1SO8A

Abeta-bound human abad structure [also known as 3-hydroxyacyl-coa dehydrogenase type ii (type ii hadh), endoplasmic reticulum-associated amyloid beta-peptide binding protein (erab)]
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
248
structure length
208
Chain Sequence
RSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTDPAEYAHLVQAIIENPFLNGEVIRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ABAD directly links Abeta to mitochondrial toxicity in Alzheimer's disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords 3-hydroxyacyl-CoA dehydrogenase type II
total genus 67
structure length 208
sequence length 248
ec nomenclature ec 1.1.1.178: 3-hydroxy-2-methylbutyryl-CoA dehydrogenase.
pdb deposition date 2004-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1so8A00
3CUKA 2JHGA 1LSUA 4XYEA 1M6WA 1N2SA 4Q3BA 4BNXA 3ONEA 1O9BA 4FR5A 4HUJA 1F8FA 1N1GA 2Y68A 4IIUA 2ZB3A 2EJWA 1Y9AA 4XGIA 4L9RA 1CQJA 4S1VA 4HP8A 4CV2A 3AWDA 3RBXA 4YWJA 3D7LA 2HLPA 1FXSA 3BZUA 1DB3A 2ZQYA 3OEYA 4B4UA 4RLSA 1GR0A 3ZWOA 3OJOA 4K1LA 2Q1TA 3G79A 3F3SA 2HU2A 3TFQA 1PGNA 1H94A 2RHCA 4FS3A 4MKZA 3GNQA 4BGUA 3PWSA 1UZNA 4LVUA 4OGWA 4BMNA 3PQEA 4NMHA 3WYBA 2NNLD 3RUEA 2J6IA 3PEFA 4E21A 1LSJA 1AXGA 4L4RA 2G5CA 4OSPA 3VTZA 4BO5A 1B0AA 1U5AA 4YQZA 4E31A 1ZNQO 1GQ2A 1B16A 4BL5A 4A10A 2IRWA 3GUYA 4PG8A 1BW9B 4AJOA 5AXAA 3KVOA 4P4GA 1PR3A 3ZV6A 2R00C 5KTKA 2J5KA 5L7WA 1ENZA 2PGDA 1L7DA 2YY7A 1B8VA 1PEDA 3MJ4A 4NK5A 1B15A 1LRKA 4YJGB 3V1YA 1ZSYA 3ZV5A 4MVJE 4MVJF 4AJLA 4P8RA 2OXIA 4XIJA 5ICMA 3V5NA 4U6QA 1V3UA 1YKFA 3EHEA 1LXCA 4RF5A 1D1TA 2BGMA 3WGZA 3ZWYA 3VZQA 2WD7A 1LLDA 2Y0DA 2BHLA 1WPQA 3NV9A 4IDDA 1VJTA 4WE3A 3W6UA 4M8SA 5TT1A 3GEDA 2PZLA 3CINA 4M49A 1GEEA 3GPDG 2EP7A 3S2GA 3CIFA 4G2NA 4DQXA 1HWYA 2VYVD 4KP7A 4DYDA 4PGFA 1QYCA 4MO2A 4BO1A 3WXBA 3EW7A 3EZLA 1NYTA 4DRYA 1LA2A 4N7RA 2HUNA 1FDVA 1XDWA 2CVQA 3ZNQA 4BKRA 3L6EA 4RCVA 3RU9A 1DIGA 1XELA 4K9DA 4RPGA 4YQYA 3WQQA 2WSBA 4WGGA 4NG5A 5U4QA 3VPXA 4KUGA 5DN9A 4QTZA 2CY0A 4YJHB 4L74A 5T64A 4OM8A 3HHPA 4WOJA 1I5RA 5AXDA 2SCUA 3S2IA 4BO4A 3SVTA 1PS8A 3NUGA 4W82A 5DULA 2BRUA 4J1SA 2ZQZA 5KCZA 4MVJH 3LC1O 2PK3A 3H5AA 3DHYA 2YQ5A 4GAEA 5F21A 3A28A 2OGUA 5TIIA 2DUWA 2HMWA 1BXGA 3GVPA 3ABIA 3O4RA 4OOEA 1GYPA 1XLTA 1JA9A 5CEJA 1MV8A 1EDZA 1QMGA 3IUSA 3I6QA 4CLOB 1MB4A 1VI2A 1DAOA 1SCUA 3IDSA 4DQVA 5I9NA 2ZB4A 3B70A 4PRLA 3W1VA 3O8QB 4A03A 3OQ1A 3PYXA 4GI2A 4YXFA 2CMDA 3I23A 4AJKA 1LSSA 4IJWA 2FY8A 1WDMA 2QRLA 3GDFA 3GAZA 1VL0A 2HAEA 2NVWA 3Q2IA 5CAEA 2VUSA 1U28A 4TKMA 4ZQHA 3F4LA 3PHGA 4CL3A 4BGEA 1W4ZA 2B0JA 3PFWO 1CQIA 2V6GA 2AEFA 3ICCA 4GMGA 4PVCA 4AJNA 1V35A 1N7HA 1Y5MA 2EV9A 4E6PA 2YHIA 2NUAA 3WMWA 2QZZA 2VYND 5TQVA 2BELA 2YV2A 3OJEA 4F6CA 2X0NA 5B4TA 3LSYA 1Y8QB 3FD8A 2A94A 4WNIA 4CM8A 1Y5RA 4NBUA 4ALNA 3ST7A 1Z74A 2IODA 2WM3A 4A2CA 5LDHA 3RCBA 1F06A 2B5WA 2RIRA 1V9LA 3A4VA 4BMSA 3A9WA 2IXBA 3EVTA 4IQ8A 1IZ0A 2VWPA 5CEFA 4R51A 3FTNA 5IDYA 2AG5A 3AU9A 1SBYA 3MTGA 1YXMA 2YV1A 1ZMTA 3WGYA 5KNLA 4F45A 3P19A 4FFNA 5LCXA 4GWKA 4XA8A 4Y9DA 1OMOA 3GN1A 4B3HA 4E32A 2HRBA 1G1AA 3BYZA 1HSZA 3R3JA 4BNYA 1SO8A 2GO1A 1MXFA 5TS3A 2X0JA 1RM0A 3KETA 1ULUA 2JFFA 2Y1DA 1E5LA 2W2KA 5U1PA 1KERA 3K2EA 4ZGWA 2PNFA 2UDPA 1EDOA 1NASA 1TB4A 3HADA 5GZ6A 4MP6A 4IMRA 3ADOA 2FP4A 4IY1A 2WEKA 3UGKA 1PR9A 1XKQA 1UXKA 3OETA 3H3FA 4KDFA 2X86A 3UH1A 3E9QA 3E03A 5EIOA 3I5MA 3RUAA 4DIOA 4EW6A 4JNKA 1LDYA 5K6AC 1GDHA 1BMDA 3SC4A 1V3TA 2GN8A 4NBWA 5T8KA 4AG3A 1W6UA 2EKPA 1NPDA 3GA0A 3MWDB 3E18A 3KEQA 5JAQA 1IHYA 2QHXA 2NU6A 1N92A 3W4KA 1DHRA 2AQKA 3E9NA 3RIHA 1LBEA 4XYMA 3VAZA 3PGJA 5BSFA 1DRVA 5CFZA 2A92A 1QKIA 1I3MA 3DBRB 3RUCA 5C7IO 3IKVA 2D0IA 1YL7A 3LC7O 1RYEA 3M1AA 5EESA 3QP9A 3MOIA 2DBRA 4CPDA 1LRLA 3B20A 3CXRA 4RPJA 4HNHA 5FWNA 3H5RA 3PJEA 2JCVA 2X8LA 4J16A 4LVCA 1FDTA 2PGJA 1C0KA 1T2CA 1ZW1A 4XR4A 4EUEA 2ZTMA 5B4VA 3IIEA 3IMFA 3PIIA 5HS4A 3GFGA 4R5MA 4N5NA 3VPHA 1N7GA 3KO8A 4IM7A 3ZZNA 5DF1A 5I7SA 1DC3A 1LTHR 1CDOA 1TT7A 4MP3A 4GSKA 4D42A 2VWGA 3GDOA 3FTPA 4IGFA 3ZCXA 2VRCA 3K8ZA 4Z3KA 3PDUA 4LISA 4IZIA 3SJ7A 1V8BA 1VM6A 1I2CA 4BO7A 5IDQA 3TDKA 3BIOA 2A35A 5HM8A 3HWRA 3NJ4A 1NVMB 3HUDA 3PVZA 4E2XA 3N58A 2G17A 3LVFO 5DBGA 1KOLA 3RJ9A 1UDBA 1E7MA 5JCJA 4JBIA 3EYWA 4LGVA 2WMDA 3HDJA 1LDNA 4CV3A 1DFIA 2UYYA 1PL6A 4HY3A 4KUEA 3UF0A 3U4CA 1AE1A 1B3RA 3F9IA 1M66A 1XSEA 1LDEA 3VKUA 1GD1O 1K5HA 1YH3A 2NSDA 3BMQA 1W8DA 1ZK3A 4FJ0A 4CV0A 5JNLA 3GMSA 3L9XA 2GUGA 3FWNA 3PZRA 3EY4A 4J43A 2NTJA 4WLEA 5MDHA 4MVJD 4KOAA 5IXSA 1MA0A 1P74A 5EERA 3JYLA 5L7TA 1FJHA 1ZEMA 1E7SA 3I1JA 4J2OA 3WSWA 5L4LA 1R37A 1XA0A 4DLLA 3BMCB 1M76A 3D64A 3HDHA 2VHYA 5C3MA 4FIZA 4ND5A 3WG9A 5DCUA 1PZGA 5FEUA 4ID9A 5G4LA 5G4KB 2X5JO 3RKRA 4MIYA 3ZGYA 4A27A 1FDSA 1V6AA 5JC1A 1VSVA 1J4AA 4I1IA 4I9NA 3HG7A 2H63A 3K6JA 2C07A 3O9ZA 4CMAA 2ZB7A 4TMFA 5I7EA 1TXGA 1Z73A 3QSGA 2J3JA 5BSHA 4PLVA 1HEUA 1B8PA 4RPLA 4IZHA 4PCVA 1DO8A 4YB8A 3VDRA 1BSVA 3OJFA 1ZCJA 5EL0A 4XYBA 1M67A 4K26A 3Q9NA 4BGIA 4R68A 4HWKA 3ETEA 4CM8B 2RBEA 2QZ9A 4O63O 4DREA 5EQFA 5ES3A 4ALMA 4XRRA 2FZEA 3WQRA 1B8UA 1UXGA 2CDAA 1NFRA 1P45A 1E6EA 4PG5A 5DNAA 1DOHA 1RM3A 5IXYA 1FK8A 4BNIA 4YPOA 1JTVA 4GX1A 4EJ0A 1YDWA 3CPSA 2EF1A 1IPEA 4KQWA 4UVGA 1ZUD1 3VPSA 3JQGB 1Q7CA 1QRRA 3OHSX 4CM6A 1T24A 2X5OA 3Q6IA 3JD1A 1IHXA 3R0IA 3UKOA 3ZV4A 2AE1A 4MKRA 1Y8RB 1T2FA 3TZCA 2V65A 3PJFA 4WLVA 3WWZA 1WW8A 2R6JA 3GZNA 4FGSA 5TLSA 3DQPA 1NVGA 1T2EA 4D46A 4DVJA 3BTUA 3H7AA 4CMIB 1MLDA 2D5CA 3BAZA 1QV6A 4NIMA 1HE2A 1I36A 1TA4A 2LDBA 4DC1A 4FJ2A 4Y8VA 2CZCA 3JCZA 1WDKA 3NRCA 5I8WA 1PJSA 3IS3A 4AL4A 3RFTA 5I9LA 1RJWA 2ZTLA 2FHSA 2WTBA 4W99A 1E5QA 1E3IA 4O59O 2QYSA 3MJSA 4WEQA 3GNTA 2I67A 2GERA 1PGOA 2NQTA 4HBGA 3ZHXA 3I9KA 2XF8A 2GGSA 4J1NA 4RQTA 2ILTA 1K2WA 3FNHA 4B7CA 4R54A 3WNQA 3KYDB 4UEJA 2GCGA 4Y6SA 1HE4A 3IJPA 2I76A 1R15A 4GWGA 5H81A 1GZ6A 2UUPA 1ZK1A 4QT0A 3C1TA 1O8CA 3C7AA 1HE5A 3IC5A 1EQUA 2CDCA 1CEQA 3JYNA 4B7XA 5DDIP 3D5TA 3MTJA 4RGBA 2OBNA 4TSKA 5L51A 1HYHA 4AJIA 2YFHA 2PZJA 2DLDA 1G0NA 1MC5A 4DUPA 1D4FA 3INRA 1PWZA 1YJ8A 1CERA 4WLOA 3ZWNA 2E82A 3PP8A 4DBZA 2Q1WA 3IOYA 2UAGA 3PPIA 3JQBC 2YDXA 4RORA 3RBVA 1T4BA 1WMAA 3KSUA 5T6BA 3FF4A 2JL1A 3RUHA 3WLFA 3WBBA 3B1FA 3KHUA 4Z0PA 2OL4A 4FC6A 1LRJA 1JAXA 1P31A 2ZYDA 4FSHA 3RJ5A 5JAIA 1NWHA 3ORFA 4FFLA 4YAKA 1C14A 1AN9A 3D3WA 3H9JA 1O94A 5G2OA 4BGVA 4IDCA 1IL0A 1DDOA 1A5ZA 2RHRA 3FR8A 3D3WB 4TVOA 2YQ4A 3GR6A 3L07A 4CV1A 2DAPA 3VZSA 3ROMA 5F1OA 3OH8A 3P2OA 1IYZA 3GVXA 3IP1A 3NX4A 1H0KA 4UUPA 1UJMA 2HK8A 1YWGO 4BNMA 3EMKA 5K9ZA 1SB8A 1DJQA 3A14A 5JDIC 3I83A 4RO0A 1HLPA 1NQOA 1SOWA 4J90A 2R00A 4GQAA 3LT0A 5G0SA 4BB6A 2JAHA 4R1NA 1P1IA 1HLDA 3DZIA 5TJ9A 1J49A 2H6EA 2YV3A 3MJEA 2O3SA 1DPGA 3WJAA 1G0OA 2VCYA 2JJYA 5EN4A 4W4TA 2PZMA 2V6BA 2Q2VA 4U0KA 2ZATA 3EGOA 3PK0A 3QVOA 1U7TA 1HRDA 4KQXA 3V8BA 3B1JA 1H9AA 2OP0A 4F46A 4CM3A 4L4XA 1JU9A 2GZ2A 3FBTA 1JQBA 2RCYA 2PFGA 4TRNA 1OC2A 3LF2A 1T2DA 3Q9UA 5TX7A 4N5MA 5A02A 1X15A 2B4TO 2CD9A 1T1SA 5KVVA 2C20A 3QVXA 1HSOA 3WB9A 3O38A 3KRTA 3H9EO 3HN2A 1U1IA 3TZQA 1U2DA 4BHTA 4A26A 5JO0A 4XD2A 1I2ZA 1PGJA 2FMUA 3DZKA 4Y67A 4J4HA 1U3TA 5DP2A 3U4DA 3KYBA 3NTOA 4AFNA 1KBZA 4J7CA 3VHRA 3ZWWA 3GHHA 3NJ8A 1MFPA 5IF3A 3WFJA 1UUFA 4OH1A 1R0LA 2B4QA 3ZI0A 1NVTA 3RASA 2B69A 5TNXA 1UZMA 2BFAA 1A71A 1SEPA 1HKUA 1KVQA 3QVSA 2W2LA 1I24A 4TVBA 4ILKA 1ISHA 1P0FA 4BO8A 4IMPA 4J7XA 2Y93A 1BXZA 2O7QA 2EKQA 4MOWA 4TQGA 1P33A 5TF4A 1MXHA 4NFSA 1WXDA 2P9CA 4R5HA 5GZ3A 4P38A 4JCOA 4TRJA 5A3JA 3UN1A 3GDGA 3AI1A 4HADA 2VNSA 3AJRA 3AM3A 5ENDA 3HB5X 4O0LA 5CG1A 4Z0HO 1ONPA 4Z9YA 3PWKA 3JD3A 4OQZA 3TFOA 2AQ8A 3BHMA 4PZDA 3RFVA 2VZ8A 3VH2A 1GCOA 3W4IA 1MUUA 4BKQA 1NFQA 1WMBA 2CVZA 1XR3A 4IXWA 1E77A 1PQUA 4KWIA 3ETGA 4Q39A 1TEHA 2B36A 3ASVA 2J5RA 4OXNA 1IE3A 1YONA 5A9SB 3QIVA 3GG2A 2BKAA 2I65A 5JLAA 5ICSA 1Q7GA 4O5OA 4E5YA 2WDZA 4JP2A 1X7GA 4AJHA 3C7DB 3H4VA 4JBGA 1C3VA 1MP0A 4KWHA 4U0JA 3FSRA 2JCYA 1EE9A 3ETDA 4YAIA 4K28A 3O03A 2Q50A 3G17A 4LSWA 4M86A 4XDZA 4XX0A 1QSGA 3GLQA 4K6CA 3UCXA 1UDCA 5JYDA 3JQ9C 1R6DA 2YUTA 4BKOA 5G0UA 4ZICA 3WGIA 1OBFO 3VDQA 3BMNB 5JY6A 1KEVA 4Q3NA 1XQ1A 2X6TA 4LW8A 1B3BA 1EFLA 4D41A 3PHJA 5KKAA 5A03A 5L9AA 1YGYA 1R4MB 1X14A 3GG9A 3KLPX 4XB2A 3DC2A 3WQSB 1DAPA 5I9MA 1UXJA 3GF4A 2EERA 4FCCA 4GGPA 3NKLA 1NPTO 4CM1A 4CJXA 4II2A 3ZDFA 1UDAA 1YJQA 4RPKA 3TF5A 2RAFA 4EDFA 1HDCA 3GRKA 1P3DA 2JKVA 4B8ZA 4CMHA 3H6KA 1NWCA 2ZCVA 3VOSA 2OHXA 3VTFA 5L3ZA 4JROA 1K6XA 1LSOA 4CUJA 5JCXA 2ZTUA 1P9LA 1CF2O 1A72A 2AE2A 1E7RA 1QV7A 3BMQB 1BXKA 1UAGA 5BT9A 1DC4A 3AOGA 4XR9A 3TPCA 4PFJA 4M87A 3CMMA 3FI9A 4BNWA 1VJ1A 5ITVA 4C7JA 1GEGA 2BF7A 5L4SA 1M6HA 4FC7A 1ISFA 2VN8A 4CM9A 1QYXA 2Z1NA 4GH5A 4ALIA 5IDXA 1EEHA 3OBBA 4D79A 3QWAA 4GGOA 3OSUA 4ITUA 5F5LA 3DZFA 4W6ZA 3ENKA 3HFSA 4XEHA 3S2EA 3IAHA 3B1KA 3RWBA 1H9BA 1SB9A 2Q1UA 3OQBA 2W4QA 4QX6A 2PY6A 4NDNE 4WEOA 3WGTA 4CLOA 1MFZA 2HQ1A 4MPDA 1B2LA 2O4CA 1TLTA 3JQ7B 3GGOA 1PJ4A 2PKQP 3W4JA 1V0JA 1GQQA 3D4NA 1YOVA 3JQ7A 1WDLA 4UREA 3INGA 1P44A 2X9NA 3G49A 1Q0LA 3OFSA 4EEZA 4B7UA 5L53A 4ZD6A 3JD4A 3QWIA 4RVFA 3ITDA 4OSOA 5J23A 1YDEA 4YEDA 2I66A 3PHLA 1JKJA 1X7HA 1PTJA 2CVOA 2FPIA 3AU8A 3JQ8A 3PHHA 2Y67A 3ZWVA 1LJ8A 1F0YA 1XU9A 2B37A 3FNGA 4JQCA 2Q99A 4XJSA 1I01A 5H83A 5L45A 2HKIA 1HYGA 3GVCA 1T4DA 2Q45A 3RFXA 1DJNA 5FYDA 1XIVA 3ZU3A 5KVSA 1B7GO 5JMPA 3DMTA 4DA9A 4TKLA 1YO6A 5F3RA 3NAQA 1JAYA 2HJRA 4ZHSA 2WE7A 4CR8A 3SBOA 2GPTA 4WCDA 3X2FA 4ZRMA 1S6YA 3QWHA 1SC6A 2IZ0A 1O89A 4XIYA 3JQAD 1TI7A 3DFUA 3S2FA 3CKYA 5B1YA 3DBRA 3TJRA 5JXWA 4D3DA 1YE3A 1N9GB 2NLOA 4KTVE 2ZB8A 4BNUA 4BIIA 3K30A 4JJGA 3AM4A 2AW5A 3KYCB 4DPKA 1ZXLA 1MG0A 2Y1EA 4EZBA 2J3KA 2PGLA 5ILGA 5AVOA 4FOOA 5DOZA 4YR9A 3IUPA 3TWOA 4ONEA 1U8FO 1CYDA 4ROSA 2OO5A 3H2ZA 4DC0A 4W7IA 1R16A 2W2KB 3WGQA 4J4TA 1U5CA 1MG5A 1UP7A 1Z82A 4I9UA 3D5QA 3OECA 1Y9EA 4G81A 3WDSA 4CODB 3GY0A 3ANLA 3GK3A 1PJQA 1TT5B 1U3VA 3E48A 1H2BA 4DPMA 3WBFA 1NPYA 3ZWAA 2POQX 3WR5A 4NU5A 4YT4A 4CLXA 5A04A 5IAAA 5JC8A 3TL3A 1DC6A 1XGKA 1CJCA 4RVGA 4YCAA 5KVCA 1C0PA 3UUWA 3F6YA 2NTNA 2TMDA 1Z7EA 4HFMA 4S3MA 2NQ8A 1YB1A 1PGPA 4C4OA 1GYQA 2G1UA 1HDZA 1NTOA 3H5NA 3FN4A 4RV9A 2GASA 4D0SA 3PLRA 1MC4A 4UUMA 3CZRA 2EGGA 4KUHA 2PV7A 1NAHA 5I8ZA 4BO2A 3AI2A 3PI7A 5JAZA 5CHEA 1GPJA 1XWFA 3DAPA 3ONDA 2HMTA 3NTRA 2OFPA 3GH3A 4JK3A 4QQRA 3DOCA 3DBHB 4KTTE 1EMDA 1GYRA 3KUXA 1VKNA 2PTGA 4Z6KA 4BNLA 1IZ9A 3M1LA 3M6IA 1DEHA 1NFFA 2FOIA 3JQGA 1OAAA 2GF2A 4O1MA 4ALJA 4CM7A 4PZEA 4RLHA 4IINA 3AM5A 2QRJA 1EVIA 3U4IA 3QW2A 2Y05A 1Y8RA 3RC1A 3W8DA 4A0SA 4FGWA 4R3NA 3EAGA 5G4KA 3K2BA 1P1FA 6ADHA 3BMOB 3LT4A 4CM4B 4U6SA 1ULSA 2X9GA 5BR7A 4Z0TA 4GX5A 3N7UA 3SLKA 3DZBA 4IXTA 3IJRA 3RUFA 2BFPA 1O0SA 1LLUA 1AHIA 3D4PA 2GN4A 1E6UA 1YBAA 4WLUA 3G3EA 4YRAA 1KETA 8ADHA 1LEHA 4JP3A 4LSMA 1KEWA 4WECA 3R6DA 2D1YA 3I4CA 1LLCA 1E92A 1U3UA 1OZAA 1GL3A 2JCXA 1D1SA 3BHIA 1U4SA 5HRUA 2VZ0A 1WZIA 4DWVA 4I08A 1PGQA 3T4EA 4AJ2A 3Q1LA 2E6UX 4IDGA 4Q3EA 2VTEA 2O3RA 1X1TA 4J3FA 4B3JA 4ALKA 4EGFA 3TSCA 1QLJA 4XDYA 1R0KA 3T7CA 1A27A 4YJGA 2AG8A 2AQIA 3VVCA 4M89A 5JO9A 4Z3DA 3GOHA 4CM5A 3GC6A 3JYOA 5F5NA 1C1XB 3JYPA 3NT2A 1N8KA 1I10A 4KMSA 4BV9A 3AOEC 1K3TA 1U4OA 4XGKA 4R1TA 4IUYA 2WD7B 4NK4A 3ZU5A 2DC1A 3DHEA 2O48X 3KM0A 4ZQEA 1LC0A 3KSZO 4WPGA 4PLCA 1U8XX 2VZ9A 2P91A 3QQPA 3F1LA 4BOYA 1ARZA 2YZ7A 4O6VA 4UVEA 5EMHA 4N18A 4GMFA 1UR5A 4XWYA 4YACA 4Q3CA 2AA3A 3PLNA 3C1AA 1ONOA 1QLHA 1QORA 5JFOA 3G1UA 2GR9A 2NU7A 4BNZA 1WWKA 1HDYA 1I0ZA 2J5QA 4BQPA 3AK4A 5JBIA 1W0CA 4FB5A 1BDBA 3JQ6A 4QO8A 5B12A 2ZKLA 3KYDA 4PLGA 4IGEA 4MIEA 1NQAO 5JDCC 4W9NA 3V2HA 4NFHA 2O23A 3FPCA 3AY6A 2X4GA 1HYEA 1LDBA 3FBGA 2NTVA 3OEWA 3PQFA 4EJMA 1P1HA 1SEVA 3RD5A 4B4VA 4INAA 2EKLA 2DFDA 3H3JA 4RL6A 2Z1MA 4K6FA 3I3OA 2PZKA 3UCFA 3VH4A 1GTMA 5CG2A 2EXXA 4EEXA 3OMLA 2C82A 3S55A 1SZJG 3FCOA 3I9JA 1BXGB 3G0OA 5JYEA 1LNQA 1KY4A 4P4NA 5F1PA 2JD0A 3ROQA 1MGOA 3RVDA 1BDMA 1IY8A 1ENYA 1GPDG 2HMVA 3U9LA 2TMGA 4CUKA 1E1LA 3OF2A 5BNIA 5TT0A 4CLEA 3DO5A 3B6ZA 1X13A 5FI3A 1TVEA 2H1SA 4OMUA 2Y1GA 3CZMA 1E3SA 1GQYA 1VE9A 3C3XA 1DC5A 2EJVA 2X58A 1VLLA 1BVRA 4URFA 1WP4A 3WYEA 2C7GA 1E1KA 3JQCA 1EK6A 3F5SA 3SXPA 3MEQA 3VH1A 2Y0EA 5JDCA 3EZYA 2P4QA 3JTMA 4NBTA 2PD6A 1QYVA 3LT1A 2EG9A 5G0WA 5L7YA 4F3YA 1J5PA 1T26A 4HNGA 3A1NA 3DBVO 5LDGA 2W90A 2Q2WA 1HDGO 4CMEC 4J1TA 3UCEA 4C7KA 3BTSA 4ND4A 1NBOA 1DLJA 1FDWA 4TRMA 2BGLA 4IQGA 1H93A 2WJPA 4J7UA 4E5KA 5T57A 4G65A 5THQA 5KWEA 5HBRA 1ZK0A 2H9IA 2C54A 1KY5A 2EWMA 4RZIA 2V6FA 2BFOA 1EK5A 3QY9A 3LLSA 4LMRA 2JHFA 5CPFA 5FFFA 1PJ3A 3Q3CA 2HJSA 1I3NA 2RH8A 4HX5A 3QWBA 4A7PA 1UZLA 3ZN2A 2VT2A 3WGHA 1ZXBA 3DXFA 3NYWA 5DP1A 1H5QA 5EPOA 2ET6A 2X22A 5IDWA 1GU7A 4IPTA 4FW8A 5C7OO 1U9JA 4DYVA 5COQA 1U2GA 3IL2A 4J49A 2OUIA 4WCFB 4DMLA 1Q0HA 4WUVA 1P1RA 3I9MA 3U3XA 4TZKA 1E3EA 5JS6A 4CMBA 2W8ZA 1A4IA 1NNUA 5KJCA 8LDHA 2C2XA 4UUNA 1HZZA 1KVTA 4CL8A 5A9SA 3RI3A 5IN5A 4X54A 3TZKA 4E0BA 1R66A 3TOXA 3AY3A 4OYRA 4Q3DA 5DCWA 1QR6A 4WLNA 2EIHA 1FF9A 4ZQFA 5JCJD 4PZCA 1KIFA 2HDHA 4XKJA 1NX6A 1Y6JA 3MZ0A 2QG4A 3LYLA 3NGXA 4CM4A 3QJ5A 4XYLA 3VC7A 1ZFNA 5BQFA 1GZ4A 1EUZA 2YYYA 1F12A 1PWXA 4PIVA 3E8XA 4EI2A 3GZ4A 5KOIA 3K9QO 3PGXA 4YRDA 4JXKA 3WOHA 2WE8A 3DOOA 4J0EA 4ND3A 4Q9NA 1VC2A 2O7SA 1WLYA 2GN6A 3KEOA 1E7WA 4NR0A 7MDHA 3X2EA 4GX2A 2CNBA 3E9MA 2CF6A 1KS9A 1VL6A 2I99A 3DL2A 4CQLB 4Z9XA 3HZZA 4PG6A 2DTDA 2D5AA 1ZVMA 3C7CB 1GZ3A 1RKXA 4YJHA 3MJVA 2Y1OA 2AMFA 3SLGA 3VVBA 5CDSA 1DSSG 1L7EA 1XG5A 2FWMX 1X0VA 4E33A 4W7HA 2IYPA 3DAFA 1E1MA 4NBRA 5JMWA 1M75A 3D4OA 4PN3A 5A9TA 1E3WA 2C59A 2BMAA 3IKTA 2OZPA 4GSLA 3WFIA 3VKVA 3HB4X 2O4UX 4F6LA 1C0LA 4GLOA 2D3TA 3Q11A 5BNTA 3DONA 2XOXA 4YJFB 2GYYA 2X1HA 3INTA 4N54A 4AJJA 1R0SA 3WLEA 3SC6A 2Y1CA 4CQMB 3QVWA 2Q2QA 4XQ9A 2B83A 4U5QA 2BLLA 3LK7A 3UOGA 5A5EA 2FR1A 4UVIA 5FF9A 4RF4A 1AUPA 1YOVB 1YB5A 2V6MA 1KVRA 1D8AA 4I5EA 1JLLA 2O50A 1DIAA 1JW9B 1PJTA 4LRTB 3DBLB 3E5MA 4GBJA 2GZ3A 4CUZA 1PL7A 3JQ9A 3S8MA 4IDBA 4YAJA 4BUCA 4R9SA 1YQDA 1KEPA 2DBVO 1E3LA 1R4NB 3I9OA 5TJHA 2E48A 2WYUA 3DB2A 3PFFA 1Q2XA 1A7KA 3H2SA 3JD0A 4LN1A 4JGBA 1I3LA 1P1KA 1V3VA 1ISGA 1ID1A 1D7OA 2Q4EA 3MJTA 1ADFA 1KEUA 4GLLA 4CQMD 3OJLA 2DTEA 2P4HX 2BI7A 5TC4A 2Y1FA 2HMSA 1J0XO 1NAIA 1ZIDA 2WWRA 3U4HA 4I5FA 4BO9A 2JFHA 4QECA 2CF5A 4MVJG 1PSDA 4B79A 4R41A 2PD4A 3COSA 2ZIZA 3H9GA 3GPIA 5KKCA 2B4RO 5A4DA 5TSDA 2FRDA 1KVSA 1H6AA 4B4WA 1KC1A 4E3ZA 3AOEA 5KJ1A 5HS6A 5BSEA 2VHVA 3WX0A 1Z7BA 3P2YA 2B35A 2GDZA 2DUUA 5G0TA 3IP3A 1NHWA 2NU9A 3LZ6A 4EITA 4CLRA 2O3UA 3NGLA 3QRWA 3PIDA 2HRZA 2O3TA 3VZRA 5IZCC 1PQPA 1VRWA 2DPGA 4YDRA 1VKOA 1LDGA 1GFSA 5AXCA 2Y99A 5L4NA 4CLDA 3G1TA 3ULKA 3DZHA 4R4JA 1E7YA 3D3EA 3ZWMA 2PH5A 3I4FA 1DRWA 3LT2A 3TL2A 3JQ8B 2IXAA 2D8AA 3GGGA 3H9QA 1QYDA 4R1UA 1NM5A 3ITKA 4YBZA 4NNJA 1YB4A 4BNJA 3H8VA 3GEGA 4E5NA 1K0UA 1I2BA 4LCJA 5KJEA 3PJDA 3JQAB 5ITWA 1SOVA 2VYNA 4R16A 3RC7A 4MDHA 2Q3EA 3CTMA 3WWYA 1E0DA 2Q4BA 3JQAA 5U9CA 3GNSA 2DKNA 1I32A 4G5HA 2A4KA 4H15A 5L40A 2IEBA 3HN7A 5BNFA 1PS9A 4BNHA 2JD2A 4BNVA 1GV1A 5A9RA 4IDFA 5DT9A 4IQ0A 4UULA 1ZJZA 3HFGA 4RQUA 3V1TC 2G82A 5K0ZA 2QYTA 1BRMA 3UICA 4AVYA 3EC7A 1B26A 1PJCA 3F5QA 3PXXA 3WTBA 4DL9A 1LC3A 3TOZA 2P5YA 2X23A 3U62A 1PJBA 3KB6A 2VRCD 2X9VA 2I5PO 2D2IA 5TGDA 1H6DA 1QYWA 1XYGA 4BMVA 4CR7A 2QQ5A 4UVHA 2P5UA 3KBOA 2IYOA 3I9LA 5CPBA 4AJ4A 3EDMA 4BQRA 2C7VA 2DQ4A 2YW9A 2FR8A 4ZU3A 4DQUA 4D3FA 4OXKA 2VHZA 3CH6A 2ZJ1A 2FSVA 4MVJI 2YHUA 4OHUA 1HETA 3AI3A 4BO3A 2RH4A 3OQ6A 3ZNOA 5KIAA 1RM5A 1LX6A 4DMMA 1RPNA 5AXBA 3DHNA 4XZ3A 5KVQA 2I3GA 4Q3AA 3MOGA 4R9RA 3BMOA 4GL4A 4OAQA 2F00A 1YQXA 4XYGA 3K92A 4HFNA 2O3JA 3AUTA 1ISIA 1OFGA 4H3VA 3JQFC 4AJEA 4MVJA 4BB5A 4D3SA 4E13A 3NDJA 1JVBA 4J2HA 5AYVA 4Z9FA 3VH3A 3JD2A 1OC4A 1VL8A 1ZH8A 5T67A 4AJPA 5ADHA 3OIGA 2O2SA 2YFQA 1YVEI 1M2WA 3AUAA 5HTOA 3DZGA 4PVDA 3U5TA 4BV8A 2NACA 1ENPA 2CSUA 4TROA 2XXJA 2EW8A 3PQDA 4R01A 1ORRA 3K31A 2Y66A 3WYCA 4EUHA 5IN4A 1I30A 4XGNA 3NTQA 1AXEA 4XQCA 4LK3A 3WICA 3TQHA 4PLWA 2C2YA 3DBHA 2DT5A 3H9UA 5K6AA 2AHRA 4NJMB 1PIWA 1A9YA 3OIDA 4BO6A 2CUKA 5T8KC 4YT5A 3TNLA 2DM6A 2OBYA 1ZMOA 3FWZA 2I9PA 1O95A 5ER6A 3L6DA 1JWBB 3F46A 4FJ1A 2VNAA 4HXYA 3ZV3A 1GUFA 4QUKA 4IIVA 3WNVA 4XQEA 2ZYGA 3ROPA 2VOJA 3ZW9A 4XB1A 3GT0A 1GAEO 4ZQGA 3ANMA 4PLTA 4I8XA 1GV0A 1HXHA 3WJ7A 2HCTA 3IQDB 2VT3A 4XRGA 3M2TA 4IJKA 2GN9A 2AEMA 3I6IA 4L8VA 4OQYA 3WGOA 3C85A 2J3IA 4YAEA 3AFNA 2ZYAA 3OIFA 5THKA 4DGSA 1H2HA 4L4SA 1DBVO 3N74A 2R2GA 3PWZA 3WIEA 1ZO8A 4B8WA 4MIOA 4JBHA 2PD3A 1XEAA 3DTTA 4I5GA 1I8TA 4E5PA 3CEAA 4CMCA 1A9ZA 2VUTA 4HV4A 3AUUA 2VRBA 4MKXA 4WKGA 3VPGA 4WCFA 1SNYA 1BVUA 1I33A 4IJUA 1WNTA 1PZEA 1Y1PA 5IJZA 2FSSA 4PRKA 3L4BC 4DBVO 1EVYA 2PKQO 5FI5A 1BTOA 3F4BA 2BI8A 4RDHA 2UV8A 2ZCUA 1DRUA 4FBGA 3ZWPA 4FFMA 4CR6A 5DCYA 2XPCA 4IBOA 4D7AA 1HL3A 3ADPA 1DFGA 1OI7A 4DIFA 5LC1A 1UXIA 2NM0A 3UAGA 1JDJA 3NDRA 3NT5A 1DIBA 4TZTA 4PG7A 3DR3A 1F14A 4IS2A 3CMCO 4KZPA 3LLVA 2OOSA 4BO0A 4NBVA 3GZNB 4MINA 3JQDA 3ON5A 4CM9D 2EGHA 3ZHYA 1ML3A 3AW9A 4OO3A 2DTXA 4MVJP 2FZWA 1P0CA 1KVUA 4QFCA 2GRAA 2I6TA 2ZJ0A 3BMNA 3DMYA 4L75A 4FN4A 4JN6B 1GY8A 1AHHA 1I3KA 3BTOA 5A05A 4OKNA 3MJCA 4JX8A 1FMCA 2DFVA 2E49A 4H7PA 4EJ6A 5CDGA 1UAYA 5DBFA 2P2SA 3K73O 3STHA 1HZJA 3GRPA 4H16A 3SEFA 4CMKA 4BS9A 2IEDA 1JWAB 1EVZA 1WVGA 3DWFA 3L6OO 3PZBA 4Y6PA 4Y98A 5ENVA 5F1KA 9LDBA 5JY1A 1P77A 1QXSA 2X5KO 3T4XA 1HDOA 2VQ3A 3JYQA 4UAGA 1BW9A 2HO5A 1K6JA 4FPXA 3ICPA 1G6KA 4MVJM 1H6BA 4BKPA 2JFGA 1JKFA 9LDTA 1EBFA 1RYDA 2VWQA 4FOSA 2VHWA 1H6CA 4JLWA 5ER9A 1R12A 4E12A 1NR7A 4GVXA 2YDYA 4GVLA 4DTIA 4CMEA 4YTEA 4TWRA 1SPXA 1RWBA 4OOFA 4M1QA 4YJFA 3Q2KA 4D43A 2EEZA 2OORA 3ZU4A 2Y0CA 1YBMA 1IPFA 1E6WA 1EFKA 3GVHA 4NHEA 2NVUB 3UXYA 1E3JA 3NT4A 5EJ2A 4WK6A 2DBZA 1BG6A 2VYVA 5JW6A 4CLHA 4JJFA 1K6IA 1X0XA 5A1TA 3PYMA 5G0VA 3FPLA 3LQFA 4NU6A 4LRSB 3EVNA 1K89A 4XQGA 1O6ZA 1NHGA 4RZHA 3BXXA 5C37A 2H5LA 4GPD1 3DOJA 1GCUA 2V7PA 3DBLA 4IS3A 4GKVA 2FN7A 2XAAA 5IZCA 4NFYA 3RROA 5B4UA 3KSDO 3PRJA 5ILOA 3ZWBA 1R4NA 3F47A 5CP8A 4J9VA 2HSDA 1E7QA 2YHIB 4RF2A 1CETA 2C5AA 4BNNA 3RC9A 4QXMA 1NR1A 1Y8QA 3BTVA 1DHTA 2GZ1A 2BGKA 3H65A 3TZ6A 1EUDA 3WTCA 1L1FA 3NEPX 1NP3A 1MX3A 1Z6ZA 1EE2A 4J9UE 1GADO 4DPLA 2PR2A 1OOEA 4II3A 2J3HA 2W2LD 1ENOA 1JN0A 2C5EA 1PX0A 5HWSA 3AFMA 2NV6A 1DXYA 1WAMA 2D4AA 4PLYA 2NVBA 2X7HA 4BNGA 4RVDA 3DTYA 4CQLA 3MWEB 3E6AA 1PU2A 4ZQBA 4WASA 3RC2A 4D45A 2QRKA 1GUZA 1AGNA 4EBFA 1N9GA 5KJ6A 4EYEA 3QWFA 4GKBA 3WIDA 1T2AA 2NU8A 3VZPA 4E30A 5JPIA 3L4BA 5COAA 3KV3O 1SAYA 2Z5LA 3MCVA 4NJMA 4U7WA 2D59A 2LDXA 4WCFC 1E3WB 3TZHA 5AOVA 1HTBA 4E5MA 3E5RA 1ZK2A 2UVDA 5IZ4A 4WLFA 1XU7A 5A3VA 3HDYA 3OA2A 1UH5A 5L95A 4IJVA 3GN2A 3EK2A 2JD1A 4BKUA 1UP6A 2WD8A 2ZK7A 3DFZA 1DIHA 1ISJA 1YRLA 2UUOA 3JQEA 1CWUA 4R3WA 3GEMA 2I3AA 2IZ1A 1LDMA 4WJZA 1KYQA 1TT5A 4EUFA 1QP8A 1EVJA 4B4OA 2C29D 3AY7A 3GGPA 4J91A 1U3WA 4R69A 4MJLA 1PQWA 3O26A 1DFHA 1F8GA 3K96A 3RSHA 4AJ1A 2OP1A 1LI4A 1ZBQA 4OXYA 3RBZA 1HT0A 1DLIA 4A5OA 1LQUA 3PTZA 1BHSA 4YAGA 1J6UA 2NWQA 4UUOA 3P7MA 3L0DA 5IFLA 1SMKA 4QSMA 4RJTA 2Q46A 3KLMX 4YJDA 3JV7A 5CDUA 5JDIA 2E37A 3R3SA 1EUCA 3HJAA 1ZKMA 3PYLA 2GNAA 4QFDA 1HE3A 1ADCA 2P68A 3LF1A 1NQ5A 3KXDA 3W8EA 6LDHA 1PL8A 7ADHA 2EW2A 4N5LA 3C24A 4PLZA 1IB6A 5C7LO 1PJLA 3ASUA 4J4BA 3UFXA 2J8ZA 3FNFA 3HQ4O 4WOKA 1T1RA 3ZW8A 4ZVVA 3SJUA 3FNEA 4KDEA 3S1LA 2A9FA 4ND1A 3ZWCA 1ADGA 1KC3A 1N5DA 3F1KA 4FDAA 5DBIA 4FQ8A 1VPDA 2O3QA 3GVIA 4BNKA 2YJZA 4RVHA 2IDZA 3GUCA 4NZ9A 4PG4A 3DZJA 3OJ0A 5CEEA 3GAFA 5MGBA 4ZN6A 1GUYA 4FFRA 1EBUA 3O8QA 5GY7A 4CLRB 3JSAA 3P5SA 2AQHA 3D1LA 4JIGA 4Y6RA 3JQFA 5GMOA 3V1UA 3W8FA 4UVDA 1XHLA 4D0RA 1ZZEA 3C1OA 2PH3A 4UEKA 4HFJA 2DPHA 3DEYX 1R4MA 3VPFA 2FR0A 4L73A 1D3AA 3L77A 4MP8A 3M2PA 1LU9A 2GD1O 5JAMA 2PLAA 3T7EA 4AICA 3ROKA 4RDIA 3I9NA 2OMEA 2G0TA 2XXBA 2F1KA 1Y7TA 2AEJA 1HDRA 2BH9A 2P9EA 1XCBA 4FD3A 4J0FA 4FFPA 2Q49A 4DLBA 4L76A 3WSVA 4B3IA 2FPPA 3HDQA 3L4SO 3QHAA 3W6ZA 4M54A 1ZSVA 2Z95A 3ZH2A 2VHXA 3OP4A 3R1IA 3UHAA 2C0CA 3DDNA 4QEDA 4UEOA 4I9HA 2E4AA 1CIVA 2QIOA 1Q0QA 4PLPA 1VSUA 5BSGA 4HFRA 4YVFA 4NPCA 1EZ4A 4LCEA 1YL6A 3ANNA 4J1QA 4WNCA 1YQGA 3QLJA 2BD0A 4JJIA 3RAJA 3ZNPA 2FPGA 2VWHA 2X0RA 1ZEJA 1NXQA 4A73A 3RUDA 1O5IA 5GZ1A 3NDIA 3HE3A 1ZJYA 4OJNA 4YRBA 3HNPA 2Q1SA 4NI5A 3AUSA 3RKUA 3D0OA 2HK7A 4OKIA 2ZTVA 4D44A 3WGGA 4CQMA 4P4LA 3ZNNA 4E2ZA 5CDTA 3I52A 3GQVA 4CMGA 5COBA 1UXHA 2HMUA 4LMPA 3RQSA 4L0QA 2WYVA 1RM4A 1ZK4A 1A7AA 1LLQA 5CDYA 3V2GA 4E4YA 4CMJA 3CSDA 1HF3A 3ZHZA 2VTDA 2X0IA 5AQ1A 3BHJA 1YBVA 3ENNA 1B14A 4P22A 1QG6A 3E82A 3QA9A 1VJ0A 2G76A 5TRTA 1XQ6A 1LQTA 4J6FA 1Z75A 3UVEA 3Q0EA 3HSKA 4XCVA 1EQ2A 1A4UA 1LUAA 3FHLA 3RUIA 3PHIA 3OM9A 1C1XA 5EQDA 5H82A 1PZFA 5JSFA 4R1SA 5DOVA 3SX2A 4ZJUA 4IDEA 1C0IA 4DXHA 4HKTA 5KJFA 1PS0A 1CRWG 4E2WA 4I5DA 1IOLA 4NH4A 1IULA 2BFMA 3BMCA 2PKRA 1YL5A 1ZSNA 4OIMA 4ZRNA 3ZU2A 1X7DA 4DLAA 3L9WA 2HK9A 2DBQA 1BGVA 4YT2A 4NJOA 3LU1A 1JKIA 2EHDA 4CMIA 1E1NA 2VOEA 2GSDA 2WYWA 3EUWA 1C1DA 1ADBA 4YA6A 3KYCA 5B37A 3LC2O 2JAPA 5DZSA 3V2UA 3C8MA 1P1JA 1C1DB 2GLXA 4YYZA 4DIBA 1N1EA 3KZVA 3U09A 2PWZA 1JVSA 1Y81A 5T5QA 2IZZA 1T25A 2CDBA 3A06A 1YS4A 3PJGA 4PLHA 3RU7A 1S7CA 1ISMA 1W73A 5I7VA 4U8GA 1U7HA 3ZWXA 1F17A 3TRIA 3KTDA 3FRJA 2P9GA 4GX0A 4E2YA 1PZHA 5HA5A 2AXQA 3ZHBA 1PJ2A 1HDXA 1WZEA 4M55A 1X1EA 4ZA2A 3TN7A 3E1KA 1Q7BA 4ALLA 3CE6A 3U49A 4NQZA 5I7FA 4XJTA 3GFBA 5IG2A 3UW3A 5EINA 3OA0A 3PDJA 4YT8A 5C5IA 1DIRA 3ONFA 1FDUA 2DVMA 4W9NC 1ONNA 4RF3A 4PLFA 4BNTA 4BVAA 5A5FA 3GMDA 3JQBA 4OL9A 3KOUA 1NQTA 4RVUA 4ESOA 4RPHA 2W98A 5JE8A 3U0BA 1Q1NA 1BWSA 2NVUA 3FR7A 3LDHA 4IDAA 4TRRA 3QV1A 4RVSA 5A06A 2EP5A 2IE0A 4FFOA 4ND2A 2DU8A 2QX7A 1IUKA 1UP4A 3DAGA 2PA3A 2O2YA 3OICA 3K5PA 2VUUA 3QVTA 3WS7A 2B5VA 2CFCA 3DMTC 3QE3A 4QO7A 1Z45A 3BA1A 3WMXA 3GHYA 2QW8A 4BNFA 2NADA
chains in the Genus database with same CATH superfamily
3CUKA 3Q3JB 4MRNA 4JX9A 3SAJA 4IV0A 3QPAA 4XYEA 1ZD1A 1M6WA 1N2SA 4Q3BA 1VI5A 4KDCA 2PBRA 3BX1A 4PPYA 4FR5A 2AZXA 1S2IA 1F8FA 4BCCA 5JZ9A 3PT5A 4CKCB 4W7SA 4AROA 4JSRA 1VQ1A 1Y9AA 1PNTA 1QF7A 1L6IA 2XKAA 1JFFA 1TTQB 2N1MA 3T9AA 1QVRA 4WA8A 5ARCA 4NV1A 4TS9A 3AWDA 4CV2A 1G7SA 2NT4A 3NR2A 4V0MA 5IMSA 2CK3D 1JTFA 1RT9A 1NR5A 4H27A 4YUZA 2DY1A 1AKRA 3G7SA 5FI1B 4F3RA 1GAXA 2AC7A 2ZQYA 4YMIA 1A5AB 1L4EA 5CLLA 1USIA 2FWBA 1YK0A 3T3DA 4RLSA 4HSGA 3AEKB 1CX9B 2OCGA 2C5BA 1PJZA 2Q1TA 4IIJB 2XODA 4YI5A 1CFJA 5I9TA 1H94A 2RHCA 3K0BA 4BGUA 1Y3AA 2C88A 3WNCA 4DM3A 5BWBA 1EGVB 3CBQA 3WLLA 4LVUA 2JGJA 2FK7A 3WYBA 4D8XA 4PO3X 2JCBA 1NDHA 2YY5A 4BX3A 4MUIA 4IWXA 2WAXA 4IIDA 4OSPA 2VQEB 3THWB 4BECA 4EGAA 1OX4A 2AG1A 3FMIA 5HIMA 3R7WB 1FNDA 2Z2JA 3RS7A 4AMBA 1GQ2A 1CS0B 2CMGA 1E4OA 1SCKA 3HBMA 5FTNA 1KAGA 1BW9B 1I9GA 1T1GA 2Q3BA 3IAS6 3K16A 3KKZA 3KXKA 3N87A 4X0EA 4GM0A 5AJUA 1P2UA 3O4JA 4P4GA 2AR9A 3WP1B 3FE2A 1ENZA 3V1KA 3RIGA 2VC2B 1B8VA 1XCMA 4GR9A 1ZH6A 2LPMA 4G24A 5FL7A 3A2NA 1LRKA 3V1YA 3ZD7A 4URZR 3BD9A 1VXRA 3BF7A 4MVJF 3EIOA 4XIJA 2PANA 2X1LA 3RANA 1J00A 3V5NA 3ZX4A 4BFUA 4XARA 5CU7A 2BR4A 3DEHA 1POXA 4KG7A 1TYBE 5PGMA 1DOAA 2FG6C 2CLHB 5G02A 4O4IF 4ON9A 3VZQA 3N2GB 2IYWA 3PQ5A 4IDDA 4WE3A 1RYZA 5TT1A 4C0BA 3GEDA 1CEYA 1JHUA 3L49A 3TLBA 5H4HA 3VMFA 1R0YA 1W0KD 2PZGA 4S2EA 1NXOA 2CKMA 3HA5A 3QA3E 3T3GA 4W5QA 4U2DA 3ZHRA 2WVJA 4C5AA 4X6YA 4F3CA 1RJDA 2C5FA 4RDXA 3WXBA 3DW3X 1NYTA 1Z5PA 1Z5OA 2FOLA 1U9IC 2XD4A 1JVNA 1E3DA 4E7OA 1LA2A 1FDVA 1QFZA 3ZNQA 4BKRA 2PX3A 2K2WA 4D9NA 1R8JA 2VK4A 1C7EA 1XELA 4B73A 3K20A 4PYQA 3KC2A 2G06A 3ENVA 2V5AA 2R6AA 4WGGA 3GO4A 1CFZA 4R7ZA 4I50A 2CUTA 1YFLA 3KS9A 3GLFB 4GYYA 4DN6A 4ZK6A 2WIKA 3CN7A 1UQTA 3IBCA 1D0VA 4MVCA 1SXGA 4YJHB 5T64A 4FB4A 3K1AA 1PD1A 4WOJA 5AXDA 1GTSA 1N5OX 2XGSA 5H9WA 2CV0A 4L6AA 1BXRB 3S2IA 2IP2A 3VZCA 2AOWA 2BGRA 2BRUA 5JQGB 4WVLA 2PL3A 4X7PA 4MUEA 3LLMA 3LC1O 4C4PA 4GBED 3H5AA 3DHYA 3MBKA 3J7TA 3BZBA 4GAEA 1TZKA 3L7AA 2OGUA 3CB4A 4GZMA 1FYWA 4JY7A 2DUWA 4HTFA 4JYMA 4PPNA 4RWEA 4ZVTA 5J40A 5B5SA 2HMWA 5EIHA 2CUZA 3G2KA 3JVEA 3FFTA 1BXGA 2C99A 3SXJA 4ER5A 4BEVA 3O4RA 5AI4A 3PI6A 2JGEA 2FSVC 4OOEA 4WKBA 2NZVG 1CJMA 1I2MA 1MV8A 1EDZA 3IUSA 1XJ5A 5TB5A 3H2IA 3ED5A 1YB6A 3L6RA 3OZFA 5FNVF 3PUXA 3FNBA 1JMKC 1QFSA 3WAKA 1VI2A 3TAXA 1SCUA 1GSHA 1UJCA 1VE5A 1RWXA 4DQVA 2I6GA 5I9NA 2XE7A 3FZEA 3I6BA 3AB8A 4MRRA 3OLYA 3ZLBA 3OQ1A 5ULLA 1NU8A 3PYXA 4GI2A 4EELA 5JWRA 3CLUC 1Z5NA 2CMDA 1C7ZA 2HM7A 3BZWA 4IJWA 1CCWA 2FY8A 3HU2A 3GDFA 4JT2A 2QW1A 3GAZA 3SU8A 4EY7A 3K4HA 4ZQHA 1U28A 4HNQA 1Y3BE 2XR1A 1T2VA 4ZEMA 4R9VA 2PRYA 3T7JA 3PFWO 2QQEA 4FMDB 1MO4A 4M2LA 3L6CA 1N7HA 3FMVA 4NCXA 1Y5MA 4BEBA 3ZJYA 4MYTA 3C6XA 5EP2A 2YVUA 2NUAA 2J0QA 1P1CA 2R9VA 4Q4AA 5TQVA 3GCWA 1O96B 2ZAMA 1HY3A 2Z30A 3PG5A 4FHFA 5ETJA 4YBRA 3K9LA 4GZ6A 2DE0X 4L4ZA 4Q48A 5DIFA 2GYWA 1RU3A 3EIWA 2QRQA 3HYNA 3NU1A 3F7TA 3VC3A 1WD5A 4FU0A 1RMYA 4M0LA 3UH0A 2NTYC 2HCBA 3SFTA 1P60A 3U3JA 5HCUA 4GLJA 4CKBA 1FJ2A 1WHSA 2IXBA 1CJUC 2QM0A 4IQ8A 3UIEA 1PWEA 4F8YA 3I42A 2MIIA 3KT0A 2AXNA 4NL4H 1IMJA 4OU4A 5GM2A 5CEFA 5KYWA 1EG2A 5IDYA 2AG5A 3OKFA 5JEDA 1N5MA 4L3OA 3B51X 3MTGA 4IWYA 1JPUA 3VZDA 3V4RA 3VNSA 1YXMA 3WLHA 1U7ZA 5CB4A 3R7DA 3HA7A 5KNLA 2BKVA 5AKEA 3S8YA 1L8LA 5LCXA 4YO7A 3SMVA 3TE7A 4DZZA 1KYXA 5JR3A 4EZIA 1TEZA 3RNOA 3GN1A 3V34A 1UC5B 5KZMB 4X65B 3PFCA 1HMPA 2HRBA 4ZPXA 2YY6A 5B64A 1N6RA 1YZYA 2X5NA 5DH9A 4EBBA 3KETA 3D8UA 3A3PA 2A78A 2Y4OA 5AKJA 3RBAA 1RZRD 2XVZA 1JPVA 4K6GA 2W2KA 4BQSA 2FQWA 3GLHA 4OQDA 3W3AD 3K0EA 1CLEA 1HYQA 2PNFA 2BCEA 1QH9A 3VR4H 4FWBA 4UTRA 1MCZA 1K68A 2B94A 2D13A 4PCAA 1KYWA 2V4UA 3EVBA 5CNIA 3FRIA 2EARA 3E9CA 2O07A 3SMQA 1KJNA 2WEKA 3MGKA 4PFSA 5K45A 1RHUA 1U99A 1PR9A 3ILXA 4DA0A 3OETA 5E95A 3HBFA 5GONF 1KK1A 1FMFA 1IIRA 1U7XA 2QRNA 3AKCA 4JBWA 1SD5A 3I5MA 1XDSA 4EB0A 2XWJI 4JNKA 4LSGA 3UJ7A 3RF7A 4ZJYA 3EVZA 2A1UA 3A9CA 3PD1A 4ABYA 1N6KA 3E3AA 2H85A 3E23A 2H4FA 5EAIA 5KTNA 2Q6TA 5FLKA 5T8KA 4C0SA 1WTAA 3AEKA 3N6XA 2HB6A 3GA0A 1M2OB 4RDCA 3WGLA 2LWIA 2GCPA 5JAQA 1IHYA 3G0GA 1Q7RA 1XQWA 2QHXA 2RGNA 3FIJA 2CK3A 3CO5A 4AF7A 3ES9A 4B47A 1I4TD 2M6KA 3G8DA 2EX4A 3NIWA 1AGPA 1MKYA 2GZRA 3SFVA 4R1LA 2QBYB 1DHRA 3TFWA 2AQKA 3E9NA 3HJTA 1R9JA 1YT5A 1LBEA 4PGGA 4KWCA 4Q3KA 4QTXA 3VAZA 1NBEA 2J87A 1DRVA 1XRRA 1Y1RA 3GFQA 1A98A 4RTQA 4M6WB 1OX4B 1WU8A 1JFSA 1LWNA 4O4JA 3M70A 2WJVA 2QXTA 2QD3A 1O6GA 3EZNA 4M6WA 4OL0A 5TDHA 3YASA 4FE3A 5C7IO 2V74B 1GG9A 2M9MA 4MQUA 2M6SA 4BWYA 1O6BA 2FGKA 4UU7A 3M1AA 3U7QB 4WXPA 3EQ7A 5EEGA 3OKPA 4RHCA 4UBNA 5EWJB 3GT4A 4HNRA 1YNSA 1LRLA 1WEHA 2ZQ5A 3B1ZA 3CXRA 4KI0A 4XX1A 1KDZA 3BFVA 3V3TA 2OQVA 2KJQA 2GN2A 2JA2A 2FFBA 4KH1A 3H5RA 2H8GA 4X60A 2IOQA 1SZPA 1X7WA 4DJJA 2NXCA 2V03A 4EY5A 3R5TA 4J16A 5HJ2A 4AS2A 4N76A 3QFFA 4JOCA 5G1PA 4GMHA 3OQOA 3LXMA 3IJ5A 3UAVA 1XTVA 4AS3A 5IT0A 5B4VA 1YZNA 3O1IC 1L5YA 3KR0A 5T3YA 1KI9A 1OFUX 2BM8A 3GFGA 3ZJ4A 4N5NA 2Z09A 3WAJA 1D0SA 3VPHA 1SJ9A 2Z8ZA 4AUNA 2JLXA 3QF4B 5D2CA 3KO8A 4OP1A 3L92A 3H1PA 1XTUA 1VE1A 3KTAB 1CDOA 3RV4A 4B9AA 1W85A 2GVZC 3LDGA 1NY5A 2C4MA 1Y5LA 2OGSA 3KEMA 4D42A 1OE0A 3QU7A 4EOGA 3V7YA 3TQQA 4I1YA 1AQLA 1XD9A 2K5UA 2VLBA 3PDUA 4LISA 4Q05A 4WZBB 1Y9ZA 5JAHA 1CF9A 5C34B 1I2CA 2Q29A 5HKAA 4JP5A 3L0SA 5FA8A 3BIOA 3D6NB 3PVSA 5HM8A 5KYTA 1L8AA 3HUDA 3MWJA 5HZMA 1JEYA 1QQ5A 1ZN7A 1X3LA 3PVZA 4LX8A 1VZ3A 2QJOA 3AHGA 2NUPB 3LVFO 5DBGA 3WQHA 1KOLA 3IOCA 4X91A 1YA6A 1DPFA 3LOPA 1Z6AA 3OOHA 3EYWA 5JCJA 3BFPA 1GGNA 1QHIA 1YZ3A 2OHOA 1GUBA 4DANA 1JEAA 1EGQA 4KUEA 4G4GA 1JB1A 2ANCA 3DNPA 1GRNA 3F9IA 3GBVA 4KIWA 4OH7A 5HIIA 3U4CA 1EBBA 1K5HA 1KOJA 1YH3A 5JH7B 3IBSA 4MWTA 3V1NA 3WKCA 3GMSA 2V7QA 2GUGA 1NUSA 4FYXA 4YJ2B 3T41A 4QPDA 5FPTA 2XD9A 2ZG6A 4F97A 1JLSA 3OLCX 4WLEA 2WB4A 3E3MA 1SU6A 5DYGA 4AF8A 1P74A 1X70A 2ISSD 3B48A 3ZOZA 1XN4A 1XA0A 3RUPA 2VHYA 4TLMB 4FIZA 1KE2A 2Z6AA 4ZGBA 3UT0A 5FEUA 1H8ED 1D07A 1L7NA 5G4KB 2X5JO 3NTLA 5KYUA 4MIYA 4DR5B 3GP5A 2WG0A 3OIWA 3QVLA 1U2TA 2MINB 3EGIA 4IV8A 3DMPA 5EIFA 1KE1A 1VSVA 1RQLA 1XTKA 2BUCA 2MINA 5EE5B 4WESB 2NNWB 1IAQA 4I9NA 1NW6A 3A10A 1PVDA 1HDEA 3H19A 4XEUA 1RI4A 4ZV7A 5SYAA 1WM1A 3X44A 3U6KA 3RSCA 1TXGA 1Z73A 3DFFA 5IARA 5CXSA 5B3LA 4PPQA 2ZPTX 2WKRA 4DNXA 1PLKA 1JFLA 2FMXA 4G4SP 1USUA 2B4YA 2XKBA 3BWMA 4G4IA 5E7IA 4F4HA 2P90A 5T41A 1E58A 3DMFA 2DGDA 3Q9NA 4CGZA 1M2GA 1OLUA 4GZ3A 4HWKA 3I0ZA 2L17A 1XZLA 3HLYA 1YNOA 2YMLA 1Z8DA 3W6NA 3LYUA 2RSLA 4K3UA 4DREA 1SOAA 4HPJB 3GLGA 2QJFA 3O4VA 1NFRA 1P45A 2H2FA 1C8BA 3Q88A 5DNAA 1RM3A 4QBKA 1PLLA 4TM8A 1I0IA 4A36A 5EJAA 4MS1A 4Q9AA 3CPSA 4L7VA 1TZJA 5AKIA 1IPEA 1DL5A 1PJRA 2UYGA 1BD3A 1ZUD1 1SHZA 1TMKA 1L5VA 4MS1B 4M1MA 3M4XA 3P52A 3R75A 5LU8A 1EJBA 2AZ4A 2OKGA 3JD1A 4DLYA 3R0IA 1RS0A 3UKOA 1GAQA 4KO1S 4MKRA 1Y8RB 2VDRB 3FOBA 3TZCA 5TLSA 1F38A 1U7UA 1WW8A 2Q6OA 3AUXA 4FGSA 3GX1A 4RELA 5BNWA 4V24A 3AILA 4L57A 5D1HA 3OCCA 4G5FA 3LRPA 4L3WA 4DVJA 3BTUA 3ABSB 3F5MA 3H7AA 3KB8A 1YRBA 5JROA 4CF6A 3N8DA 3O1HB 1AV7A 2D5CA 2XNDD 3BAZA 2HWYA 1LCIA 2IOYA 1FTNA 4BRWA 2O8DB 2YZMA 4DC1A 1SVWA 1JJVA 2E1PA 2JIOA 2CZCA 2YXEA 4ODIA 4C0XA 4DG5A 4Q4DA 3EIEA 1P39A 2NZWA 1QIIA 4LZZA 1XQ9A 2Q4RA 3MQ4A 1CNMA 1JX6A 1TQDA 3EXG1 1FSSA 2J3MA 1RJWA 2VL7A 2ZTLA 4AL4A 4Y2TA 4EGJA 5I9LA 1NLMA 2BBTA 5K0EA 1EDDA 4O59O 2QYSA 2DETA 2JLRA 4RUKA 4E51A 3TK1A 2PXCA 3LBFA 1PT8A 4WEQA 2QENA 3GNTA 4AUMA 2GERA 1JIQA 3ZHXA 3I9KA 3QNUA 4OLBA 2GGSA 1TNDA 2ILTA 2GZMA 4R54A 4Y6SA 4OLJA 1K98A 2IOHA 4GWGA 4OQFA 5JWHA 4DIUA 3KJFA 1AKYA 1Z26A 3PDCA 2AFRA 3R3YA 2ATVA 3F78A 4IDOA 3W2IA 3GLIB 3AESA 1Z9BA 4P1ZA 3WV4A 2P62A 4B76A 2ZSJA 1ESCA 3OD5A 4RGYA 4BVBA 5A3RA 1TTTA 2F1IA 2O2XA 4WK0B 5DDIP 5IABA 1Q17A 4MRVA 2JG3A 3TLJA 4TL6A 1HYHA 4AJIA 2YFHA 2PUDA 5FWDA 1G0NA 3OZIA 4FXOA 1S4QA 2QIPA 3C6QA 2HGZA 2K7ZA 2ZI3A 1YRYE 1D4FA 3INRA 4H4CA 5AI0A 4YCBA 3ACBA 3ZWNA 5M5BA 4ZCLA 4DR7B 1KZYC 5D01A 5BSWA 4LF8B 3LPAA 2AUTA 3FUVA 5EFOA 4DBZA 4AZSA 2RC5A 3USES 3IOYA 1T6XA 2UAGA 1GPWB 1U1GA 4RTPA 3S8EA 1ZU4A 3KTOA 3OWHA 1T4BA 3KSUA 1Z7GA 1DBPA 3P20A 5E1DA 1TJPB 2R62A 5CGQB 5HE8A 4COOA 3WBBA 1VG9B 4ZVNA 4Z0PA 3UV7A 3QXSA 4KIJA 1NE2A 3VO2A 1LRJA 1GTRA 1MZVA 3NTXA 1D1QA 4MKFA 3VDNB 5JAIA 2D1SA 2KLBA 1B6GA 1JPJA 4YAKA 1BX3A 1AN9A 3DKVA 4GQBA 4Z4QA 3H9JA 5DT2A 3AZQA 3AF2A 4HUQB 3BB1A 4IDCA 1IL0A 1A5ZA 3GCDA 1GLGA 4TVOA 4KPEC 1RCFA 3GJ4A 3L07A 1M2EA 4Y2HA 1BWRA 2DAPA 2NUTB 3LUCA 4P98A 5F1OA 2JIRA 3VZSA 4Z1OA 3IHLA 1JNXX 1Z3CA 4DLUA 4MWDA 2DH6A 3A1EA 3GVXA 3NX4A 4RBNA 1UJMA 2KI5A 4UUPA 5E4YA 3ZDXB 2WR8A 1DJQA 3LCVB 3A14A 5AKKA 5E6RB 1VBNA 2HTFA 1NBWB 3QH4A 1HLPA 1SOWA 1KH2A 4GQAA 2Y6UA 2W6IA 1RXVA 1SG6A 1S2LA 3AZPA 3DZIA 4MCJA 3HJGA 4L8LA 4U63A 1RQ2A 4DJFC 4DRZA 3ZHVA 4ZI3A 2YV3A 1CYEA 3M0EA 1X7ZA 2QVCA 3RYHB 4BATA 1DPGA 4C78A 1H66A 1Z13A 4TN1A 2PZMA 4HDAA 1M34E 2Q07A 3OQPA 3EGOA 4Q15A 3QVOA 2OZLA 4A6PA 4BRUA 3PGA1 5FPYA 4OSEA 4F46A 5JMTA 3HZOA 4XVUA 3I9FA 1HURA 4RK0A 4JP8A 1M9NA 1V7CA 2GZ2A 1GN9A 1CR4A 2PFGA 3BXZA 4ER0A 5AI6A 3CRQA 2ZZNA 4RCYA 1U5BB 3U3OA 4AM8A 4J2TA 3B38A 3LF2A 3PEVA 4MMXB 3PA6A 1DAHA 1LV8A 2Q9CA 4N5MA 4NYMR 4UU8A 4JVMA 4MVXA 1CW2B 1PR4A 4NBKA 3VAAA 1WXHA 4UU1A 4DRXB 1ZJ6A 1PJAA 2H2GA 4MYDA 4X8OA 3I8OA 5EHXA 2XQKA 1L4BA 3WB9A 2CWDA 3GLHB 3HN2A 3HYSA 1QK5A 3HNOA 3I28A 3I5YA 2PMEA 1C9NA 2XH8A 4ND7A 4NBNA 3RARA 4J4HA 1FMTA 1P2GA 3MILA 4RQBA 1TAGA 4OAPA 2XT0A 5DP2A 3ZQJA 2UYHA 4S35A 2VDNB 3A1DA 2Q3MA 2AWNA 4P7BA 4AFNA 1A9XB 2AXEA 3MOSA 3NJ8A 1MFPA 3IO5A 3IEXA 1JQDA 3WFJA 1GRVA 2IXEA 1NW8A 1UUFA 4X95A 2I7CA 4EIWA 5HJEA 2XYRA 2BZGA 3O8CA 2PUCA 3WK4A 4CEJA 3R5XA 1ORVA 2OBXA 1ODCA 4M8IA 1OGJA 1Q15A 4XLZA 3ZK9A 1HMYA 4AY3A 1H0HA 4CEJB 2BFAA 3STVA 1EAYA 2H0RA 4TV9B 5EJ7A 3CUEF 3K15A 5KU7A 3L0YA 1KVQA 3QVSA 4M22A 1S3SA 3UJ8A 4ETNA 1NONA 1XTJA 4ZO6A 1OB2A 2A5DA 3L7MA 4MR9B 3DW1X 4K88A 1K66A 1J8YF 3Q6NA 4MRSA 1MO6A 5F2EA 4DEXA 4II7A 4YRZA 4B17A 5IUJC 1QQBA 3ENZA 4N3CA 4PZZA 1SQ5A 4NENB 4PIMA 5TF4A 4C5CA 3RW9A 1CU1A 1MXHA 3HWX1 4YROA 2P9CA 2PPLA 2YVLA 2QTMA 3MQFA 5LLDA 2R5FA 1NF3A 5C51B 5A3JA 3VR4D 1XLVA 3UN1A 2FG7C 4HADA 4GXTA 4ZO9A 1ZL2A 3GPLA 5IEBA 4YP0A 4P0QB 1I51A 1T9AA 2WMOB 2DFLA 4O0LA 5AHOA 5LSAA 1NI4A 4Z9YA 3O2JA 2HOQA 5FORA 2LIVA 2BFNA 3DAYA 4KFUA 4NFLA 1G64A 1T9ZA 2QL6A 2NGRA 1EWYA 1F7VA 1CV2A 1PQUA 4KWIA 2BZ1A 5BUQA 2C7PA 4PCUA 2B8TA 3F49S 5JLAA 4ZEVA 5ICSA 1G98A 1YA8A 4O5OA 3FTFA 2OXFA 4BUJA 3FUCA 5K8IA 4WY2A 5ARDA 3P4UA 3PXCX 1MP0A 4HAWA 3ZVMA 2Q7XA 2JGNA 5F64A 5DMXA 4BCDA 2JCYA 5EZYB 1A9SA 1EE9A 3S68A 2HT6A 4K28A 3O03A 4XX0A 1XF9A 1QTNA 2A88A 1RBQA 2GJ4A 4LSWA 1QSGA 2BEJA 4XDZA 5D1NA 3SXUB 5KC9A 4K6CA 5AWFC 3UCXA 3U19A 4XX0B 3TG2A 1DT5A 4MV9A 4KNWA 4ZICA 3WGIA 1J8FA 4ES6A 2P9YA 3BMNB 2ODNA 3ZC3A 5JY6A 1KEVA 1AHNA 2GH1A 3EBOA 3RB8A 5BP7A 1SVLA 2XSZA 4M1OA 5FWYA 3LLUA 2BGJA 1U0RA 4X7MA 5SV2A 1EFLA 3IH5A 3LW8A 3W5AA 1MO5A 3LTNC 1U1FA 5KKAA 1C3JA 3B9RA 4DEVA 4LGCA 1P1BA 4WW0A 5A03A 5L9AA 2OEPA 3G0HA 4D5EA 1NMYA 4H3SA 1Q19A 1X14A 2AJCA 3GG9A 1O9HA 1ONSA 5AHWA 4TXLA 5FOWA 4UDNA 2M1XA 3DR5A 5BMVA 1TE2A 2PS3A 4FCCA 4FGUA 4OJYA 3WSTA 4CJXA 5HQ3A 1UDAA 1V5FA 2I3ZA 3FM9A 3JZMA 4DCVA 1TPYA 1MENA 4GU5A 4GQIA 1OZFA 4C7XA 2K7FA 4DLRA 5A5GA 1RW4A 1EIWA 1IC6A 3VOSA 3DDZX 2SICE 3VTFA 5I8PA 1CR6A 1LW7A 3BFXA 5K3SA 1TYZA 1XCLA 3ABRB 2ZTUA 5JCXA 1KRHA 3JQRA 1KI7A 1BXKA 2HIMA 2NO6A 1XYVA 3HKCA 2ADFA 2BLNA 3DEFA 1U31A 5AO9A 2P9BA 2PJRA 3KOMA 4C7JA 3I4LA 2DUMA 1H8HD 1R4ZA 3DE5X 1S8FA 3C15C 3TEFA 1M6HA 2R4TA 3NHZA 1WG8A 3NHMA 2ZJ2A 3O1JC 3EXG2 1Y80A 2R7LA 4GGOA 1E89A 4UM7A 1Z5UA 1TM7E 4HVTA 1QAQA 4EHLA 1KNXA 3DZFA 2H8KA 2ZBFA 1YAJA 4QVKA 3K4QA 3CCCA 3S2EA 3IAHA 4FIDA 9MHTA 1X9HA 1R1DA 2FPXA 1H9BA 1M2VA 4ZKDA 7ABPA 1BEEA 1RLJA 4YRPA 4NDNE 3PFIA 2PCLA 5JW6A 5LQAA 1MFZA 2HPAA 1YR2A 1B2LA 2ZRBA 3HCFA 3JR7A 1GL6A 3OJCA 5K3OA 3RC3A 2VPPA 3I53A 3ZZ0A 1H69A 4XWOA 1WA5A 3EPKA 2D3WA 2EX1A 1J0EA 1SIOA 4FCWA 4TLDA 1WDLA 1FDRA 2QVXX 3HRKA 3INGA 2X9NA 1GDDA 4RMGA 4EEZA 1QBGA 4DQLA 5L3SB 4WDQA 3TCNA 4AUKA 5J23A 3ITDA 4KSYA 3RJZA 2I66A 3C2QA 4L4YA 4JUDX 3ABQB 3KKNA 2CJXA 3AHIA 5ALPA 1JDPA 3GRVA 4B4KA 1PW7A 1HYBA 2A59A 5FI0B 4D4JA 1KXJA 1UPUA 4AZTA 3G2QA 4K81B 4RK5A 3IT0A 3JZDA 2R97A 4BEWA 4GXNA 3OPXA 3PHHA 3ZWKA 1JJIA 2VYFA 1Y8ZA 1F0YA 3AIKA 3IOMA 4JQCA 5EWLB 2Q99A 3RHSA 2ONYA 4ZOLF 1CT9A 1HYGA 2BBOA 3PGLA 3FTDA 1ZR2A 4BLQA 4UE3S 2P4SA 3TUJC 1FUIA 4L2IB 3SIPA 2ZSDA 1CIPA 3A9RA 3EDRA 1XPRA 2VAPA 1PNQA 2RGUA 4DA9A 2GDJA 1YO6A 2Z2XA 4C06A 4EA9A 5JXHA 1RI3A 2C4NA 2Q3CA 3DTVD 3WNZA 2OK8A 5CM8B 2WE7A 4MW5A 5LZ7A 1KO4A 2JFOA 4DWJA 2HD4A 4WCDA 5KAMA 4MX8A 3X2FA 3KJGA 1S6YA 4PW0A 3NKVA 1TD9A 4WZBE 5CMLA 2O5RA 3UZUA 3K2IA 4NC9A 3BKXA 3JQAD 4OYLA 3IBYA 3T5MA 1T6BY 2QM7A 3DBRA 3R0QA 4TGLA 3WA6A 7REQB 1L5QA 3TTTA 4YFYA 3K30A 1QZTA 3H4TA 3HDTA 1A2KC 3KYCB 1IH8A 2Q9BA 4DPKA 4KLRA 2CXRA 2VP6A 3CXUA 5ILGA 4LV5B 3I5XA 5DOZA 3AVUA 2C1XA 2FPWA 4PYMA 3SNKA 1EWKA 4E5UA 4ROSA 2Y71A 1Z88A 2C57A 1BHJA 1DG3A 1R88A 2GTPA 4LQ4A 4RKEA 2IVZA 2W2KB 3WGQA 5C8YB 2I4LA 4N5HX 1M7BA 1U5CA 4FEGA 4J4TA 4MHSA 2Y77A 4RTSA 2C7RA 2D6FA 1F5SA 3OECA 1Y9EA 2CNDA 2FJPA 3BUSA 3GY0A 1K4KA 2WMNB 3WDSA 4AT1A 1DCMA 3ANLA 2OXTA 4CODB 4EPWA 4YV1A 5L3VA 2BTQB 3E48A 4KFRA 1PG2A 1VMKA 4HQ0A 3GARA 3WKEA 2PX6A 1ZGJA 4X20A 4DPMA 4Z7JA 3L4KA 3ZWAA 5LYYA 2O8VA 3A27A 1RWQA 1OBHA 1SULA 1NL3A 1UQRA 2XWSA 2R2AA 4NU5A 2OYCA 1N32B 3ZCVA 1RAIA 2WOOA 1H2AS 2D2EA 1DC6A 1XGKA 1CJCA 3LX4A 5IAAA 1SIBE 4YCAA 5KVCA 1C0PA 3UUWA 3K0AB 3W9YA 2QT9A 1G60A 4OLAA 3D0RA 2O0KA 1P7VA 2G07A 4HFMA 5IF9A 2NQ8A 4I4NA 4MRMA 1PGPA 2F64A 3C6MA 5FPSA 4CF7A 1NTOA 2W0SA 4Y0NA 2ZXEA 2OC4A 5KOHA 3VGPA 4D0SA 2B6NA 3U1BA 2H3EA 1ZU5A 3F8TA 5FBVB 5BMOA 4UUMA 2AMJA 4E03A 2H1RA 1F4VA 5J63A 4HZGA 3RS4A 4C6SA 2AJLI 5BXYA 3GPCA 4MDEA 1D2MA 3PI7A 2PS0A 1GPJA 1FIUA 4EHKA 3HUUA 2OFPA 2BP7A 1SVIA 2A9QA 4JK3A 4J3JA 1XD8A 2NQ2C 2I6XA 1ZGHA 2KS6A 2VPWA 1RP1A 2A1IA 5BORA 3ZY4A 3CVOA 5F2KA 1T8SA 4LJ8A 4PZ0A 4JLPA 1L4GA 4IJQA 2V97A 2VSNA 5H80A 4CM7A 1OAAA 4KO8A 4Y9TA 4RLHA 3UMBA 1TUBB 2AN1A 4IINA 3AM5A 4CEHB 1Z29A 4ITRC 2VQFB 4FYJA 3VYTB 2P9JA 1W9MA 1ZNXA 1Q21A 4MV1A 2CNNA 3ZTWA 2CHUA 2FMHA 5LB4A 4CCAA 6ADHA 3TOCA 3FDZB 1WTCA 1N2JA 3FVTA 2ZXUA 5J59A 2NYVA 2X9GA 3MTEA 2DLNA 1A9PA 2HIGA 3DH0A 3N7UA 2QQFA 5C3UA 2C5SA 4WK2B 3NHYA 4B2IA 1N0HA 4A0QA 2B34A 1N57A 1YR3A 4U7HA 1LLUA 2J4DA 4ZI7A 2CFIA 2GN4A 1E3QA 1GUAA 4MPTA 2GEUA 1F1JA 2LRHA 2ZIXA 3G3EA 2YJ3A 3IPYA 4MV7A 4RY9A 3NWJA 4GC9A 1Y4UA 4YLEA 4DG9A 4JP3A 4LSMA 4EPVA 5IH3A 4JLBA 4G4JA 4N12A 2IYTA 4B4DA 1Z2DA 1RAAA 4GZLA 1QS0B 3WRWA 3THYB 3EWSA 2C04A 2K6GA 3R8FA 1U4SA 1Q83A 3MN1A 1CUXA 2Z2IA 1WZIA 2XWQA 3QUSA 2ZEJA 3AEYA 3HU1A 3UMJA 3IESA 4MTLA 4LE0A 4AJ2A 1X6VA 4IDGA 4Q3EA 2Q4DA 4J3FA 4LQDA 4R1MA 3ESZA 1A0OA 4JH0A 1QO0D 5F78A 3C5WP 1ILWA 3VYVA 3DM5A 4DMFA 3ZTTA 2IKSA 1AUVA 4EGFA 2XKJE 1BDJA 1DAIA 1XEWX 4LYYA 2VCEA 3TSCA 1KYZA 2QTGA 4V39A 1OFIA 4UPEA 1NQXA 2R8YA 5GM1A 3RRBA 2I8LA 1HV8A 5CB4F 4TTQA 2AG8A 2R5NA 4M89A 3FTCA 3AP2A 3NHWA 2Z6VA 3D8BA 4XI9A 3M5PA 1YACA 1YHYA 1QH1B 1H85A 4P2BA 3NT2A 3CA8A 3GLVA 1NZJA 4PZPA 3VPDA 2G40A 1E94E 3VNUA 5BSVA 4MZXA 2ZUEA 1NGSA 3D4BA 3DE1X 1K3TA 5KX5B 4NK4A 2DC1A 3KM0A 4OYYA 3Q9SA 5JSKA 1DARA 5HKKA 1E1RA 4MA5A 3KSZO 3WB2A 3QQPA 2GBPA 1N5RA 4P32A 5ECYA 5AW5A 1B0UA 3VOAA 5JRDS 4O6VA 4UVEA 3V80A 4XWYA 1U2QA 2GOYA 4GPZA 2Z57A 2Y6VA 3PLNA 4Q3CA 1QORA 5CIYA 4V0SA 5JFOA 2GR9A 2AZTA 3PHCA 3KG2A 3IULA 1HQKA 5BWCA 1TKRA 2GBFA 3D6MA 5JBIA 5JADA 5LQJA 3JQ6A 1E79A 4KXFB 4NZZA 3LE8A 2C9BA 3QKTA 2R44A 4MIEA 5I5GA 4W9NA 3V2HA 1W1IA 2P35A 2QN7A 3KAJA 4BXOB 4ETWA 1C4KA 1W19A 2BM9A 5GGYA 1V9CA 2Q1YA 3X3HA 1HYEA 3KQHA 1LDBA 2P2DA 2NTVA 4JR0A 4X61A 4YXWD 4X1IA 3EY9A 3NUQA 4PX2A 4A6EA 4OHYA 2P2GA 3V8NA 3BHNA 3CF6R 2BW0A 2EKLA 1VIDA 3USZA 1K88A 3FHCB 1DQPA 3U1TA 3F2IA 2C82A 4BLWA 3OKAA 4A0RA 2UVPA 3I9JA 1BXGB 4MPPA 4NH0A 5HUHA 1D1PA 2EBFX 1LNQA 1KY4A 5F1PA 2JD0A 2XB8A 1DOZA 4BMXA 5CJPA 1IY8A 2AIRA 2TMGA 1E1LA 1VXOA 2JZNA 2ST1A 3R0JA 2WOJA 3QPUA 4ZZIA 1E4VA 3HV2A 4XJVA 2B8EA 4BBAA 4LHEA 3GRCA 3KAPA 1PL0A 1UOOA 1LF0A 2F48A 5B3JA 4BMOB 3UV6A 3QBJA 5T3UA 2FETA 4NAVA 4US2R 3KJEA 1K8XB 7AT1A 1XAJA 2XUAA 4F0JA 1I1NA 4D9HA 4EEKA 3DMRA 1N1DA 1E3SA 2O2IA 1VE9A 3NBZC 1KEEB 2P8JA 3C3XA 4G63A 2EJVA 1E8DA 2X58A 1VLLA 2ZRHA 1BVRA 4JKYA 3UWKA 4YAWA 4URFA 1F6BA 3ZOKA 1XZCA 4MW6A 3JQCA 2F62A 1EK6A 1XVTA 5C8DA 1HE1C 1NX9A 1QC5A 4JJEA 4KQ2A 3SXPA 2GPBA 1UT6A 3SN6A 3QOFA 4W1RA 3JTMA 4FYVA 5K4HA 2P2NA 3BXOA 3DUWA 3NCHA 2EG9A 2LNDA 2R1VA 4J75A 5G0WA 2GHIA 2PUGA 5IMBA 1P19A 1T26A 1L3IA 2YS6A 3A1NA 3DBVO 1OZGA 2VUHB 1WPXA 2F4NA 5LDGA 4CMEC 3UCEA 1CR1A 5FA6A 1M73E 2NZXA 5JS7A 4DIMA 1NBOA 3AKEA 4TRMA 2BGLA 3I58A 4JVSB 4CBVA 4CKXA 2WJPA 3PKZA 1F20A 3S3TA 5THQA 5LM3A 3K1TA 1NIJA 3HKCB 1SQSA 2AWOA 4FZRA 1U2DC 2ZUDA 3H2YA 2FRXA 4RZIA 1QGAA 1EXDA 5KYXB 2P78A 4IO0A 1QGZA 3O9VA 4JSYA 4P7GA 3H1AA 5BYKA 3LLSA 4O2RA 4RH3A 3K70D 4IH1A 1PJ3A 2EF0A 3HR4A 4NZOA 3J81A 1MRNA 1Z4LA 1DKLA 2ZJ6A 3OZ7A 4QLOA 3DEJA 4KX5A 4KN5A 2D1FA 3CW2A 2BHNA 3QWBA 4QRHA 5J2TF 3TDNA 2XB2A 5EPOA 2ET6A 1GU7A 4IPTA 1NW9B 3TRDA 2IIBA 5COQA 4F4JA 4J49A 3BVPA 5IM5A 2VAWA 2I4OA 4DMLA 3PUYA 4MMZB 2W71A 2HSZA 5A0TA 1F8UA 4YDSA 5C8XA 2XMDA 3LXRA 2A5JA 3MWFA 4TZKA 4I3HA 3WLIA 5KWSA 2QSJA 5GIPE 3HJNA 4FFVA 5KJCA 4IV5A 4E22A 1X8XA 2GZHA 4UUNA 1FUUA 1W5SA 1XVUA 2RGWA 1KVTA 3ORQA 1L3CA 5A9SA 2ZRAA 3RI3A 2UXCB 2O8FA 2YTZA 5TQ0A 1ZH2A 3IMGA 4DT1B 2FW9A 2ZZKA 4XIGS 4YRCA 5LB2A 4XPIB 1QOQB 3AY3A 4IVRA 4RTKA 4OYRA 1PZMA 1FF9A 3RC8A 2PBFA 3ZE2B 4GMDA 4DNPA 4FI3F 4RMJA 1KIFA 3QEBZ 5CLFA 2W6JA 3GW8A 4RHXA 4Y6QA 1MIHA 1NX6A 2DECA 2IOFK 3NG1A 4XWAA 1WCYA 4CKZA 5K6RA 5DISB 3FIUA 1EFTA 2AX4A 2PZFA 3LGXA 2R4UA 3LYLA 3NGXA 4Y2JA 3PXGA 3R7AA 4MARA 4YH1A 3ZHQA 5TMPA 3GRZA 2FEPA 2HN9A 4NENA 1EUZA 2FWNA 1Z6TA 1PWXA 4K6OA 3LHKA 1VFPA 3C3AA 3N0VA 4JODA 3W04A 4PIVA 2Y2UA 4MV8A 1AD2A 4MUKA 3LKDA 4WV3A 3UB2A 1F6DA 2OE2A 1PFWA 4FR2A 3QXJA 5FAKA 1SXJA 1X1DA 3K9QO 4RIGA 221PA 1ATZA 1X7ZB 3RYHA 4WXMA 2AMLA 1SBTA 1SXJB 2WT4A 4Q47A 4QPCA 2D1TA 2OB1A 4B3GA 1DQRA 4XQ0A 5KI6A 4EW1A 1Y6RA 1M74A 1AF4A 2C4WA 3P0EA 4L8GA 2INGX 1CS0A 1KXZA 5EJ5A 4DCTA 5IKMA 4YRIA 1FNNA 3WYFA 4C89A 2C2OA 2D5AA 1G63A 3ESXA 4Q1EA 4Y1RA 2BV3A 5F77A 4A0FA 4QULA 4ESEA 2C4UA 1T5BA 2Y1OA 2AKYA 2OQRA 1Y7IA 2AMFA 2G80A 2GXAA 4RZQA 5EZYF 1IJBA 1IAVA 1AHPA 3V33A 2X6QA 1L5WA 5JMWA 1M75A 4N65A 2OENG 3K7EA 3KJZA 2P0EA 2JLYA 1C9YA 1E1QD 3K9WA 3TTYA 4WVFA 2C59A 2ZIUB 5BWMA 4GSLA 3ETCA 2FPGB 3L8EA 5TS3A 4MQ6A 2O4UX 4FEYA 4BC0A 5LD2B 3NC4A 1Z39A 2JW5A 2XOEA 2Y9PB 5ECWA 1QHGA 3H0EA 3H2GA 1GWNA 3WY9A 3NFYA 3O4GA 1P7PA 4I1UA 4N54A 2WD9A 3G9UA 3WJ2A 4X20B 1G2PA 1UBFA 4RIHA 2WICA 4CT5A 5ALEA 3S2YA 3UW1A 5ENZA 1YTLA 4G1VA 1U8TA 1CUDA 3BGIA 1MPXA 4U2GA 3SC6A 1JILA 3WLEA 16PKA 3D3KA 2ZJ5A 5F7ZA 4F8EA 1BIFA 5IYZB 2R0QC 2GEJA 4XQ9A 4N6NA 4BZPA 3OQIB 4ZYVA 3LP8A 4WSOA 1RWWA 3QOWA 4P82A 1YS6A 2DR2A 4GPIB 1JHDA 1YOVB 2NYUA 4WZBA 4HLCA 3Q6MA 2O5EA 1AZTA 1ZUIA 1JLHA 1UADA 4I5EA 2O50A 4MITA 1PJTA 2C96A 3PENA 1C0EA 2ZWVA 1GOTA 1SKUA 2CB0A 3BE5A 2WM8A 2X0KA 3DBLB 3JARB 4GBJA 2GZ3A 1E2IA 3JWPA 3SP1A 4CUZA 3JQ9A 3B8EA 3PTLA 1QVZA 3R24A 4HJRA 3R0VA 4M1EA 1QWSA 2YZGA 3ONWA 3DPUA 2QX4A 2VDVE 1ZA1A 1UFRA 3CKMA 3K1AB 3JD0A 4FX5A 4UATA 2I4RA 4O5AA 1P1KA 3TQSA 4EMUA 3K8OE 1D7OA 2Z83A 2I0FA 1ADFA 4LG1A 3K0KA 5CVUA 5DHQA 1QNFA 3V3KA 3OJLA