3B 3QVOA 5E4TA 5U1PA 3UMRA 1QVWA 1Y7IA 2YWGA 4DA9A 4WXHA 3HU3A 5GIOE 4QPDA 1DFHA 3CKMA 4D0SA 1ENZA 1DIAA 3ODPA 1PD0A 2JJ1A 4ASUA 1XHLA 3GV0A 3PA6A 3PGKA 4R8MA 4JGBA 1E7WA 3RYFB 2QTFA 4WXPA 1U0TA 4PG5A 2ZYAA 4CDMA 2GRJA 2NUPA 5B1DA 3F5QA 1XZFA 1ZBQA 5GJBA 4ZYUA 1C4OA 4DADA 3QLUA 1YA6A 2RKOA 4EUFA 4KDRA 5DEOA 3KTOA 5AVTA 1ZH4A 1FNSA 1XLWA 2VBFA 3EMDA 4FXOA 2WW8A 4CODB 4DQ0A 1RADA 3G2LA 4MXDA 1CQWA 4RKQA 3MOGA 4U3JB 2O3TA 4DDTA 2GNPA 4B83A 1WDWB 1XQ9A 3KOMA 1RQPA 3I01A 1KVUA 2Z1DA 3FB1A 3DAOA 3A4IA 3E53A 2GZAA 3NPAA 1MOZA 2IOYA 2W43A 4MJLA 2A1TS 2I3BA 3K6SA 4HQNA 1YQDA 3G0BA 1WRBA 4LOKA 3T1YB 4B32A 5IKPA 1YQGA 3BTOA 4OJNA 2WF8A 4KR2A 1RBZA 4GVXA 1XDSA 2W6JD 3FI0A 1JYEA 4HUTA 1O03A 3A3YA 3O83A 5AKXA 2XB6A 4BNWA 5JR3A 2OZLA 3GFVA 1AG9A 1YCGA 2C04A 1O8BA 4BRSA 1SHJA 4DCNA 4FFOA 5JXGA 4B48A 4JP8A 1U3CA 3HDGA 4ENPA 3K2EA 5D3KA 1IJFA 3DYBA 2YYSA 1U7UA 3E6AA 3LWDA 5EINA 5D3MB 4ZAFA 3PQ6A 3UXEA 5BV1A 2VF7A 3VR5D 1I4EB 4M8IA 2O1EA 3K70D 3LY8A 1PK7A 4U2BA 4V3BA 1JR4A 1VBMA 2K7ZA 4WLVA 5JVDB 2J45A 2P6OA 3PD1A 2D0DA 3ZZUA 4AXXA 5IFKA 3AI2A 2EIHA 1V48A 5JSYA 3P26A 1YSCA 1TEHA 3TD2A 5C81A 2J4FA 1DL5A 1E60A 3A37A 1G60A 4NFLA 3N0VA 2IRWA 1S3FA 1W5SA 2PX8A 1RKBA 1QOZA 3JQFC 2FLVA 3GDFA 3JALB 1BVHA 2RGEA 1K4YA 1EGMB 1Q1BA 1YZHA 2OD2A 4MW2A 4U9IS 5E9WA 3WFIA 3P9KA 4YBZA 3AJDA 3WGGA 1YXMA 1F2TA 3RRXA 4WBNB 2X9LA 4A5SA 1WW3A 4CCAA 2GILA 1K7YA 4Z9BA 1FB5A 4DTCA 1KMMA 1T29A 1ZL2A 2WHPB 4C2UA 1A72A 1KYXA 4MS1A 1XI2A 1SFRA 3CRMA 4PANA 4A23A 4RCVA 3H8WA 2QTTA 3KSDO 4BRUA 5HRUA 4X7BA 1OX4A 1IN7A 1P2BA 3A14A 4C78A 1OXTA 1E61A 4QDTA 1Z5NA 5I4KA 2BEJA 3PIIA 3WIUA 4MULA 3K4QA 2W2MA 1L2TA 3A6HA 5GJWC 1R15A 3DVSX 3RAPR 2QUZA 3G7NA 5EJ7A 2ZXEA 3BFXA 3BIOA 2VBIA 1I3CA 4UVIA 3IYLW 1DJMA 1YZUA 5BYJA 5E9JA 1WPRA 2BISA 4KPYA 5ALTA 2J3JA 5E8JA 1WF6A 4G0NA 2J8ZA 2OHJA 4A0GA 3P2EA 4FWTA 1CJKC 3WGJA 1SXPA 3CRRA 2PUJA 1S9HA 4HG2A 1J25A 5DM1A 4WV3A 3MC1A 1P33A 3OOHA 4UAVA 3GWGA 1N5KA 1K27A 5FUMA 3KYBA 3HZHA 4AG3A 3M9WA 1P0FA 3PNVA 4G89A 5TQ2B 4OQYA 4U7PB 1U8FO 2FW9A 1EGVB 4WESA 4TYYA 3AUKA 4H6VA 4FKZA 3RTCA 4JP3A 1YS4A 2H48A 4L8VA 4UBKA 5CR9A 4B4VA 5HM8A 3N8KA 4M99A 1CZNA 5JU6A 1SKYB 1XMQB 1UJMA 1YK1A 5T6BA 4UM7A 2X9NA 3V7WA 4D4MA 5FBRB 1G38A 1IDN1 4NH0A 2QSZA 2Y9PB 1YGPA 1ENPA 2COKA 4DWJA 1KNQA 1RI1A 1UMKA 3K6JA 3QFTA 1WMBA 3VU1A 5BN4A 2DCUA 4MKXA 1KTVA 3AJRA 2XXJA 4AM8A 2EC5A 1RIFA 1Q0QA 1JECA 4REQA 5CCDA 4URXR 1QRRA 5T8KA 2JG3A 4UXJA 2XYPA 3PI6A 5FI0B 4BQOA 3FGOA 4LRQA 5F4ZA 2IUTA 1G8GA 2CUZA 3L6BA 1YVPA 3K6SB 2RAPA 2WFLA 2BF7A 4JT9A 4NFHA 1H2WA 1TTPB 4KN8A 3PGMA 3T15A 2WFMA 3OZDA 2VDPB 4MV1A 5FL7A 2GH1A 1BDHA 3ZVLA 2MCFA 3ILSA 1H3FA 5DBOA 4NVRA 3SX0A 3HYLA 2ZE7A 1Z56C 3JZAA 2JI7A 2HQ1A 3ANTA 4F4UA 3PD0A 4N76A 2E9SA 1ZHOA 4EVQA 3I9FA 1X8JA 5COQA 1FDOA 3U2QA 1TCBA 5CLFA 3JQGA 3GJ5A 4G5YA 1QDUA 4PQEA 4BFVA 2C78A 1KC3A 1PYDA 1OFHA 2H7VA 3I4FA 4PHCA 4EPWA 4DR7B 1UBKS 2ZPUA 3HI6A 3LO8A 3I6ZA 3ELWA 4EX7A 3MK31 2IS2A 4BO2A 1C9DB 4BNUA 2DBQA 5F77A 5DHUA 1XCOA 3DEFA 3IMKA 4O4IF 5LNK6 3ER9A 4WA8A 5A71A 3SSAA 4BY9E 2GPWA 4JNCA 1GGJA 2MYPA 4YP6A 3RUDA 2GBGA 2HDWA 3IKLA 3PVSA 4P7GA 3R3YA 5G53C 4HVCA 4QM7A 4X45A 3V80A 3BAZA 4I8XA 4M1KA 1USUA 1RD4A 3AIIA 3C3MA 1K7SN 3N1UA 4ZIRA 1JHAA 3O73A 1CEXA 2I6TA 4I0WB 2WHYA 1BMTA 4MVCA 4NR0A 4RHUA 3G0HA 1Z74A 4O59O 3UJHA 3RFVA 5AUOB 2XYGA 1JNXX 5JPIA 4M9SA 5EMNA 2YRWA 4PHHA 5G1PA 1DBRA 2GN6A 2R2GA 1UDXA 4OHUA 3OCXA 1C50A 4I66A 4Q0MA 1QBKC 2HXGA 1I2CA 3DMYA 4P3KA 5FPKA 5EZQA 4EH1A 3UG7A 2NO9A 3U4QB 3Q8MA 2Q5FA 4QQNA 1W94A 2GTIA 3OKFA 3N74A 4MQ6A 2XTMA 2HFJA 521PA 4GRDA 8GPBA 1ESDA 1W30A 1UWLA 1PV1A 4CV3A 4YAKA 1DEOA 1AZLA 5F1KA 1GZSA 5AOVA 1XTUA 5LLSA 4AICA 2OP0A 2VCHA 2NTEA 5F2NA 2YOGA 4L5IA 1XVLA 1CYDA 3G5AA 4M83A 4FYXA 4Y2HA 4P36A 2GF9A 4C7JA 4WN9A 1LY1A 2PEZA 1IEXA 1N6RA 1U90A 1Z8NA 2OCLA 5GONA 3TVDA 1LS1A 3MQFA 1CUIA 1D3AA 3V8QA 1EWQA 3RF7A 1CV2A 2H2FA 1Q17A 4MRPA 5AKHA 1H85A 4PSVA 1SVMA 3U9LA 2PLFA 1YR7A 3WXMA 4POOA 5HW0A 5CLGA 2BBSA 4MDHA 5GM1A 1PEAA 1UZUA 3OPMA 2LUOA 2IYYA 1NF9A 2JI6A 2W2QA 3CSDA 4OA8A 3THRA 4EIWA 5FAKA 1EFCA 5CPBA 1EE2A 1JWBB 3HVRA 2GEVA 4O4JF 1GPDG 4UBJA 1WDTA 3M6XA 4NMWA 4KPUA 3DB2A 3JWGA 5FA8A 5K3FB 5B1YA 2Q1SA 5H80A 1IG0A 3R3ZA 2QMHA 3WWYA 3RYCB 5EZ6B 5IS2A 5FBLB 1MGPA 2DTDA 1T6XA 1JUDA 2FW6A 3C87A 3FB4A 3L6OO 1C3OB 3MTDA 4OM8A 4BLVA 5F9HA 3OOWA 3BSFA 2V6JA 4P5EA 4LY3A 1G3MA 4BMZA 4QPPA 4WIAA 3EH2A 1SUEA 3C8DA 2LGJA 4S12A 4W7IA 4XYGA 5ALZA 2A0UA 4INJA 4N5HX 1XNRB 1P8JA 1WR8A 1I24A 2FFJA 2J4CA 4IDHA 3HA2A 1FVOA 4PVCA 4TRNA 3S7TA 2FCAA 3A9CA 3NM6B 1Y8QA 3D9QX 1M8JA 4NONA 1YDEA 2O9JA 1C4WA 4HAXA 3V7YA 4CXMA 3QVXA 4RD6A 1YCDA 1C3VA 2P35A 4L5CA 1VE1A 1X7GA 3OJ0A 3HM9A 3OPYB 4FYVA 4G1EB 4Q82A 2OQIA 3AEXA 1W4CA 4JI7B 2H6EA 1RSZA 1LTQA 2PWYA 4JLAA 2XCQA 1QM5A 3L5KA 1AGXA 4MWCA 4B6RA 5JS8A 3GUYA 4K28A 4IAOA 4TL6A 4F06A 4RWEA 4R9NA 1XTZA 1KY3A 3I73A 3ZWMA 1BJKA 1LLQA 3AKDA 2RGRA 4DFDA 4RHEA 1OI2A 4Z9FA 2CLHB 4ONEA 2QJFA 4AJPA 3RVOA 4G4JA 1VPWA 4HNSA 1Z6PA 2VP6A 3H6GA 4KVZA 2ZIFA 1ZN8A 1OBHA 2PQ0A 3I9LA 5LYYA 5EIBD 3SI7A 4MMYB 3AUTA 2ATCA 4INPA 3IH5A 3R0JA 4JLPA 5DBFA 4D44A 3T3DA 4TLMB 1RXWA 2H4WA 3RAJA 3DVLA 1NWHA 1BSVA 1X1RA 2ZRPA 4EHDA 4YJ2A 4OHCA 4X71A 5BW6B 2FQWA 1SUCA 3K6RA 2OFFA 3CE9A 4YJKA 3ZEAA 4X20B 3HNPA 3O1LA 1ZJWA 4EA8A 3QFSA 3AZOA 2A1UB 3HSYA 2QF7A 1QUFA 2BTQA 1J1IA 1F8FA 1NE2A 2B2CA 4U7GA 1NBHA 1C1DA 3OUUA 4CQNA 3OECA 1JHMA 1GQQA 4FI3F 4LDRA 5TR9A 2C99A 3QE2A 3ZE7A 3B8HA 1H8HA 2EWWA 3NT4A 4YDRA 3IDZA 4ZEWA 1P2GA 3F73A 1KQOA 1XUOA 1YRWA 2YC2C 4G1VA 1PK9A 1GQFA 4RDCA 4YJDA 4BNYA 3HXOA 4RKWA 1J1UA 4N0EA 4RUKA 4TLEA 1H4VB 1QIGA 3GOQA 2X77A 3ONWA 1FUIA 1XALA 4C2AA 3SJAA 5M3BA 3M9LA 2J5BA 4PTZA 1PS9A 2B5OA 3MTEA 3UXHA 3OPNA 4M9RA 4GICA 3X44A 4DUGA 4ZPJA 3R6LA 4KIFA 5FPYA 3TZHA 2A1IA 2NO7A 3ZUPA 1J2TA 1TI7A 4OFZA 1VCNA 2C98A 1EA5A 1XRMA 2IEZA 4QEKA 1QYRA 1H5QA 4WBNF 5JAQA 2HX1A 4PG7A 1DT5A 4PC2A 5CLIA 2A5GA 1WXDA 2IYRA 4EG7A 5ALMA 1WXFA 1ECPA 1ORVA 1JE1A 2VF8A 2WT9A 1KDPA 1FSFA 1QK4A 2E6KA 4YCDA 2R8YA 4O02B 2C7QA 4GX0A 3ZY3A 2Q45A 2PL3A 2ZRJA 3DP9A 1G8FA 4OGLA 4G0MA 1NVGA 3W2TA 1BXRB 1O6FA 5DEIA 3LT5A 1CRLA 2FP4A 2QTBA 4L0QA 5LYJA 2QJRA 1OYOA 1JR6A 3D1LA 3I8OA 2HH9A 1V3VA 2OSBA 3VOAA 3NOVA 2UYYA 4RORA 1MA3A 2HA0A 3ISJA 1H3EA 4DMGA 2DU8A 1ABBA 2D1TA 3ISTA 3G3EA 4KQFA 4MVYA 2EGHA 3T3IA 4CM4B 2PH7A 3QEBZ 1G66A 1OLXB 1K0FA 2XW6A 3OT4A 3Q98A 4MZXA 3WYEA 3X1WA 3AR5A 3U56A 4XDYA 1ML3A 2FY8A 2ST1A 5BNIA 3QXCA 1DEKA 2CF5A 3RKUA 1QPBA 1P74A 1UH5A 4BU0A 4QICA 3IMGA 1V7CA 1VIVA 2CEKA 1GUYA 3B38A 3GARA 1UM9B 4AUMA 2RSLA 4LZZA 4Q7MB 5E4YA 1EUDA 2J6CA 1KK3A 5A3SA 2DLDA 3QLJA 1JXQA 1NM5C 2PXHA 1E3WB 4QXMA 4UXIA 4WOCA 4YRMA 3PHCA 3K1TA 2AQKA 1FP6A 1USGA 1W5BA 2YOHA 3CB2A 3I61A 4YPFA 3NT2A 3R75A 4CEHB 2N1BA 1JRLA 3EMVA 4HF7A 4J3FA 4Q9HA 3E1SA 4X24A 4CL0A 4W9NC 4HB4A 3HVKA 4AP9A 4EO7A 4W99A 4XVUA 5BMVF 1ZMOA 5JSHA 1OR8A 4JJKA 2HIGA 3C6KA 5JXJA 1T5IA 3SF8B 5DHTA 1CR1A 2FXIA 4EGSA 1Y9EA 4KI7A 2QWXA 4Y3UA 4XRGA 3T99A 2VWHA 3M6WA 1QE0A 1M8PA 2D1YA 1SVKA 1SUIA 4JS0A 2PZGA 3HRKA 3CF4G 3ZJYA 4CCYA 4D8UA 4I1UA 4OJTA 1R00A 2G07A 3EYWA 2GQ0A 2HHJA 3GDGA 4TKUA 1NPYA 2B25A 2NTJA 4L75A 4EDHA 5BQXA 1FQWA 3I23A 4MS4A 2Q2QA 4BBJA 1ZVMA 2V1XA 2YY5A 4L85A 4Q66C 4D9FA 3A10A 2RGWA 5I4BA 1L5MA 4MI9A 3U7EB 2DMRA 1FA9A 3AKYA 2DUNA 1UWKA 3X1YA 3EEOA 3AR2A 2LKCA 1NVKA 5CX1B 5CM2Z 2HK8A 1FS5A 1XQ6A 4QAQA 2J0SA 3AUUA 1CD5A 4EABA 2F00A 2W8BA 3T4UA 4YP1A 4MI1A 3LW7A 3AFNA 3R9WA 7MHTA 1E3DA 4Z4EA 2V7UA 4IYJA 3NKFA 4QUGA 4MOWA 4MVJH 4IOJA 3KAKA 4I5DA 1NY5A 3ZDQA 1EVEA 2CXHA 4D9GA 3L8YA 1V95A 1L5HA 4B7CA 5CURA 4DANA 5C4MA 3W6UA 4ARSA 2DRIA 4ZO9A 4D3XA 2EG9A 3HO8A 4Z1MD 5J47A 4RE6A 4A36A 2YDYA 1UFVA 3FPGA 4PN3A 4QM6A 2KX7A 2H1VA 4I55B 3EOBI 3F6EX 3CMCO 1NMSA 1Z2PX 4AKTA 5I6DA 1C9YA 2ZT8A 4AYXA 2WHXA 2VK1A 2HO5A 5JH7F 2A9QA 1EH5A 2A5FA 2CVQA 4PLFA 1P7CA 1THZA 3DL0A 3K3PA 2ZUCA 4JLVA 1D4AA 2V6BA 1HQKA 1GKIA 1PHPA 2X19A 1L8XA 1NR5A 2QK4A 4O2LA 3VKGA 3JQ8A 2HTEA 1YJQA 3PICA 3OEEA 4ZN6A 3QWHA 1SZDA 3X1MA 3R1IA 5D00A 4D9BA 4P98A 4EQ6B 2A9OA 2GOYA 1GLGA 3WGZA 4P80A 3PPWA 5HSGA 2XYVA 3ZDRA 3F8TA 2GPYA 2CLMB 4TM8A 4OXKA 5JD4A 2H54A 3LT4A 3M6MD 3GEEA 4RBNA 2GBPA 3AQ4A 3O90A 4DIOA 3NV7A 4QJ5A 1PWEA 2EJVA 2FUG1 3MPUA 1P2TA 5C37A 1ODSA 3LBIA 3LXMA 1JQEA 4O2AF 3AO0B 3IAM1 1J22A 1UT8A 3ACCA 3C7DB 3OLXA 2KBFA 3HPRA 1AKQA 1A7JA 3TLKA 4EYGA 5DFAA 3HJFA 1S3IA 2EX4A 2IZ7A 1G3RA 3ONNA 2WDPA 1RQLA 1UKYA 3D81A 2C88A 1FDIA 2VP2A 2QRKA 2WTAA 2WWFA 3D43A 3DTTA 4IH1A 3NI2A 3R3WA 5AVZA 2AZTA 3REQB 2CWWA 3Q7IA 1R0KA 4PG4A 4TKLA 2XAAA 3RGGA 3S29A 2C2OA 1NR7A 2YX1A 5J2TB 1D7AA 3O8LA 2R62A 1D07A 4JYZA 3OJFA 3B1WA 4QG7A 1F48A 1I4LD 4IXDA 3TIGA 1C0IA 3HGMA 3Q8WA 1M2EA 1PU2A 3HB5X 4KN5A 4KUEA 3MCVA 2YDXA 3ZIDA 2I6XA 1QH8A 2R6FA 1J8FA 4LWPA 2PV0A 1GPKA 4G56A 4WE3A 4KJZA 5KTMA 5IARA 2R86A 2B4KA 2FXVA 3IJPA 6PFKA 1QZZA 1RXUA 1QK5A 3TVYA 1N2GA 4DE5A 10MHA 1V7QA 4XR4A 2P1DA 5CIQA 3C3XA 4TMZA 1YQEA 2HY7A 1KU0A 2ZSHA 2WNIA 4CR6A 2XOXA 2ODWA 3EJWA 3UV6A 2P5TB 4GL2A 2YXDA 5HILA 4BVHA 5JEEA 1OVMA 2E6UX 3OD5A 4Q4JA 4P35A 3K9LA 4L95C 3ZHRA 2NQTA 1H2BA 1A98A 2CHGA 3RVNA 1TU0A 1DC3A 3CXUA 3F4LA 4WT7A 1XROA 3RUIA 4D97A 2QA5A 3DV0A 1GXSA 1TAQA 5K09A 5KYTA 1EGQA 4Q3EA 3CXRA 2PO7A 1EG7A 1TM7E 3A05A 3T4XA 5EZSA 2QE7A 2CXUA 3EGWA 2V8BA 3D5TA 3D3WA 3DVAB 1CSEE 1D2CA 2LIPA 2R9VA 1T2AA 4LZNA 4E31A 5I47A 2CDRA 3HN2A 1UKVY 2EDAA 1HT3A 2KQUA 3OX4A 1E1DA 3Q3VA 1U7HA 4FKMA 4MTLA 4BQQA 4BX0A 5L4SA 1KEEB 2OQ2A 2JGKA 5IHXA 1GP2A 3P9YA 1QHSA 4TZTA 3ZKWB 2D2VA 4XVHA 3GUUA 3ZHOA 4NECA 2PSDA 1J4AA 1GG5A 3B82A 4YRIA 2IYAA 3NHWA 2V0GA 3SEAA 4P34A 4CQLB 5ALYA 4ZDIA 5DNYB 1YI8A 3F8WA 1IIRA 4AL4A 2P65A 5AJHA 4R1TA 3TNFA 3PFKA 3QKRA 3NWOA 1HGXA 1Z2EA 2FWMX 2DWUA 5GWXA 2XLBA 3CH4B 3BJRA 3GMTA 2FEKA 3QXSA 1PNVA 1UDAA 2W93A 3FKSD 4JB3A 3QXJA 4RY8A 421PA 4BE4A 5J58A 3R5SA 4PIVA 2L19A 5KQGA 3I42A 4JYMA 4KRFA 1DJQA 3SC6A 4LQDA 3CY6A 3N6XA 4BP9A 1XTVA 1VB5A 1NXSA 1N3LA 3EGXA 4DLUA 1RJEA 5MN5A 3FZNA 4G0YA 1U2EA 1AB5A 4M22A 3K96A 4DC1A 2YN2A 1B26A 4MJ7A 1GL9B 4MQBA 5EKSA 1J42A 2RBKA 2FG6C 3OQNA 1LRJA 1Z5UA 3T7IA 2G7ZA 3EWNA 3ZK8A 3BEDA 1VJ5A 5K7SA 2FPPB 1FSSA 1F3LA 3M6UA 5F35A 1B14A 4DRXB 2ZSKA 2CXQA 2NXNA 1XAGA 5B1IA 1KH3A 3L77A 1GWNA 2CLIB 4GBED 2X0RA 4GP9A 2V0CA 4RTSA 1FJHA 1B1AA 2VJLA 3VDMA 3CLRC 4HH1A 5DSZA 1CUDA 3SIRA 5A7GA 5LXTB 1XKTA 3RBAA 3FCCA 5FFFA 3FTEA 1SULA 1GG8A 3MGGA 1CZUA 1MP0A 3SD7A 3SIXA 5IX8A 1D1QA 1V6AA 2C1ZA 5HZGA 5G4KB 3GJZA 1PR5A 5JLJA 5L45A 1YDWA 4QO7A 2YQ5A 5C32A 2OAGA 3EXHC 4KMMA 3IDFA 3TOSA 1OLSA 3GF4A 3B1YA 3OIFA 4QUDA 1ORWA 4UHKA 3ST7A 1W0CA 2JFXA 5D87A 2D5CA 4B4UA 1VCIA 1H42A 2XUQA 1BD3A 3IKVA 3KXLA 4GL4A 5JASA 2ZIZA 2IX9A 3HB4X 4WEOA 3T7EA 1U7PA 3DT8A 3PX3A 5G4LA 2XGGA 4FD2A 5FQOA 4J1TA 4MUGA 3W78A 4D43A 4JX9A 5AM5A 5CXQA 1EIWA 3GRFA 5HQ3A 1WAMA 3RR2A 1ZBDA 1WSBA 4RA6B 3MERA 4JYPA 3SP1A 5I7FA 4ZVRA 5IJWA 2ZUFA 2ZJ4A 1UR5A 2A33A 4LCBA 2VDWB 5BN3A 3W9YA 3CJQA 2HN9A 2BKAA 4PHGA 4KR7A 2JPDA 3Q7TA 3KZXA 2J09A 4LUCA 2VQ3A 5FEMA 5GJVC 3PCTA 1D5CA 3EIXA 5DZSA 1XEXB 1AS3A 4NBNA 4NTZA 3FIUA 3N7AA 1OB2A 2NTNA 2WSYB 1V7PC 1IWPB 2AUTA 4IUCS 4I3HA 2HYIC 1RLIA 2HJRA 4JVSB 2VHVA 3QRWA 2F55A 4LF4B 1DBPA 4N3GA 4XX1A 1R6VA 2JHFA 1NQWA 5AXAA 3C1AA 1G8AA 1OT5A 1U2GA 3OVMA 3BMQB 3IQFA 4RNCA 5TIIA 1B8UA 3QPCA 3RYHA 2ZBEA 4YN3A 5B3LA 2PD4A 1OZFA 5G0UA 4DIKA 1EFRA 2AFRA 2WU8A 1UBFA 3FVVA 4WDRA 1QCDA 2BEKA 2UYOA 4LE2A 3VFDA 2VUSA 2WE7A 2YN0A 2Q9UA 5E9AA 2W6PA 5FUBA 1Y6JA 4BQFA 5SZIA 1XJQA 3OQPA 2J6HA 3HADA 1ULSA 3KOYA 4LXYA 4PS0A 1MEEA 5CGQB 1FW6A 3TNYA 3OMWA 5CDYA 2IVZA 2LXNA 1TCAA 1RCUA 4PRZA 1YIAA 2P9EA 1DKNA 4BV9A 4OD0A 1MKYA 1NVTA 4LDJA 4Y6GB 1U1FA 1XXHE 3VOSA 4CKEB 4KGDA 3HUEA 3HXLA 4XTCS 2W6ZA 3ECSA 4K9RA 2G83A 1SVLA 3L41A 4UE3S 5F98A 3QKTA 5C1BA 3T94A 3U7HB 3LNCA 1KDOA 5UKDA 3BVPA 4MIYA 1TQ4A 1QG2A 3G0CA 1YKSA 4Y2VA 4OL0A 4RDIA 4C03A 2Z0MA 1G5PA 2QRMA 4BO5A 5JPCA 2WV7A 1S9DA 3CX6A 3FWPA 3DKVA 2FZVA 1QG0A 2QOEA 4KKXB 3IPYA 2WAOA 4BFSA 4HDAA 1C8KA 1BE1A 4N7RA 5ITWA 5HM6A 2HRZA 4RLSA 1E7QA 4MUIA 1NDQA 2X1VA 2JLYA 1ZCJA 1RFGE 3R6DA 5BW5A 1NFQA 3GC6A 6REQB 1F5SA 2C8KA 2VT6A 1TMKA 2D3TA 2OO5C 3JX9A 4HEQA 4LJLA 4M76B 5AJTA 1C7JA 4XWTA 2HM7A 3S40A 3VVCA 3EPJA 3A9WA 4MW9A 1OZGA 3N0WA 3BRSA 4HDNA 3U4GA 1MVNA 1Z37A 3NTRA 3B9RA 2AJLI 4UUAA 1GZ4A 3I72A 3UJAA 3M2PA 2WA1A 1XHFA 4KI0A 2Y1FA 1OQAA 5EE9A 1W5TA 1LZLA 2G6TA 2R8RA 4BLPA 1OAOC 3PQ4A 3WE7A 1X14A 4PZAA 4PRYA 2Y0BA 1EK1A 3EQ9A 4KDFA 1WUHS 2FU5C 4DKJA 1IN1A 4ZJZA 4HAVA 1UMCA 1T4BA 4DGQA 5LQAA 1QQ7A 3WWEA 2C2BA 1FMTA 2IXFA 3D02A 5ED4A 4YVFA 4A5OA 5LBIA 1PP4A 3MMNA 3PFWO 1G41A 2PH5A 5CA1B 5L7WA 4BWGA 2D7JA 2ZI9A 3KU1A 4DQKA 5A0FA 3W06A 3I1IA 5JDCC 4KYUA 4B3IA 1FUKA 3S44A 1KEPA 7MDHA 4HQLA 4OUKX 3ROGA 3ADOA 1J21A 3CUTA 1IEVA 4PNHA 3LVQE 3PC7A 4RGQA 4XA8A 4BYGA 2W2LD 3PXBA 2PBZA 5AOCA 2B20A 5EIOA 1DC8A 2GPBA 4YXWD 2P78A 4G8DA 1BEUB 4TXLA 2H1LA 1O87A 4ZMSA 5KTPA 1RRKA 3QYAA 5LD2B 3O91A 5JRDS 4E1AA 1U28C 4H4EA 3QX3A 1NQUA 1Z8HA 3IAM6 2P2DA 5EE5B 1T0HB 1DV2A 1X1QA 4G63A 3ETHA 4MP3A 3VO8A 4FZJA 1D4FA 2RMKA 3EVNA 4TMXA 1GFIA 3ZJ5A 3H8VA 1F7UA 1QSGA 4GPAA 2R7AA 2ZTHA 3COPA 5HK8A 3FLEA 1RDFA 1CY1A 2GJ9A 2MU1A 1PQUA 1GNSA 1KFEB 3QVGA 5IH3A 4EKYA 2ZR0A 3KWLA 4C6TB 4HX9A 4RV9A 1VZ3A 1PJZA 4C7BA 4CGYA 5ADWA 1A9XA 1JSCA 1VCOA 2H3HA 4EKGA 3MLAA 3BMOA 3W77A 4PAGA 2FMFA 3F6CA 2O50A 2D5AA 2ZOSA 1TM3E 4Y98A 3FN4A 1QIJA 3OZVA 3HO6A 5L7TA 4QUHA 5CFQA 2H8GA 2FPWA 4O4LB 4IFBA 4D3SA 3FOFC 4C3ZA 1PFKA 4BFXA 4C4SA 4FHEA 2FF5A 4LDZA 3MQ4A 1SBNE 2Y27A 3DAGA 3FOEC 2VFAA 1Q6YA 2A7XA 3ZV4A 4LJ6A 5JAZA 3RW9A 2JC3A 1JA0A 1WTAA 2PG3A 3ZCSA 2F1HA 5LIRA 3EBLA 3L4BC 1C7RA 1MZVA 3OZBA 5FO0A 4EPVA 4PLVA 1GRNA 2Z5LA 5E6RA 5CVVA 4IIFA 3TLEA 1U31A 1GFSA 1X42A 2MYTA 3ENWA 3VYWA 1PK8A 2RK4A 2ZBDA 3KQHA 3NBXX 4FR5A 4PQGA 721PA 3DG9A 5LZ7A 5JFTA 4ALKA 3BWYA 1U5AA 4DA0A 1CZLA 4C4TA 5CX4A 5ALWA 1HOXA 1WO8A 1YB4A 5DHRA 2AB0A 5CFNA 3W90A 3C4VA 1M1UA 4RDHA 1M2FA 3AERB 3C7KA 1YC2A 1PGJA 3KWMA 2W8ZA 4UPVA 4ENTA 3THWB 1Y81A 4I4LA 4OYRA 4ZHQB 1ORRA 2MJLA 1A5SB 1I4OA 2LZ0A 1F4PA 4DMRA 3EGDA 2RC5A 4MX8A 2M9MA 4MQEA 5L4NA 4O3MA 3ASVA 4CR7A 1QTQA 5BWCA 1Y7LA 4LY0A 5IYZB 2AZMA 5DO9A 4UBMA 4ZZ2A 1O89A 1P45A 2ESRA 1VBFA 3OE7D 4C4OA 4EHFA 4F7DA 5LZ9A 3THXB 2ZPTX 3CPEA 4QFMA 2I91A 3EZ2A 2PWAA 4UFOA 2AZ4A 4FNGA 1CF4A 1MVOA 2ODAA 2NU9B 1Z5ZA 4GSKA 3FPAA 3PKZA 4F5EA 3N2LA 3PG5A 2CV0A 1LRLA 1PLLA 5JAIA 4B5LA 3Q3JB 3F5MA 3NVDA 4L74A 4OBWA 3WBKA 3B2EA 3F67A 3HCBA 4MIEA 4OJYA 4PFJA 4BEJA 4CMCA 4NXMB 1QO7A 3V4VB 3LQYA 1GCUA 3T1OA 4MNTA 1MJGM 3W2EA 2H29A 3CUKA 3QHAA 4I4TA 3CR8A 1K08A 1ULZA 3LXRA 5CGZA 2ZSAA 3VR6D 4XVCA 4TUYB 4W5RA 4FOSA 1M2NA 4Q1BA 3UJ9A 3OY7A 3EVDA 4EJSB 2IS4A 1IM2A 4XJSA 2TMDA 3PEUA 2VPZA 1T91A 2OVBA 2AEFA 5AUNB 3RU7A 3ROEA 4Y9UA 3ORQA 4N0QA 3KJGA 1II8B 4GQBA 4LSGA 3QHPA 1PGPA 1W8IA 3TKAA 4B3RB 2D8MA 1RC0A 1HNZB 4ZJPA 1WDKA 4H6WA 2NSDA 1YB5A 3OURA 1W5EA 3B48A 3JTMA 4E32A 3LIPA 2G5PA 3LGXA 3E3AA 1Q0ZA 3CEJA 4JUDX 4UCFA 4WZBE 2HBZA 3Q8LA 4UXHA 3ZNOA 1H23A 3MYRA 4EG5A 4YONB 4OBXA 2E49A 2JGJA 1FPMA 1QKJA 4YLGA 1QHXA 5FWXB 1P1KA 1VBNA 1CIVA 2FZCA 1UFQA 2I22A 2PN1A 5DU2A 2XWPA 3HLYA 4QODA 4Q4AB 3V8NA 5B64A 3T7AA 5I4CA 1Y8AA 2VPTA 3E7DA 4WK0B 5BWBA 1RJ9B 4X1YB 5L40A 2HI0A 2X0NA 4D0GA 1W2WB 3CZCA 3FFAA 3PPIA 4TM7A 1W88A 1P0CA 1ZN7A 1TNDA 5K3BA 2GN9A 3PCRB 3OE4A 4JC4A 4D0LB 3KQWA 3RHSA 5JBIA 4UAUA 1FEZA 2BWJA 3WWPA 5BSWA 3A11A 2LE0A 1BE0A 2AR9A 3EDCA 3MYYA 1WHTA 3MSCA 5AHRA 1U3UA 4J0JA 1GITA 4MKIA 2ZIVB 1EVLA 4GXQA 3ZVKA 2C7GA 1ECFA 1Z0JA 1Y33E 4UZFA 2CLLB 5C8YA 1H66A 1T25A 4FQ8A 4BMXA 4ZYWA 1KORA 1IB0A 3TQSA 4E4YA 1TA0A 1SUDA 4OI2A 4KK3A 1XZKA 2EFJA 2J0QA 1FTGA 1Y3DE