1SOKA

Crystal structure of the transthyretin mutant a108y/l110e solved in space group p21212
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
116
structure length
116
Chain Sequence
b'CPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIYAELSPYSYSTTAVVTNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transthyretin
publication title The beta-strand D of transthyretin trapped in two discrete conformations
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 23
structure length 116
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 1sokA00
1E5AA 3IMRA 3DK0A 3M1OA 4PMEA 3GRBA 5AYTA 5L4FA 4TLSA 4PWGA 4ANKA 4I89A 2QGDA 3ESPA 2F7IA 5E4AA 3DK2A 4ABUA 1U21A 2FBRA 3CN4A 1SOQA 5CNHA 5IHHA 4TLUA 4HISA 4IKIA 4MRBA 2WQAA 4N85A 4YDMA 5L4JA 1ETB1 5E23A 4IKLA 3CN0A 1TTBA 4TQHA 2H0FA 3NEEA 3IMVA 3IMWA 4QYAA 5FO2A 1E4HA 1TZ8A 3P3SA 4HJUA 4TKWA 3I9IA 5EN3A 2B9AA 1GKEA 1DVUA 1IIKA 1ZD6A 4MASA 2GABA 3IWUA 4ABWA 1DVTA 4DESA 2G3ZA 2H6UA 3DJRA 2G4GA 2H1XA 1SN0A 3TFBA 1THAA 2IGLA 4DEWA 1ICTA 4TNEA 1BZ8A 2TRYA 4ACTA 4PVMA 3IPBA 1G1OA 3CN2A 1DVSA 4DETA 1TFPA 3P3RA 3NESA 1IIIA 1SN2A 3P3UA 3GS7A 5JIMA 4WNSA 4TM9A 3CXFA 1THCA 3CN1A 4PVLA 3CN3A 5FW6A 3DJZA 5CLYA 4TLKA 2B14A 3CBRA 1TT6A 4TLTA 3GS0A 2G9KA 3I9PA 4FI7A 4Y9EA 2G5UA 3D7PA 3I9AA 4TQIA 1FH2A 3GPSA 2QPFA 2TRHA 2B15A 4PWIA 1TSHA 4QXVA 3BT0A 4PVNA 3P3TA 4MRCA 1IJNA 1SN5A 3A4FA 4WNJA 5CN3A 3A4EA 1BZDA 3IMSA 5CM1A 5L4MA 1TTAA 4IKKA 3Q1EA 3CFTA 3A4DA 4QRFA 5AL8A 1TLMA 5K1NA 5A6IA 2G4EA 2G3XA 3DIDA 2FLMA 1IE4A 1X7SA 3CFMA 3IPEA 1F86A 4PWJA 4Y9CA 3W3BA 5EZPA 2H0EA 3DGDA 3ESOA 4TNFA 5CLZA 5FW7A 3ESNA 2GPZA 5E4OA 4AC2A 5CR1A 4KY2A 5FW8A 2F8IA 2ROYA 2NOYA 4L1SA 5JIQA 3B56A 1RLBA 3KGTA 4PMFA 1TYRA 3GS4A 3IMUA 4IIZA 5AKTA 4TQ8A 2G2NA 1FHNA 5AL0A 2G2PA 4I87A 1BMZA 4N86A 3DJSA 3DJTA 3HJ0A 5BOJA 3GLZA 1DVXA 5CLXA 3OZLA 2QGCA 3OZKA 4ABVA 1KGJA 4TQPA 2QGEA 2ROXA 2PABA 3NG5A 4HJTA 3CFQA 3IMTA 4PM1A 3D2TA 2H0JA 3FCBA 4TNGA 5AKSA 3FC8A 4IK7A 1BM7A 4WO0A 5JIDA 4PWEA 4IK6A 4Y9BA 2QGBA 4Y9GA 4DEUA 5DWPA 1ZCRA 5DEJA 3IWVA 3DO4A 5HJGA 3BSZA 5L4IA 3QVAA 3GRGA 4IKJA 4Y9FA 1DVZA 1QABA 1Y1DA 1F41A 4N87A 5TTRA 3SSGA 4ABQA 4D7BA 2B16A 4PWFA 2QELA 1X7TA 4HIQA 2H4EA 1DVYA 1TTCA 3CFNA 3KGSA 3KGUA 4YDNA 5AKVA 4Q14A 1DVQA 3U2JA 3TCTA 1ETA1 1E3FA 4AC4A 4FI8A 5K1JA 3U2IA 4DERA 1KGIA 1GKOA 1OO2A 1Z7JA 2B77A 4HJSA 4I85A 4PWHA 4PWKA 1TTRA 3NEOA 4TL5A 1QWHA 1SOKA 3NEXA 4TL4A 1BZEA 4FI6A 4L1TA
chains in the Genus database with same CATH superfamily
1GS6X 3PP3H 3NGBC 1W8EA 3TVMD 2R0LH 1U8NA 2FT7A 2Y23A 5B1JC 1TEYA 2NY2B 1DUZB 1YYML 4GMSL 2BO0A 3QZWB 2OR8A 3HI6L 5GJSL 4J8RA 5HDBB 3BKMH 2WQAA 3BWAA 4H8WC 4UNUA 4M3HA 5TDOA 4LGSB 3EUUA 4BCZA 2H0FA 1JZ5A 3M8OL 5CEXB 3QJTB 2BSEA 3P4MA 1OGAB 1JNNL 1A6PA 4OZFH 3AQZA 4H26B 4DGYH 2VT0A 3QUZA 4R90L 1CQYA 1X5FA 2DQFA 2ZONA 4IRZL 5JQ6L 3FB5A 5BJTA 1UQSA 4K5LA 1SOSA 1QRNA 1WK0A 5IHUH 1HJCA 1XGTA 1HIMH 1LM8V 2NW3A 5I18L 1TT6A 3NMEA 4JDVA 4JM2B 3SE4A 4DCQB 3TTYA 5HXMA 3IGLA 1BQHA 5FHAL 1Y0LA 3EIFA 2FX9H 3U7WL 4DSYA 4S1RH 3OKDA 3A4EA 4XPBL 2PCPB 4NAQA 4UAHA 4PRPB 5F1NB 1KTDB 4YPGA 1A14L 2FGWL 4R7NA 2Y5TA 2FJHA 1IGTB 3MNZB 1OW0A 3Q06A 2YPLA 2YRLA 4WUUE 4N8CH 3F7VA 4Y9CA 3FULA 3INOA 4FLOA 5C0DB 4I2XE 1OAQL 1U41A 2P80A 4XMZA 3SE4C 1YNTB 1AJ7H 3T71A 1IEHA 3V4LA 1JRHI 3GK8H 1L6ZA 4LNRA 2PWHA 2R0ZL 1LE5B 1G94A 3LQZA 4FTDA 4LIQE 4OZIA 3VFVA 3O11A 1P0SE 4HGKC 3EH1A 1JI2A 1ZLWK 4F7PB 3ZQ9A 2XKNB 4ABVA 5B39A 2HRLA 2QSTA 1XF4B 2FJFB 1EHXA 4ZRGA 4PJXB 5K69A 5CCGE 1A2YA 4U6TA 1YEIL 1K8DA 2HJLB 5EFIB 1LQSR 4CJ1A 1DQKA 4JY5L 3BN9D 1J0IA 1FLTX 2EDXA 3H4FA 3GNMH 2LAAA 4R5VA 2CD0A 3HE6D 3HVDA 4GBXA 2PPAA 4LCCC 4UM8A 4NO3B 4MS8D 2LVCA 3L3GA 4JHWL 1VA9A 4QTIL 5L2KD 5SWSA 2MKLC 7TAAA 3QYNA 1QPPA 3KVDD 4HA1A 2HVJA 1MCOH 3EGDA 2QFPA 3DIVA 4DEPB 3ALXA 8PAZA 2H3NB 3O45A 4GKOA 4H13C 3VFTB 3PQYA 1DN0B 2HN7B 4OFYD 5IV2A 2I85A 2NY6D 4C83B 3HNSH 1H8SA 4L4VB 4S10A 5JW5B 5KANG 3H6AA 3TIEB 3K2MC 3L8QA 4YWGH 2DKSA 1WAPA 3VXRE 3JWNC 1M7DA 3HMWH 3BPNB 3NRFA 3X13A 1ANUA 3Q5YA 4BYHA 3MA9H 4MJIA 4OLUH 5DRWB 2BIIA 1UEMA 3IWUA 1DEEA 4URKA 1OF0A 5L2KE 4LO9A 2OA9A 2KERA 3ZSTA 3FQWA 1RZFL 5I1GH 4MJ2A 5IHLB 3NN8B 3T1FA 4GI9A 5CMAA 3FRUB 1SYSA 4Z7VA 4GS7C 2YAPA 5I5RA 3DURA 4LLAA 3HCVA 1JZ6A 4UTCA 5DLML 5DJCB 4NCDA 4NCC1 5AZEH 1B2WH 4YSAA 1QATA 1NCCH 1II4E 5H37A 1E4XH 4Z7OB 1EHKB 1P6AB 3EHBD 4MRCA 3WHXA 2UWEB 1HHIA 4R7DB 5CGBA 1XZWA 3BD3A 1NDMB 1K5NA 1BZDA 2JB6B 1UT9A 3IDGA 5B21A 3EGXA 1R19A 2VZTA 1EXGA 3UG4A 4AMXA 3VG0H 3F04A 1PQZA 1SDYA 4V1DA 1CGYA 1UB5A 2WXLA 5IJDC 1F6FB 1OF2A 3QUXD 1OK8A 3L9RA 3Q05A 25C8L 3VFGH 2PKDA 4G9FB 4OM1H 4HUWA 2MCPL 2ZICA 3HC3H 1JV5B 2OJZH 5C0EA 3NCJH 4U7MA 4XVOA 2IQ9H 3ZHKA 4LLDA 4ZFGH 2X10A 4JCLA 2XZCH 4ANWA 3LN4A 5GSRA 3O2DL 5KBPA 2J5LB 4TQ8A 1ZTXL 4YHOH 4CVUA 3WCYA 1D7FA 4NPYB 2CK0L 4PRDB 4EPSA 2CBMA 2C5DC 1RLWA 2CRMA 2RCSL 3QDGB 2HLAA 4R2GC 3AREB 4ZAKB 3S88H 4PRBA 4UT9A 4FQ1L 1KTLB 1FNAA 2VL5B 1WCBA 2KLSA 4ODUB 1T04A 4J3OF 1A0QL 1QBBA 4MMXA 3TO4A 2F74B 2YAEA 3EYVB 1FGNH 1TTUA 3GMQA 3NP3A 5F7NC 1NBZA 2ZXAA 3BW9A 1YNLH 4RWHA 3Q5TA 2DTMH 3NIFB 5AOKA 4DGWC 1LYQA 5C08B 1IL1B 3ULAB 1EXHA 3LRGA 4K7PY 4HJJL 4X6DF 4B97A 4I0PC 4TUKH 5KUKA 2PYED 1H9VA 4FF9A 1NC2B 3AS0A 2VZ3A 3CVIL 4FFVD 4AJVA 5F6IB 1S7TB 3MJ9H 5L9DH 2F53B 3WTXA 3D9AL 4OZFG 3H3BC 5F7LB 1HILA 4JO1H 5IB4A 5GZOA 2XNAA 2HKFL 3HFFA 3S4SB 3O41B 2BP8B 3C6LB 4PS4L 4PV9A 3TO4C 1KYOK 3PWPD 4AL8C 2V3EA 1JWSB 1AO7D 3MBEA 5C09A 4OLZH 4GQZA 3LIZL 1UD8A 4N2CA 3IJ8A 2P5PA 4DOHB 1TIUA 2EDOA 2AEQH 2PTTA 4RFOL 3RL2A 5GRWA 3X12B 4JFXA 3VI3E 5DS1A 4P9ML 3QUHA 4UOJA 5EF1A 3WJMA 2XZAL 1D7DA 2PYEE 2UYLA 1X7QA 4JKNA 2F5BH 1FL3B 5CGTA 5DMGC 3F00A 2XDHA 1SJHB 2ZUVA 4YDJB 2RR3A 1BF8A 4UQ2B 3L45A 3HNVH 2FX7H 2WXPA 1RVFH 3PWPE 2ATPA 1RHFA 2NSXA 3CSYB 4U3SA 3OBAA 3B83A 3QJRB 4UIKH 3JYBA 3I9PA 1DVFB 3WFEH 5FYLH 1GS7A 1I3VA 1AGBA 4JFTA 3DHJA 3WG7B 4PLNC 1KWGA 1I1YA 4HPHA 1CFBA 5TF1L 2W92A 1NM4A 3RWGA 1A4KA 1I4FA 2C3XA 3VRLF 3D3VD 4QY8B 1WD8A 3GLDA 4EKXA 4HIXL 1NOAA 2FLMA 3MV9B 2G5BB 4K23L 3DYOA 4J3OC 4R4ND 3WTYA 3WHE1 4DW2L 4DPBX 3NZ8A 3DRQB 4JY4A 2N0KA 4RGMC 3RUGA 1UM6H 2V5TA 3UCQA 2XY1A 4ZUUA 1M3JA 3A67H 5DHXB 3L3KB 3K2UL 4QXTB 3LV3A 5DQDH 1CXIA 5TD4A 7FABL 2JH2A 1ONQB 1TPXC 3CHXA 1QSEB 5FFGA 2HFTA 4GW4B 2VDNB 4ANUA 1TJHL 3B7TA 4BSVB 4NZUL 3D3VE 5IMOA 4ZX6A 2AQSA 4UI2A 5D4IA 2FO8A 3OKYA 4X80H 4ELMB 1U42A 1OP4A 4W4OC 4GAJH 2GY7B 4NHUA 1ZEAH 3PUCA 1LO5A 2AXFA 3MVSA 3UO1H 5JNYB 1KB5B 1UZGA 1RU9H 1F6AA 5HGHB 3KW8A 1P7QD 1QTPA 3LKOA 1A3RH 3QS2A 5L4IA 4NHCH 5MENA 4NC0B 2BY0A 5CKGA 4MHHG 3TWCH 5HHQA 5CBAB 1K6QL 2HB0A 4N2FA 1ZLWH 4JVPA 1RZ7L 2OPCA 4OF6A 3OKOA 4IGBD 1GA2A 5AEAA 5BMFH 1GKOA 4JQXC 4W9KC 4LSPL 4QI3A 5D2NC 3N5AA 5TF0A 4WHTB 1RFDH 5EZOL 1H3UA 4NWUL 4NJAH 1GZHC 3TPKA 4LAQH 2KYIA 4HIEB 4TSCL 3UZQA 4UIMA 3BKCL 1JFQL 5ESQB 2GJ6D 3FFCD 3TX4A 3CDGB 3CSTA 1HDMA 5IUSA 2NY5H 2PUQT 5D7JA 5FGCE 1PG7L 3X1BA 4B7IA 1Z9MA 4LLWA 4PUBL 5EZIL 5G2NA 5BZDA 4WKXA 2PCXA 4OCMC 1TQCB 1G4RA 4OZHF 1XGUA 2GI7A 4ANXA 3WN5B 2A73A 2FH8A 3D39D 3FQTA 4P4KA 1MFAH 1JXJA 1K3IA 4JMNA 1HKFA 3SJVA 1XMEB 1N2RB 4GSRA 2AK4D 3LKQB 1IGCL 2DQIH 2L4OA 3WTUA 4HD5A 1H5BA 4A6YH 1UT1A 4P4RA 1AGCA 3INUH 4KK5D 3DOSA 4KO9A 1NC4B 1YNKH 2GJ6E 3O6FA 2OMUB 3QJFB 4EEEA 1H3PH 3B6SA 5ICZA 2FVNA 4JRXB 1FNSL 3FQRB 3SGKC 1A64A 3TZVA 3VFSB 5ABDE 5DMKB 3UPRA 1T03L 2JK5B 4Z3EA 2D03H 3UTSB 4EDXA 4K9JA 2VOTA 3AC0A 1G7JA 2YGQA 5B1AB 3D07A 4N2KA 4OCXH 1U2HA 2NY1B 1D9KD 4R0LC 1CIDA 3D39E 2TSBA 3PRZA 5C2BH 2CCWA 4JO8A 4L9LB 3ARGC 3C09C 4CDHA 1UZ6F 3MKGA 5HD8D 1MAKA 4RDQF 3S5ZA 3WE6B 3O6FC 2KHAA 4UT7L 4UUJA 3WIIL 4OV5B 5D1XA 5E8NB 32C2B 1QO3B 5BV7B 2BJML 2Y1VA 2BSCA 5CEYA 3U0PA 4XBPA 3T2NL 2BCKA 5IQOA 1KFAH 2AK1H 3PWNB 4BGDA 4P2RB 4M1CD 4X4MA 3D0LA 5IW1A 4DGVH 4C56D 1BVOA 1GY2A 1A6AA 5BRZB 1SOXA 4PJDA 3SKOA 5HI4D 1YEGH 5C92A 3JV5A 1E8YA 4KU1A 4JREC 4OZHA 4U0RB 3VSTA 5E08H 3AM8A 3RKDC 2VGLM 5C0JA 1J8KA 5LG1A 3AY4C 4PW4A 1TQBC 5D1XC 4TQPA 1MSPA 4HKBB 2HMID 3IRCA 1FN4A 5CHNA 4A7TA 4FTVE 4R26L 2V3DA 4MNQD 4RZCA 4OIAA 1GGIH 1S78D 4WFHD 4LLVB 4YC2C 4GIAA 1ZA6B 3W5NA 1VADB 5JHBA 4N6RB 3OMIB 1YNTF 1JGDB 3SDDB 4TQEH 1DUZA 3S8WA 4GQQA 3QZWA 5I15L 2VRQA 1X5GA 1ADQL 2J3SA 2OL3H 2E4TA 3ARVA 4DERA 3VXPB 1R3IH 2CM5A 4P3DB 1N10A 5CEXA 1JZGA 4MB3A 3B7SA 1OGAA 1AI1H 2X53A 1GW6A 2YO3A 3KPLB 4Z7NB 2BVTA 4H26A 3TGXA 4Y2DC 4JFPB 4KFMA 4NN5C 1F3DJ 5ITBH 3KWWB 2NY0B 4PJXF 1QMUA 4GKLA 3OM3B 4HWBA 4YBQD 1UWGL 4UBDC 3FUFA 2NY2C 3RIAF 1E3XA 3IDUA 2A77H 5LAPA 4DGUA 3CX2A 5DC9B 4OCWH 4ES8A 2WKOF 4XCYB 1C9SA 2LU5A 3W2DL 3C2SA 4W1TA 1DVUA 2XIDA 1HXKA 2XSKA 4JM2A 5KTEL 5TFSL 3EFFB 3FN9A 4A1RA 2H1XA 2YGVA 2ED8A 4MAYD 2HTLC 4DCQA 3GBDA 1NOFA 4LF3B 1GZPB 4L3EE 1SJXA 3LEYH 4N28A 1MCSA 4L3AA 2RB8A 3N2JA 3GZOA 1KUMA 1T5WB 2PCPA 3FN0L 4H0HB 4PJ5D 1NMAL 4JQIH 4PRPA 5F1NA 1KTDA 4GUCA 3V0WL 1GJIA 3QIBC 2ZX9A 3BGMB 3QORD 1CZ8H 1X5YA 1AS7A 1IGTA 3MNZA 3WNNA 2YMOA 3N91A 1SPDA 1ZT4B 2AI0L 5D70L 4ZMVA 5C0DA 3FT1A 1YNTA 3KWXA 4WTZG 3ZMEA 1KY7A 3CFEB 5GPRA 3L08A 5L4MA 2DY2A 5CR8A 2XVBA 5C0NC 1CC3A 4EDWH 1K3ZA 3Q1EA 3A4DA 2KPNA 1YEKH 5JYMA 3WN6A 4NENB 2VDOH 2HTKC 4U6VL 1X5MA 1OCWL 4L23A 3RBSA 1IE4A 2DYRB 4ONGH 4XX5A 4KTEL 2XKNA 1XF4A 2DD8L 2FJFA 4OZ4B 4JJOA 4PJXA 3L9BA 1XSOA 1OAKH 4DKFH 5K93A 2HJLA 1H6UA 4CVZB 5EFIA 3CHRA 5HI5C 4GRWB 3FBKA 3S7GA 1PNCA 2N7SA 3KGTA 5C70A 3FB8B 3EG9B 1OAYL 1MDTA 3FZUC 5K9KB 4NO0D 1UM4L 1BJ1J 1FFNB 1T2QL 4Z7OF 1O6TA 2XUWA 3HG5A 3CZEA 2J1ZA 3VTTA 2YD3A 3LNEA 2R15A 3QIUD 3MJ6A 2V5RA 4NO3A 1LO0H 3V4VL 4KZEL 1N4XH 4Y16D 3KXFA 5EU6E 5L6YL 4KMLB 4G3YH 4UQDA 3R7QA 3RL1B 2DQDL 3SSGA 2CBPA 4OI9A 2H3NA 1JZ8A 3MXVH 3VFTA 1DN0A 2HN7A 3VXSB 3ZDXB 1JNLL 3EAKA 4C83A 2IWFA 3NABH 5JW5A 1AHWC 2C9PA 3TIEA 2K3HA 3QRGL 1GPOL 5DJ8B 3BKYL 1QI4A 1YHPA 5F3HB 3NAAH 5BZZA 3W57A 1DZ0A 35C8L 2EO9A 4OZFB 5DJ2B 5F88B 5DRWA 1VENA 2I69A 5EIIG 3NRQA 1J1XH 1TYEB 3MRPB 3X2QB 5EIQA 4YSCA 1HHKB 4AXWB 4DEPC 2ZX8A 2DM2A 4HCRH 5ILTH 4M5ZH 3NN8A 2GTQA 3T2LA 4AVKA 4XPAL 3FRUA 3OHXC 1HNGA 2NX5D 2KUTA 4TTDC 3OF6D 2CCLA 4G6MH 3KD4A 3BPNC 3PFUA 5LBSA 4JFHD 3WIHL 1IJ9A 5TE7H 2W9LA 1QI3A 1UA3A 3NIFF 1AC0A 3MN8A 5DJ6B 5SWZD 2QTEA 2ORBH 2ZXGA 3II2A 4E42B 4HF5L 2UWEA 3TN0D 1BZ8A 5AW6B 2UVFA 4R7DA 2XWDA 1NDMA 2JB6A 2JCCE 4HUMB 1NZRA 4KKQA 3K6OA 1QLRB 5AOLA 5B3SB 1C1EL 2OXGB 4OCNC 1JWMB 5D1ZB 2IAMC 4K55A 2J44A 5I9QB 5ADOL 1MCJA 4DZ8B 3KYKL 3I9AA 4R7VA 1S7WB 4G9FA 4Z7QB 2A38A 1NCTA 3IU4L 3FF8A 1ZGLB 3SDCC 4XR8C 1J88A 2X4NB 1KXVA 3OJMB 1JV5A 4XZ4A 3BVUA 2ZCLH 3QNZA 3LZPA 1MJ7L 3TO2B 4X5QA 4NPYA 2WZAA 2IH8A 4LEXH 4Y1AB 4PRDA 5FC9A 5DMIH 2WOYA 3FO0H 1X7SA 3QDGA 3W3BA 3AREA 4ZAKA 1CI3M 1KTLA 2Y7SA 3ZJAA 3X1NA 2F58H 4AK2A 2VL5A 2ZXWB 4DP6X 4ODUA 3BCFA 1ZV2A 5GGSB 1S9YA 3F65A 3N85H 1KZYA 5BW7A 4MQXC 1G6RL 1UD2A 2F74A 2E9GA 4OFKA 2CH8A 2WQWA 3II3A 4XP9H 1HYRC 1GCYA 4KROD 4KK6D 2HLFD 3ULVH 4KRNA 1OSPL 1E30A 5IP4A 5C08A 3VFRB 1IL1A 3GRWL 2CR6A 2A1WL 2ZG2A 1N8OE 4V2CB 2FD6L 1C5CH 1NC2A 2DQTH 3ZDYE 4LL1A 4HWNA 1S7TA 5ITFB 2F53A 4KNTA 5BW7C 1YVLA 4MYWB 3S4SA 1MWOA 2BP8A 3C6LA 1JPTH 3O41A 5TK4A 2QELA 1EK3A 4BXSV 5CN2A 2BIHA 1TSRA 5GRUH 5KVDE 1JWSA 2Y3AA 4G8AC 1J05B 3E9UA 3WJJA 5HJBA 4LNVA 1B3JA 2YQGA 4LEEA 1R9FA 1P7HL 4P2QD 2P48B 3X12A 4EXPX 2D2OA 5IQMA 3FOMB 3M1CA 3WFBL 1WLHA 2CR3A 4RFNB 1WFJA 3K3QA 1FL3A 2ITEA 1F4WH 3TH3T 3UBXI 4KQ3H 5IVNA 2AXJA 3QYMA 4KZCA 1SJHA 4YDJA 1U8OB 4RWYH 4UQ2A 2FIKB 1UB6B 2J12B 3X1FA 3ZTDC 4QWWC 2XCMC 4CKVX 2YQBA 3CSYA 2DI7A 1NPJA 1CICB 1KGXA 4GRLD 2UXTA 5EN3A 3IJ9A 2ADFL 2BXYA 5ACZB 4P2QE 2X88A 3PL6C 1L3WA 4DIXA 1S5IH 3P0VL 1DVFA 1OK0A 2YFNA 3QHFL 4PG2A 4G83A 1QLEH 3WFDL 1ZT7B 3QCTH 3K6FA 3ELQA 5G4OA 5EO1B 3ETBJ 1BX2B 3BIKB 4QY8A 3RNKB 4EZLA 4GSDL 4M7JH 4XMXA 1SDDB 4ERSH 4XMKL 2EEDA 2R0KH 3AQYA 3MV9A 1REIA 2G5BA 2ZP9A 1IZKA 4ZFOL 4N4YB 2KPWA 2ZG1A 3DRQA 5FYKD 1DVFC 3JWDH 2VDLH 4PG2C 3ZDZF 1BAGA 3TA4D 5HHPB 3L3KA 1KTBA 1DQML 4QXTA 3RNQB 3ZE0B 5GJTL 2OSWA 1ONQA 5CGMA 3ARDB 3BVDB 4XB3A 1QSEA 5GZNA 4GW4A 4BSVA 2CMRL 1FGVL 4LLYB 4L2YA 5DUPL 1G0YR 1R5IB 4ELMA 1HINH 3IAGC 1K4DB 4PB9H 2FUQA 3BQUD 4RGOH 1JVOA 4FABL 3V0EA 5JNYA 1BZ7B 1KB5A 4YBHA 1F4YH 1HWWA 4LSTH 5HGHA 3ZU8A 1I8MB 4FERA 2Y7MA 1EZVX 4XC3H 2BZDA 2XI9A 4MB1A 5FF6B 3HJ0A 3I6GB 1NCNA 1KV7A 5CBAA 1D2PA 5FYJD 5FHBH 1KGJA 3I75B 3NG5A 4HJTA 2WUCL 3QPKA 4WW2B 2G75B 1ZK9A 3IDJB 1Q1JH 3CDFA 1TZOA 4PWEA 5AB0A 4WHTA 1SJVA 1G9ML 1IMHC 1HX0A 4PJ9D 1F02I 3GKZA 3E6HB 3MMEB 3A0OA 1X5JA 3SBWA 5DHYB 4HIEA 2WP3T 5ESQA 3SO3C 3AUVA 5IREA 1XEDA 4DO5A 4LGRB 3UP6A 1AYRA 3CDGA 4XTRC 1DVQA 2DMBA 1TETL 3BSZL 5FYJE 3Q6FB 4A2FA 4F2ME 4AE1A 1KENH 4DUWA 1KBKA 4ZSOB 1J5HA 3MLVL 5AALA 2YBGA 1J86A 1MRCH 2IDFA 3SOBL 1CN4A 3A47A 4YGVB 3WN5A 1YPZB 3QJHB 3FQ2A 2F7RA 2X4OB 3F01A 4R8WL 4ANKA 4O58H 1N2RA 4WLCA 3VMNA 3LKQA 2B4CL 1WF5A 4RAHA 3LQAH 1CLYH 1KDJA 2C9XA 4MX7B 1NC4A 2XT1B 3POHA 1I9JL 2OMUA 4YHPB 5I19L 3CN0A 3QJFA 3DXAD 4ZTOH 4E0RB 2E6JA 2ZKHH 4JRXA 3FQRA 3VFSA 2P7TB 5DMKA 3P77B 3S9DB 4X4ZA 4M93B 3UTSA 5CGYD 3QCUL 4QRUB 3U4KA 4TULL 3FU8A 1NKOA 4HKZB 2DJ4A 4ADIA 4EZJA 5F1IB 1XD0A 5BS0D 5LNGA 4KKAC 4RISH 4YSOA 5EA0L 4L9LA 2J1YA 4GMTL 3CSPA 5KSBB 2HUHA 4X5RA 4Z7NF 1D5BB 4IBZA 4TM9A 4YSRA 2NSQA 3K6IA 3WE6A 4OV5A 2HKHH 5HDQL 5ACMA 1G7LB 4LQFL 5CS7A 32C2A 1QO3A 3APDA 5E8NA 3S35L 2YJQA 5DS2A 4CU6A 5JW4M 4D8PB 1Z5LB 4UTAH 4MA7H 4PWIA 2Q6WB 1CBJA 2DICA 3PWNA 4P2RA 4HEPG 2G60H 4N5EC 3T3MB 2NY1C 2C4XA 5GGTA 5BS0E 5BRZA 3IGAB 1MNUL 4HUCA 4Z76B 1IAIH 1BMGA 5MERB 5B7FA 1VF5C 2BFVH 3TBCA 3UBHA 2X3BA 5HHXL 3HOGA 1F86A 4HZ1A 4HKBA 5EOQL 3O6KH 4P46B 3BUYB 3NJIA 4WNQB 4Z0BH 5I75C 1CBVL 4MJ4A 4P07A 3V9EA 1ND0B 3VXTB 1UH2A 5JR1H 4L1SA 4LLVA 2AHIA 1PJWA 1ZA6A 4GO6B 3OD3A 4NUGL 1VADA 1JJUA 3P1VA 4N6RA 3ZKMC 1JGDA 4QGTA 3N43B 3SDDA 4U0RC 1KJ3L 2WVUA 3L2MA 1ZDQA 2HCZX 1QFWH 2BZCA 4BUQA 3VXPA 3Q6GL 3IXAB 4P3DA 2ZOWA 4XI5C 5I0YA 2VC2L 3IGUA 2G0KA 3MCG1 4IYKA 4FFYA 3CC1A 3KPLA 4JFPA 4Y9FA 3LQMA 1D5IL 3FOLB 3KWWA 3V7AG 3QIWC 2RD0A 1GRWA 3WO4B 1TTCA 1RURL 3BAKA 4GRWF 3B9KB 2J8UB 1SXAA 1HHHB 4XCYA 5EIIB 1HXMB 4AIXA 1M56B 2EABA 2OX5B 4PFEA 5HHOE 1BCIA 3EFFA 3CK0L 4Q58C 5AYTA 2PO6D 4JFED 4YE0A 2Q0ZX 2V8MA 4LF3A 1GZPA 4A6YB 1CURA 4TS6A 5JQHC 1T5WA 3G6JB 1LO3H 3BRGC 1AZVA 1DN2A 2Q2EB 4NUQA 4GG6E 3BGMA 3Q2WA 2AQPA 1JAEA 4WF7A 3WFHB 5CWSB 5F96L 3ZDXF 1E8ZA 2FT6A 2O6DA 1RIUL 2ZX7A 2ZXBA 3C6SB 3MFGB 3UAEA 1S8DB 3TH4T 2L04A 2WQUA 4QRPD 1G7IB 3LH8A 2IPTH 2V5SA 2WBJB 4KX8A 4UMGA 4M8VA 1KEGH 3GLEA 4E2OA 1DLHB 4PYGA 2EUVA 1XH3B 5TE6H 1KCRL 3EOAB 4BQCA 1TZAA 3VQMA 4G7RB 4LDLB 1UENA 4F7MB 5I1EH 2IC2A 1QSFB 4NENA 3P4OB 5FW6A 1BAWA 4N0YL 1ECZA 5KZCB 1NGQL 5DFVC 5F1KC 3O2VL 2ZP0T 1NCAL 3DVIA 1HQ4B 4OZ4A 4J8QA 3NJFA 5LG6A 4CVZA 5FCUH 4ODHL 3L3DB 3KPOB 2ZUUA 3N1MC 1T66D 3ARFD 2O6PA 3EG9A 3FB8A 1E9OB 4PBWD 3RIFF 5K9KA 1FFNA 3IFLH 4Y19D 5LHDA 1JG9A 2NW2B 4QDGA 4KJPD 3UH8A 4N1EA 1UFUA 4NBYB 5I8KL 2DM4A 4KH2A 2AV7B 2OYMA 4FMKA 3PE9A 1NMBH 3FSZA 1B0WA 3HRPA 2Z93B 3RL1A 1JHKL 4OCLC 5IROA 2WQRA 3S37X 4F24A 2KZWA 4XXWA 3VXSA 3VFPB 3WAJA 2CDEB 1E5CA 4O4YH 3T77B 1EV2E 2OL3B 3FHAA 3OC8A 2EDMA 2LV4A 3LHPH 4U3CA 2PABA 5DJ8A 5F3HA 1XGRB 3FCBA 1DQTA 4WWKB 4OZFA 5F88A 1KSRA 5DJ2A 3F8UB 2BVEA 2QMJA 4BFGA 5KVFE 4FQXD 1S3KH 2GEEA 2F68X 3KPSD 3MRPA 1QFUL 2W9DH 4DKEH 1HHKA 4AXWA 4KY1H 1TJGL 3NIDF 2B08A 1YEFL 1TEGA 4XXWC 1OAZL 2ZCHH 3QK0A 1DCEA 3OZ9H 5IFAL 1SJMA 2WNGA 4CNIB 2EIMB 2R2HB 3BUIA 3QAQA 2GJJA 1Q0EA 2E75C 3KG5A 1VZHA 1T80A 3QA3B 5DJ6A 4ODVH 1N0LB 4Y4HD 3VXUD 5IOKA 4E42A 1YY9D 3KPSE 4GIPD 4EI5B 3RPIB 5DCCA 4NZRL 1LP9B 1E6JH 3UTZB 4CKQA 4ZMWA 3K1DA 4I0CC 1MCKA 1MY5A 1BGXH 4MVBC 1HOEA 4HUXB 3P02A 1QLRA 4GW1B 5HDRA 4P23B 1A6TB 2OXGA 3IN0A 3RP1A 1RH8A 1K4CB 5D1ZA 3U2SB 3ARYA 4LSUH 4OLYH 2MPAL 4LFHG 4Y4KD 4UTBH 4FQJH 1PEWA 2KDGA 1NL0L 3I50L 4X7SH 5H94B 1S7WA 4DZ8A 1GGCH 2R59A 1ZGLA 1WA1X 2X4NA 4ONHB 1O9VA 3RILA 1ZLDA 5J6GB 5JDJA 4Z9KB 2DBJA 1WWBX 3BT2L 3HKFA 2DN7A 3C5ZD 3P3UA 4GG8B 4LIQH 2VDOB 4KJQC 2X4RB 1PD0A 3KYMA 3TO2A 4H8QA 4WK2B 4Y1AA 5EBLB 2QQLL 1PX8A 3ETTA 4UT6H 5CILL 1HNFA 1SUJA 4U1GB 3RWHB 4P2CG 5D1ZC 3CLEH 4JPSA 1F8TH 3IB4A 2LLLA 5JW3H 2F19L 5I9QC 2OR9H 3LZQA 5HGBB 1LWJA 3ORJA 4ZQKB 3GYRA 5AVWB 1FUNA 5GGSA 2CUMA 2FEDD 3K1KC 4JFQB 4JG0H 5EDXA 1F18A 1OAUL 1SM3H 4E41D 4HZLB 5BPPA 3BFQG 3CFUA 4RMSA 2MOVA 5IW3A 4QLWA 5FB8B 2CHDA 2JE8A 3VJ6B 3VFRA 1FCCA 1PCXA 4P2OA 1E4KA 2I27N 3JSSA 4F5CA 2AXGB 1SF3A 2MHAB 5ITFA 4EIZC 1UOWA 4WK0B 4PJAF 4YZWA 3KS0J 4IJ3B 1JD7A 2R4SH 5GGVY 5CIPH 1DBAL 3L54A 4RFEB 3SCMD 3S48A 2VRKA 2QPUA 1F2QA 3FS9A 2B1HL 3DSFH 1J05A 2D3VA 3ZE0F 4G9DA 3RI5K 1EHLH 1DDTA 3QXTA 2VR7A 3MLWH 1ACXA 4L48A 3FOMA 4DO6A 2JB5H 1ES0B 4XNUL 3QNXB 4RCAA 4B9YA 2FHFA 1G9NH 1CT8B 3EBAA 2E8YA 1JN6B 1YYLH 2LFEA 4EXKA 3DKHA 3B1TA 2OK0H 1U8OA 1DYZA 2FIKA 5D4HA 1UB6A 5GXBB 1OWWA 4IU2B 5KW9H 4FQIH 2A99A 3L1OH 2O30A 5ACZA 1SOKA 2D73A 3OQ3B 4RFNC 3NTCL 2D3LA 1ZT7A 1UM5H 1KXQE 1UG9A 2Y07L 1ZY9A 5EO1A 1IGJB 1LWRA 3V55A 1QRKA 2IWKA 3D1MC 4JM4L 4LOUD 1BX2A 1NCIA 3BIKA 4L1HA 4N85A 5MI0C 3ABKB 3RNKA 2YPKB 4ZO7A 1SDDA 1AGDB 3SDAB 3AXHA 4P3CH 2V2XB 2YD7A 1FVCB 3GMMA 4FL4B 2XJLA 2YLHA 3QQ9C 4MASA 1CICC 3CZLA 4R7LA 1JUFB 4YSUA 2H1PH 3N42B 1CQKA 3CCHB 2DLHA 1J18A 5I6NA 5KS9E 2LR4A 4FZEL 3TONA 1JZ4A 5HHPA 2F5AH 5J13C 3L16A 2E47A 3GKWL 1CU4H 2Y0SA 3FN3A 4YSTA 3RNQA 1YPZF 1BSIA 1SN2A 3FPYA 3GS7A 3RU8L 3ARDA 4DAGH 3WJLA 2XN9D 2J21A 1OAJA 4LLYA 4FNTA 4QAMB 4LCWB 1JGLH 1R5IA 4R6UA 5ELIA 1RUQH 3NJKA 3RX7A 1CF1A 3LMJL 4BQ8A 4FI7A 5J12C 1K4DA 3N9GH 4XC1H 2NZ1A 3L1FA 4FNUA 5FECB 4PBVC 1BZ7A 2Q20A 4P5TB 4TRPH 4BKLB 1AKPA 1I8MA 1E9PB 1P5VB 4I48B 4PVBA 4R5TA 3GSUB 4F9LA 5J7CC 1BJ8A 2BDNL 5FF6A 5JA8B 4HS3B 2XN9E 3I6GA 4LBAA 1NBVH 3LNGA 1PZ5B 3I6KB 2FATH 3I75A 3FUNA 4WW2A 4GSXA 2G75A 2BNRE 3IDJA 3QSKB 4KRMB 1WHOA 3MJ9A 4ZS7H 1LMIA 2XTJB 2YAOA 4CU7A 4MDJB 1JFHA 1KCUH 1X6LA 3E6HA 5T3XL 4GKSB 3MMEA 5DHYA 4NQDD 2VSMB 1N18A 3E6FB 3FAXA 5TQ0L 4F9LC 3T3MF 4E9QA 1NIDA 5IB3B 5HY9B 1CDIA 3VWJD 4YX2H 2H8PB 3Q6FA 4ENZA 1A7QL 2XJKA 4HULB 4ZSOA 1DBKH 1TNNA 4JRWA 3AADB 3JVGC 2R8SL 4APQD 1IVLA 4YGVA 3EUDA 1KTRL 1YPZA 5IFHL 4IKJA 4BFBD 3QJHA 4F2FA 3CFBB 2WWNA 4Z7WB 1CTMA 2X4OA 3A6OA 2IH1B 4Q6IC 5KYXB 2J2ZB 1RZQA 1PLBA 1F58L 2VB5A 2DQCL 4MX7A 3OR6B 5LUMA 4PJHF 2LGNA 4YHPA 2VXSL 3NFPB 2VM9A 5K1JA 4LASL 4NNPL 5JZ7C 4E0RA 3OLEA 1BZEA 2P7TA 2YPVH 3KYAA 3P77A 3N50A 4WI7A 1KBGL 1QLEB 3O0LA 4QRUA 4PH8A 4O9HL 4Q6YA 4M5TA 4QD2E 4HKZA 4ENED 1IARB 5F1IA 3NACL 1HWHB 2D31B 4RMUA 2G9HB 3WKNA 5KSBA 3A23A 1D5BA 1MCPL 1SY6L 3ULUD 4IMLB 4JPKL 3V5HB 2DMHA 2QADD 3IBOA 2CJUH 3P3SA 1G7LA 4MZRA 5DD1H 5JTWA 4WTZA 4D8PA 1Z5LA 2VDLB 1YC8A 2DPKA 4M93C 2YXWA 3B7YA 2Q6WA 3S34L 4U4BA 3RZCB 3BPCB 2PXYC 1DJYA 3QWRA 2AKRB 4DKTA 2HJFB 3CZJA 1YO4A 2Q7AA 3MV7D 3IGAA 4Z76A 1XF3B 2X0UA 2ZUXA 3OAYK 3ECUA 1ZTXE 3MJGX 5MERA 1NBQA 4PJEB 3ECBB 3G6JF 2H6PB 4GXUM 3VYNA 2N4IA 2K9UA 4YL4A 4P46A 3BUYA 4WNQA 4D9RD 2HRGA 4HEME 2GJRA 3Q13A 4JAMB 4NWTL 1ND0A 3O4LE 3VXTA 4EBQL 3I9GL 2EXTA 4JX0A 3ZTCC 1FVDB 3ZHNA 1NWOA 2EIDA 5E4IA 2WB7A 4FG4A 4KK8C 3MV7E 1GGYA 5J3HD 3IS1X 4FQ2L 3ABGA 2VR3A 3SPJA 3I85A 4JDTH 4OF5A 5DZOA 3SGJC 3IXAA 4JFZH 2VXVH 2WZ0A 4P46C 2XV6B 5GSVB 3GSNH 4D9RE 3D0VB 3S5LG 3FTSA 1IEBB 3KBHE 5CCKH 1OOAA 3FOLA 3BZFB 4PP2B 3MSPA 3HHRB 4JB9L 2EINB 3GI8H 1T7VA 1G9HA 5ADPH 3G6AA 5GRXG 3P11L 1ZSHA 3B9KA 2J8UA 4HUVB 4XCNB 5GS0H 5BQDA 1HHHA 3PIQB 3CH8A 5EIIA 4U1SB 1HXMA 1V8HA 4JFSA 5TE4H 2OX5A 2AQ2A 4ZW7A 1YEJL 1INEL 1CGSH 3HZ3A 5CCJA 4HLZG 1OALA 1YCSA 2GG1A 3LOWA 4FQLH 4A6YA 3TFKC 1KTCA 2H2SD 3KGSA 1Z3GH 3G6JA 3WO4C 3U2JA 1BBDH 3MRHB 3H42L 5BO1L 4F58L 4BSJA 3SYQA 3IGKA 4GXVL 2H2PC 2VN4A 4WTWA 4WVRA 5CWSA 3WFHA 2VL4A 5I16B 3C6SA 1PJ9A 4DGIH 1S8DA 2VN3A 2I32A 5GRVL 1OCOB 1G7IA 2WBJA 3QZMA 1EZSA 5K9QG 1DLHA 4QXUL 1XH3A 4XN2A 4KK9C 2APBA 1RZIA 3LD8C 4FNPA 4F7MA 4UT9L 1QSFA 3ZPDA 5K5YA 2GW5A 3CG8A 4HS6B 2EKSB 1UASA 2VZ1A 5DEGB 1HQ4A 4O02L 5C0AB 2UXGA 5MP6L 5A6MA 2JJSA 5JW4N 1EO8H 5I6KA 3L3DA 3KPOA 3VD2A 4XN4A 4AYSA 4OGZA 1DANT 1E9OA 1RZKL 4HJ0C 3U25A 2EDDA 1JZ7A 1DEDA 2NW2A 3LEXB 4NIKB 3HG0A 2E56A 2VZVA 5C86A 1G5GA 4R96B 4XRCB 2IGFL 1O0VA 2ESVD 2BP0B 4WEUD 3A4FA 2AV7A 4G8FB 3H9ZA 2F0CA 2MNWA 3ECQA 2JIXB 1DJSA 2Z93A 5BUGA 4H88L 2WJ7A 1AZNA 4X6CF 2CGRH 2QEJA 3VFPA 5CFAA 2CDEA 1EHNA 1BLIA 1UATA 1VSCA 2AEOA 3UZVB 2OL3A 3AROA 1GC1C 3G5ZB 2X3CA 3B2UD 1XGRA 3WY1A 1U8IB 4QT5B 4WWKA 1ZSDB 2YD6A 1DQDH 5E56A 4E9XA 1AZBA 3OGOE 5FKPA 5SX4H 1WIOA 2ESVE 2DYPB 3FTVA 3I84A 2BCMA 5FA3B 1YJDC 1RZKC 2UX6A 1EJOH 3IJEB 1BZOA 4LBEB 4AMWA 2CHNA 3BIBX 4YO0A 3IKCB 7PCYA 1M4KA 2E5EA 3FNKA 1NIEA 4BGLA 3PJNA 4Z77B 2IMMA 4WJ5A 5F7UA 2ZUQB 4CNIA 2R2HA 4L1LA 3T5WA 3BE1H 1A7BA 3VI4F 1URIA 4Y5XB 2WW8A 2EILB 4WWKC 2ERJB 2EZ0D 2HH0H 3JZYA 4G6AC 5C6WH 3MRMB 3OKKB 5JORA 5I1IL 3QA3A 3GRGA 4N87A 5L7XL 1N0LA 4WEBH 3IJYB 4EI5A 1BVLB 1WIPA 2Z0BA 5DZ9A 4GP8B 4JQIA 3RPIA 3CFNA 3PABB 1LP9A 1Q9LB 3T8XB 1OHQA 3UTZA 4K3JL 4KPHH 1JVKA 5M95B 3CZUB 4HUXA 5CUSH 3TYFB 3BO8B 3IT8D 5A2BA 5IQ7L 5J06A 4GW1A 4GUOA 4AEEA 2Y25A 4P23A 1A6TA 4MBOA 1DQLH 3U2SA 1U8KB 4XVTH 4NKIH 2X2YA 5DYOB 4HC1H 5EOCL 5T1DL 5H94A 3NFNB 4HCGA 2YBRB 3FQNB 4ICWA 4ONHA 4Z7IA 2B59B 3EYSL 3UYRL 4AQ1B 2X9YA 5J6GA 1AMYA 2NR6D 3H56A 4ZMYA 3ZTJH 5HPMB 1TQSA 1I1CA 4GG8A 2QHRH 1E2ZA 4DTGL 1M42A 2X4RA 3AQXA 3PF2A 4ILDA 1IE5A 1LEGB 5AKRA 3QR0A 2OMVB 5F2FA 5EBLA 4DN3H 4X4KA 3O3EB 1BD2E 4P23C 3RWHA 4ZXBD 1HJBC 3ZL4H 3RVVD 1ASOA 4JO2L 4PLOB 5B1CA 4AGPA 4ADJA 5ICUA 5HGBA 4JKLA 2WLJA 4ZQKA 3HA0A 5ETUB 1ACYL 1MH5B 3G5YB 3QH3B 3SBRA 2ZAIA 4JFQA 1KMGA 4AW7A 4HZLA 4EAEA 2NT1A 3K5SA 1NEPA 1SGKA 5JUEH 5E2UH 2AAVA 5FB8A 1L7IL 5DLLA 3QG7H 3I3BA 2OJ1A 4LDEB 3FU3A 3QJXA 3VJ6A 2OBGA 3LZNA 5FUOL 2V17H 3GBNL 4TSBH 5IG7B 2KLTA 1WAAA 3N1GC 5B3JE 2NLJB 2Q8BL 1WFTA 2AXGA 4A2EA 2MHAA 1AKJB 3KPRD 3NPSB 3RFRA 1TVDA 1AE6H 4IKKA 3N42F 1YEWA 2DKMA 1ROWA 1MLBB 1A7RH 1WZLA 3OAYH 4RFEA 2MOQA 4ODTH 3ZTNL 2PR4L 2I9TB 3ZL2A 4PJCF 3TPUB 1E4JA 2ZD0A 3O0RL 2YWZA 5IQ9B 3GZPA 4YHLH 4QO1B 3N6YA 1ES0A 2IMNA 3QNXA 2NOYA 4HFUH 1S5HB 4PBXA 1CT8A 3UJTL 1FORH 4IRSD 4HCRA 2B1AL 1IFHL 3KPRE 4LOVA 1JN6A 3SE9L 2FQFA 5DUML 3LEVH 3QDMD 1UC6A 3LTVA 1MHCB 5JXAH 1BM3H 4IU2A 3UIZA 2YUZA 5C7ZA 1UUNA 1JPSH 2H26B 2JTYA 4KUCD 2SODB 3MODL 4CVXB 2C26A 2QGBA 4HQQL 5LVEA 1JHLH 3TNMB 4UNTA 2W60B 4V33A 4RQQB 5HGGS 3BGAA 2YZ1A 2XVKA 2DRUA 2RH0A 4PJGB 4A2DA 4JR9L 1IGJA 2R4RH 5AKVA 2IOIA 3EF7A 3S97C 1QBMH 3QDME 1YUHB 1T20B 1UA7A 2YPKA 2Y7NA 3CMOH 4WUUB 1AGDA 3SDAA 2D7TL 2V2XA 1PZCA 1ZA3B 1FVCA 1OCZB 1YC7A 2CA3A 2L7EA 1E6OL 1JUFA 2AZAA 4XN1A 1FFQA 3F6LA 3CCHA 4FFZH 4O2CB 1YA5A 1JYVA 1NLBL 4UQ3B 1OAXL 1KCKA 3B7UX 4HPOH 5AVXB 2DBLH 3CXDH 3ARXA 2EDTA 5M7QA 4Z7WF 3H6JA 1TF4A 5FDWB 1IBHA 1XDTT 5IVZB 3DPDA 1NCOA 4JVUA 4LCWA 1FSKB 1IIKA 2MIZA 3SDAC 3CXHJ 1ZRUA 4DESA 4FL4C 2FYVA 2BP3A 4HEPA 2JMRA 2DQEL 2FYYB 5D7IB 1W91A 3T0ED 2O1AA 4GPVA 2P1YA 3QWOB 2K78A 1VDGA 4XHJD 4MA1B 5FECA 4M03A 1UWEL 1NINA 2DQJL 2C9SA 4NKQB 4P5TA 4BKLA 1E9PA 3EDKA 1P5VA 3PPEA 3CSFA 3NESA 2VKWA 4I48A 1KYAA 4QNPE 3MLZH 3R0MA 4M48L 4POZC 5AENA 5BRQA 2GUYA 1CIUA 3GSUA 5C6TL 3M07A 4X9BA 2KH2B 4HS3A 1P6WA 1J5IA 2MKWA 1XR9B 1PZ5A 1MCWM 1I1AC 3I6KA 2YXVA 1I9RL 1ITCA 2QMKA 2X4QB 2I9LB 3MUUA 3HMXH 3ZDWA 1SN5A 1RJZB 2VLKD 2HT4C 4HWBL 3T0EE 2HLEB 4Q8BA 3PP4L 4MDJA 4NP4H 1LDSA 5CIPB 2IANE 4GKSA 2Z31D 4K9EL 4M62H 5KJ4A 1MAMH 3BN3B 3E6FA 5E8OB 3ZKNC 3D6GA 3VXRB 3HI1B 2NSMA 1FAIH 3U9PL 1F6LL 5IB3A 5HY9A 4FD0A 3KLKA 1DL7L 4TNFA 2X89D 2H8PA 5H8DA 3S5LB 1YN6B 2C4FU 2C3VB 2NDFA 2WQXA 3NFSH 5KVEE 4C4UA 4HKXB 3L2NA 1AQKH 2UZXB 3F58H 2Q87A 2VLKE 1BVZA 3CFBA 3O6ML 3O8XC 4Z7WA 4GINA 1A5FH 2J57A 4KKRA 2PP7A 3VSUA 2IH1A 2CRZA 5KYXA 2NY6B 4BE5A 4JO4H 2J2ZA 1ZS8B 3KLAB 4K8RL 1HAWA 4S1SL 1ZK5A 1I7UB 3OR6A 3WXWL 3NFPA 5IB5B 5F9WC 1I31A 2B7DT 3LRLA 2ZKWA 3QZBA 4XBEL 4ZG1A 4GKZB 4BQBA 2YMTA 1GL4B 1RUAH 3IAPA 4K9EC 4LKCB 5I74C 4ZMTA 3GMOB 4QRRD 3T3PB 4PWFA 4N8VG 4Q2ZB 1HCVA 2D31A 2G9HA 3R1GL 2OCCB 2XPGB 4H0LC 2JFCA 5FXCH 1NUGA 3ZTJG 4IMLA 5ISZD 3V5HA 2IH3B 4K94L 2K1MA 1DHKA 4XP1H 4KGLA 1UKTA 5CD5C 4O5LH 4IRJB 2N59A 3X3FL 2MTAA 4X5PA 3WKQA 3L95B 3RZCA 1FYTD 3BPCA 5LXGL 2Q7NA 1LO2H 1Z32X 2AKRA 3IETB 4QRRE 2HJFA 1OPOA 1U8CB 4NN7C 2WKLA 2LW3A 2YGNA 3U48A 3LPFA 3FPXA 1XF3A 4EVNB 3L9YA 2DI9A 4YVNA 4LL4A 3QHZH 4DP9X 5ISZE 1X9UA 4MSWB 2OZ4L 4PJEA 3ECBA 4FQCL 2CO6B 3RVTD 2H6PA 5J57B 2VMFA 1EEYB 2FIRT 2WXRA 3LS4L 1LEKB 4JAMA 1UD3A 4PCYA 3RZCC 4X7FC 1DO6A 2BS8A 3PDOB 5E6ZA 1FYTE 1FVDA 4JFWA 4S0SD 4S0TD 1N8ZB 4JKPH 3MNWB 3WEMA 4K94C 2JI2A 2KZKA 2XKUA 3QDJA 1EWHA 4XMWA 1DBBL 2M83A 4ZS6C 1U92B 1AZCA 1D5RA 1QR4A 4PV8B 1YY8B 2D3JA 4XZUB 4ZUTB 4M6AA 2NQDA 4KX9A 1JZ2A 4TVPL 2AABH 2YFOA 4OT1H 4AQ8A 4C8XA 2IAAC 4XMPH 5GSVA 4KKPA 3D0VA 1TZGH 1E7VA 1XH2A 4AIOA 1IEBA 1SVZA 2HT2C 4PP2A 4D3CL 1NGYB 2K3TA 4EQ3A 2NZ9C 43CAB 4L0YA 2H9GB 2LTQB 3KVQA 4H44C 1BIHA 3CVHL 4HUVA 1LJMA 4KJWD 4XCNA 5KJRL 3PIQA 3A21A 4U1SA 3BXNB 5EZLB 2IDSA 2X70B 1XZ0B 5HYJE 1VZIA 4AQ8C 2PMZA 4KDTA 5DHVH 1QFPA 4CC0A 1KDIA 4U3XA 2A6IB 2D9QB 1B88A 2D0GA 2H3XC 2W9EH 4IBLT 4KKNA 5KSUB 5HGAB 3MRHA 2V9TA 4YSEA 3C2AH 1C7SA 4MKTA 3VAEA 2Z6FA 2K6ZA 2P45B 2AERT 1N64L 3DPBB 3C9NB 4M00A 5I16A 3GBML 3CFDB 5D72H 1P9MA 1BYPA 2JWYA 4FDWA 4NFDA 4KDWA 4KHTL 2Q9OA 1HYSC 3UBFA 3K71B 3NIGE 4MD4B 2EE2A 3UOAB 1VEMA 4N24A 1F11B 1I1FB 1NKRA 3NJMA 4G8GB 4EQ2A 1IO4C 1KACB 1FHGA 2C9RA 3AGVA 4S0HA 4HS6A 4Y1SA 2EKSA 5JPMA 4UTAA 3MZGB 4NM8H 3O81A 4JFFE 5DEGA 1N0XH 5C0AA 3U4BH 5KSAC 1YG9A 2NY7H 2CHWA 4XXDB 4MQSB 5HGDB 1NFDB 5EG6C 2A6JB 4JHBA 2VSDA 1BQ5A 5J6HB 3D3VB 3LZFH 3THML 1EUTA 5AZ2L 1PY0A 4HBCL 2ZCKH 3Q9PA 1IQWH 3EYUH 2F54E 5E9DB 4DF9A 3FW6A 4XNXL 2MJWA 3IJ7A 4PGDB 2FR4B 2ZXCA 4FXKB 3LEXA 4P59H 4S1QL 5HDOA 3F7QA 1BWMA 4R96A 5JHLH 2Y6SC 5F3BB 1N5AB 4XRCA 2BP0A 3JWOH 5FLUA 4NFBA 2K0RA 2XXMB 4G8FA 1DQJB 5F44A 4AGNA 2AP2A 3ZE2E 4BXVA 2GJZB 1GJWA 2JIXA 2FQGA 3W0WD 4WNSA 1ZIBA 3OWEA 5JYLA 2HA1A 3NH7H 2FHCA 3LH2H 3UJIH 2VLLB 4B5ZA 1NSNH 2YZ8A 3UABA 3UZVA 4TLKA 4WTXA 1W9XA 2EEFA 4HXAL 3DI3B 3RB5A 1CVSC 1IBGH 4XMVA 3G5ZA 1XF5B 4KXBA 5MHSD 3BP4B 5DK3A 1U8IA 3ASNB 4QT5A 5KYYB 3GSNB 1ZSDA 1XSKA 2XQBL 2PNDA 4L4TB 3FONB 3VVVA 5LWYH 1F4XH 1P7QB 2DYPA 5FA3A 1PZSA 2ZPKL 1H19A 3MBWB 3CFTA 1N6QL 4WI0B 1NM9A 3IJEA 4LU5H 2G3XA 1QW8A 2FLRT 4LBEA 5DU7A 3W0WE 3IKCA 1P1ZB 5DFAA 5JHDE 1SXCA 2YD0A 4Z77A 3DJ9A 2H0EA 3BAXA 2Z7ZA 3FRPG 3BSGA 3LCYA 1NA8A 4XPGH 5MHSE 3RGVC 4Y5XA 2E6PA 3ZUNC 4F7TB 2GVYA 2RJMA 3MRMA 3OKKA 4IEFB 2R9HD 5AKTA 2J72A 4FG6D 5AL0A 4I87A 3IJYA 3F3HA 4UILH 4QTFA 5HHMB 1BVLA 4GO8A 1S9KC 3PABA 4JY6B 1Q9LA 3NJGA 2DWTA 4OF8A 3U7AA 1OSYA 4UF7C 3TYFA 3BO8A 2MWCA 1JPGB 3QT2A 1U8KA 4WI4A 3D39B 5DYOA 3NFNA 3WLWD 4LCIL 3MLXL 4D7BA 2YBRA 3FQNA 1J8RA 5D8JH 1JK9B 4IQHA 2BNQE 2B59A 4PJ8B 3VWKC 4AQ1A 2CKBH 3CQQA 1I8LA 5HPMA 5DD5L 3K80A 4BQ9A 1Q9OB 1LEGA 1NDTA 2HVKB 2OMVA 4ODSL 4TVSa 3O3EA 4KRPD 4PI2A 3ARBD 1EA9C 3FQYA 4PRIA 4ZZFA 3GRBA 2ICWB 3MV8D 4B7LA 3DRTB 1CE1H 3L5XH 1FBIH 3F7YB 5SX5K 3GDBA 1YEHL 2FQEA 3H9SB 5LO7A 1NANH 5LN8A 1L5GB 1H3TA 1OVZA 3WL9B 1MH5A 1O7DE 3G5YA 3LPGA 3QH3A 3RX9A 3W9EB 1Y07A 2YOCA 5JMRA 3EW3B 4Z8FL 4HD9A 4M5YH 3VD1A 2QSQA 1WT5C 2FO1A 1CDUA 4MJJA 1DVTA 7CGTA 3V5KB 1NAKL 4FTVB 4IOFD 5DO2C 3M45A 2DMKA 1HEJC 1THAA 2IGLA 5IG7A 1PU0A 1OPGH 2O5YL 4QR7A 4NQTA 4XN5A 5GS2D 2NLJA 1FG2B 4PV1C 4H8PA 5K33A 1OGSA 1MZYA 3ECWA 4MXWH 1G0DA 1AKJA 5D2LE 3L3HB 4AGOA 3L3IB 3KS0H 3QUML 5D7LD 4EUPH 3RTQC 1MLBA 1N19A 4C57C 3MRFB 1GOGA 3OV6A 4M9PA 2I9TA 1T1WB 3F2LA 2YMXL 1AP2B 3TPUA 3PWJB 1KN4L 3T08A 3AABA 3LB6D 1AD0B 5IQ9A 3KJ6L 1BG1A 2VXQL 4P99A 4QO1A 1NAML 4EO5A 4G6KH 3OGCB 4LOEA 1S5HA 4OGYL 3U6XA 4PR5B 4LRNL 2P46B 3NJHA 1SXBA 3T2OA 1A3LH 2NXZD 3P40A 1M1SA 3VUAA 2Z7WA 2WYTA 3X1GA 1KCVL 1DFXA 5E6SB 1A4JB 4UOQA 2H26A 3IE4A 3K46A 4YOKA 5F8RC 5FPIA 5AWNH 1GSKA 4L3EB 1TZHA 2QBWA 3HG1D 2W60A 3TNMA 4RQQA 2ZWNA 1FC1A 2G2NA 2NY4D 3TVMC 5F71A 4JHVA 1JE6A 1RUML 3OL2A 4PJGA 2DIAA 2CDGB 5E8DH 1I8UA 3BFOA 2ZOOA 1MQKL 5C3TA 1PG7W 1RULL 1YUHA 2AEIT 2J7LA 1T20A 1ECYA 4WUUA 4OAWB 1ZA3A 3DBSA 4GLRH 4KKZA 4UTBA 2BRRL 3FK3A 5IQLA 1WBXB 4N8VB 5FWQA 2VLRD 3NSXA 5I8EB 5J9PB 4OI7A 4B53A 4O2CA 1PD6A 2DQHL 1LMKA 1MRFH 1QAWA 5IQNA 4YLCA 4UQ3A 2HWZH 2J43A 4M1DL 4DVBB 4ZMLA 1LK3L 3IEAA 5IB1B 3NCYS 1BQLL 4OY9A 4WSGA 2YD9A 4UT6A 2RGSA 4HW6A 5FDWA 5IVZA 1CMOA 3FT0A 1VPOH 3L7EB 3A22A 1T0MB 2YC1B 4U49A 5CO1A 1XF1A 2Q3XA 5D7IA 1MELA 4H8WH 1H8NA 2Z8RA 3QWOA 3UXFA 4ZI8A 2IALB 1A6UH 5AW7B 3C5JB 3T4AB 2DJUA 1N59B 2YQ2A 2E7LA 4AWJC 3SPGA 1VCBC 3HB3D 2JJVA 3LRHA 4MXQD 3UAFA 3NBNA 4DNLA 4QHKJ 5CJXA 2GT9B 4UYPA 5IHZB 3ESUF 3Q8CA 1ZXQA 1XR9A 5I0WA 1E42A 1ZHNB 4K0OA 5G55A 1LD9B 5EU6B 2X4QA 1W16A 2E4FA 2FX8L 2I9LA 3EBHA 3FCUB 1FQ9C 1UZ8B 5I28A 1RJZA 5I1CH 2EQDA 1HL8A 3GSOB 5CIPA 2IFFH 3D87B 3MROB 1AIZA 2FJGB 3KPMB 3OR7B 3PAZA 4JN1L 4NQCB 5D1QE 5E8OA 1BA9A 3VXRA 3HI1A 1YYMH 4GMSH 2B14A 5GJSH 3HI6H 3MRQB 1HQRB 4PJBE 2JKTM 3IDMB 1RPQA 3MUY1 5BVPL 3S5LA 1YN6A 2C3VA 4BEIA 3PNWB 3PAYA 2CHXA 3FHQA 4HKXA 1JNNH 1MFVA 2ENJA 2G0LA 5E70A 2UZXA 2Q8AL 4U7KA 3TBYB 1AR1D 1K8IB 3ELAT 4BH8B 1U8PB 3BN9C 4QHKI 4R90H 3EH3B 1ZS8A 3IPEA 3KLAA 5DK0B 4IRZH 5JQ6H 3T8VA 1I7UA 3FSOA 4AUYA 2KLRA 4ZX4A 4BKTC 4FJ6A 2BM3A 5IB5A 5DZAA 3WNOA 4MCNA 2O6CA 2NUPB 3OMNB 4MS8C 4ZX3A 5I18H 4R5XA 4GKZA 2AJXH 2E27L 3STZB 4LKCA 2ENSA 3HC2A 3GMOA 5FHAH 3U79A 4Q2ZA 2X0WA 3U7WH 4AQEB 3R4RA 5JDSB 4XPBH 2NY6C 1DBML 2VQ4A 2XPGA 2ITCB 1HXYB 2FECI 1RKRA 3EJZD 3RDTD 4JK0D 2HRPH 2FGWH 2IH3A 2V9QA 3GSXB 2E8ZA 1DLFL 4BZ2H 2CIIB 3DHUA 3VI3F 4IRJA 4TF4A 4IMKC 4LOFA 1OAQH 1Z9SB 3GM0A 4NZTL 3L95A 3TN0B 1YAZA 2J6EL 2QR0B 4WHYH 3IETA 1U8CA 4JPIB 4OCSL 3KPNB 2R0ZH 1PKOA 4NUMA 3OKEB 1A22B 2YRZA 4L29B 4TL5A 1QWHA 3D69B 1YMMD 3H8NA 4MSWA 2CO6A 2Y06L 1R4XA 3AITA 1EEYA 5J11C 3JWNH 1PMYA 1I8AA 4R97B 5LQBL 2VDML 4OLVL 3BKML 1SOQA 3DDFA 3PDOA 1N8ZA 2E7BA 1COBA 2QVMA 3MNWA 3KLQA 1RIHL 3IMVA 1NUNB 4HJUA 1CO1A 4N0CD 3QDAA 3TU6A 4G71B 2D8KA 1TXKA 1U92A 4PV8A 1YY8A 4XZUA 1GZQB 4ZUTA 3ZDYB 3EYQD 5SX5H 3NDYE 3W56A 5DI8B 4JHWH 4QTIH 5F0PB 3RWIB 1AS6A 1HIML 1OTSD 4PVLA 1TEFA 1N67A 5E5MB 1NGYA 5A2KH 4WV1B 43CAA 4YN3A 2H9GA 1PTZA 1I8IB 4F80A 2B15A 2FX9L 4S1RL 3BXNA 3ILPB 5EZLA 4XVJH 4F91B 1XZ0A 4OV6F 1QD0A 1XAUA 4U3HA 3MTXA 5I2IB 3O4OB 2A6IA 2LE9A 4WUKL 4IDLA 1RZFH 3FRPB 5KSUA 5DK2B 5HGAA 2VZSA 1KGCD 1KXHA 2LTQC 1IKOP 1E65A 4GKNB 2K4AA 2B0SL 3KM2A 2OI9B 3DPBA 3C9NA 3FCGA 2YPVA 3CFDA 3GK8L 1SLWA 4XB8A 3CXHK 2WZPA 3ALPA 1Q94B 4FFVC 1A65A 1DDHB 4YIQB 5CBEB 3K71A 5FA4B 4OH2A 5BOPA 3VFNB 4MD4A 5B3NA 3B2VL 4XODA 1F11A 4FG0A 1I1FA 2BH0A 2E76C 4G8GA 2WLIB 5LGHH 1KGCE 4X2UA 1LO4L 1EH9A 5EBGA 4J3XA 1XTLA 4BFKA 1CFVH 25C8H 4X9GA 4XXDA 4X6FB 1T83A 5BZWB 2MCPH 2QFRA 2J88L 2WOBA 4FFTA 5HGDA 1NFDA 3TJPA 3FO9B 4M7LH 2A6JA 5J6HA 1HHJB 4UOZA 1L9RA 5AVVB 3QXAB 4AC4A 5EUOE 3EO9L 3E0GA 5E9DA 4WW1B 1PD1A 2BSED 2CK0H 5LKNA 4GI6A 1B2YA 2OQJB 2BOCB 2RCSH 3L4ZA 4FXKA 4HJ1A 4PGDA 4AL8H 2FR4A 3PYCA 5CSGA 2VDRB 2WO2B 4D2NA 2AW2A 4XP6L 4E68A 5F3BA 4FQ1H 2JQZA 3QUZD 4LPUA 1N6UA 3HNSL 4WAFA 1NMCC 2E7DA 1DQJA 1CDCA 2FEEI 3HS0C 4WO4B 1QRND 2GJZA 5T3XD 4APXB 4ZMPA 2H41A 3DA0A 3D8MA 3IK2A 4S1DD 5D7SL 5FDYA 2VLLA 1MQ8A 4PTTB 4PGBB 4MGXA 4P9HC 1J5OH 4R4NC 4FXKC 1XF5A 3UL4A 3ZGIA 1M53A 3BP4A 4HJJH 3A6BL 3EJSA 5I1GL 4PGEB 3GSNA 5KYYA 3EDJA 3CVIH 4L4TA 3FONA 4NKMB 5EORL 5PAZA 5TPWL 1URZA 3MBWA 4KAQL 2HKFH 2FZ3B 1QRNE 3PGDB 4WI0A 5T3XE 1XH0A 2C3HA 1P1ZA 5I1HL 3GSVB 5AZEL 1ZVSB 3LIZH 4WK4B 2P80D 3ARRA 4L1DA 4RFOH 3DX9B 1HL9A 1AZRA 3FTWA 4P9MH 4V11A 5DHVB 1KJ2B 2ZAHA 4B0MM 4P5MB 4F7TA 2XZAH 4GH7B 1AMXA 3LZLA 4J3OH 4IEFA 4BFFA 1DJZA 2VR6A 4MHHI 4X7DC 1PAZA 1KB9J 2J20A 3RWCB 1HKLL 5ICXB 1KIRB 4FXTA 1NCHA 2HFGL 1MCIA 1MCHA 4JY6A 2YLKA 3E1ZA 3RIAK 2P42B 3ESOA 5GS0C 4PP1D 4IGBC 3VDBA 2BWQA 5AVRB 2GBVA 1JPGA 5C0RL 3KYOB 4AMKL 4I18C 3PREA 4Y5YC 2YUVA 3IMUA 4YHOL 3MOQA 3CQPA 4BFOA 1LK2B 2G2PA 4LVHC 1JK9A 4PJ8A 5TF1H 1MRDH 1DJXA 2MOGA 5CJQH 4B60A 5I66B 3PDDA 4OZIE 4GBXD 3M7OA 4X5XB 3KZ8A 2X4UB 5D93B 3ZLQC 4CSZA 3T8MA 1Q9OA 5HVWA 2HVKA 4IK7A 4HIXH 5SWSD 2DKUA 15C8L 3P9LB 4K23H 3LRSB 2ICWA 4DW2H 1J0JA 1I3UA 1EZLA 3DRTA 5A2IH 1E4XI 3F7YA 3V0JA 3KCPB 3H9SA 3PQYD 3DETD 4GB9A 1L5GA 3JWNG 1HI6B 3WL9A 3W9EA 1IV8A 1P4LA 4FHBD 1TJIL 1HESA 5AVUB 5D96B 4KK5C 1T6BX 4LSSH 3B7RL 3UDWC 4NZUH 1GW0A 4MJID 4WY7L 1WRFA 3MCKB 1PY9A 5EC2B 3WMPA 3V5KA 3SB3A 1ZHKA 1YQVL 5SWSE 4FTVA 2CDFB 4I1NB 4WQOA 3SGDI 5L4FA 1FIGL 2W91A 1FYHB 2D2CC 2ZNWA 4NCC2 2D0FA 4W4NA 4W9HC 1D9KC 4BDVB 5HYQA 3PQYE 3L3HA 3L3IA 4QPEA 4DZBB 4CC1A 1FA4A 4J4PA 4PLJD 1IZJA 3DWTA 4JFYB 2BHFA 2EE6A 3MRFA 2GABA 3RWDB 1T1WA 1K6QH 1MW3A 1AP2A 1MHHB 4NB7A 3PWJA 1MUJB 2VMCA 5CSZB 3CBJB 1RZ7H 2NQCA 4MJIE 1B4JL 1AD0A 1QACA 1XXFC 3MUJA 3TT1L 4DEWA 2AJSH 5IJVB 5DR5L 4LSPH 3OGCA 1OSZB 4HS8L 3IF1B 4HAKA 1U8LB 4D0CB 4TOYH 5HI4C 4V1DD 3BKCH 4Z7VE 1WFIA 3R4DA 1GHFL 2G9KA 4P05A 1A4JA 4AEIL 1PG7H 3HZYB 3B4NA 5AFAA 4PUBH 3GXTA 4YXKL 1NCUA 3B5TA 1MJUH 4BK5C 5HHOB 1EZUA 2HMIC 4HHWA 1WFUA 3K6NA 4D8OA 4BWWA 1NLDH 1CGVA 4L3EA 1IC1A 1S78C 3F7LA 4JZNB 3AGWA 5EZOH 1BQSA 2WTPA 1RPUA 2CDGA 4IBQA 1IGCH 3CFMA 2G5RA 4V1DE 1XL6A 3MRIB 1ETZB 3IVKB 1JZHA 1MCRA 1K72A 2I25N 3IDIB 1YECL 3ZHDA 1UOKA 3A67L 3Q3GB 3L3OB 4XE5B 4OAWA 3S2CA 4HVBA 1AR2A 4N0RA 1FNSH 4HC1A 3RVWD 3TO4D 1T03H 3IE9A 1WBXA 2YN3A 4GAFB 4N8VA 4RRPG 2FWOB 5I8EA 4AOFA 2PO6B 4BZ1L 3HZVB 2CKBB 4M8UA 1ZLEA 3Q1SH 3AB0C 4DVBA 4U7SA 2B5IC 4QRQB 3PLYA 4YBQC 2J73A 1J9QA 3QEHB 3HG4A 5E5RB 5IB1A 2YKKA 2QPDB 4U6XB 4NQEE 3AT8A 3L7EA 3WIIH 4FQPA 1T0MA 2YC1A 4MXVF 2BJMH 5DWPA 5EEZA 4NHCL 3DX4A 5GZOD 2CO1A 4YE4L 5I71C 2GKIA 2IALA 4Z3FA 1UD5A 4MAYC 3C5JA 3T4AA 2PWDA 1N59A 3MBED 4JRLA 5C09D 4H8UA 5EF0A 4OSUL 1JGUL 4F20A 1KULA 1ZLVK 2K9FB 3TEXA 1KGIA 3N41B 4U1IA 4P3WA 3UO8B 4UV7L 2E86A 2JCCF 2V37A 3C8KB 4OFVA 3QORC 1RFDL 5IHZA 4FAAB 4L1TA 4YFLF 4XPTL 1ZHNA 1LD9A 2FHBA 5EU6A 4NERA 2WWKT 2MH4A 3MZTA 4QGYA 3B34A 3V79C 1UZ8A 2EC8A 4R26H 3PG2A 1HZLA 2NY5L 3GSOA 4J1UB 5CSBA 5C09E 4CGUB 3MROA 5TDNB 1LE9B 3KPMA 3OR7A 1BEYL 3CJJA 4NQCA 1U3HB 2X1XR 4PI0A 3JTSB 4HH9B 3MRQA 4Z7UB 1HQRA 5I15H 1WV7T 4EN3B 1ADQH 3DJRA 4UZUA 3D4CA 3IDMA 3NQKA 1MFAL 2VH5L 3G9VA 4OW6A 4K3EL 5E2WL 5T8IA 5H2BB 3PNWA 3HBQA 2EE9A 2CLVB 1M05B 3UC2A 4OZGB 1YNKL 1QOKA 1X5ZA 3TBYA 4J3OG 1K8IA 4GAGH 2ENYA 1H3PL 2XACC 3CXFA 1U8PA 5D6DC 4BH8A 2DIJA 3S0PA 1GAFH 2NNCA 2WLLB 2MCAA 5G4NA 1QI5A 4C47A 1UWGH 5DK0A 4NGHH 4YK4C 2K70A 4Y4FB 1ZHLB 2P5WD 2JKRM 3GPSA 3BZDA 4G8IA 4K5PA 1PSKL 1U3YA 2ZZUT 2VO8A 3QIUC 2NUPA 3W2DH 1SMAA 5CN3A 3DX2A 4Y16C 2EECA 5CM1A 1A66A 5KTEH 5TFSH 3STZA 1A8ZA 1U95B 3CHOA 3ZDYF 5I8OL 2JCWA 5E6IB 1D6VL 5CXPA 1BVNT 4AQEA 3R18A 2A9BA 5JDSA 1J0KA 3FN0H 1NMAH 2ITCA 3QJUB 1HXYA 3V95A 3O3AA 3V0WH 3GD1C 4NN6C 2P5WE 3RUGE 5BO0D 3UG5A 2CIIA 1MCBA 4FFZA 4JPVL 2R1XB 4P0DA 2AI0H 5MEND 2AQQA 1Z9SA 4DUXA 4BWUA 3TN0A 3D2UB 2P43B 4UM9B 1UGNA 2QR0A 5BOJA 1ODUA 3V52L 1U2CA 4JPIA 3NSFA 3KPNA 1SEBB 3MJWA 3HRZB 4EIBA 3OKEA 2MTPA 3GIZL 2J5WA 4HDIB 1CF8L 3BAWA 4L29A 4U6VH 3WTVA 1OCWH 3D69A 3WNMA 3NQIA 1XF2B 4B9FA 1I85A 4KTEH 2UXFA 4OKVB 4GQRA 1BBJB 2DD8H 4FA6A 4HZAA 1MZZA 4MCYB 3TN0C 2X1WL 3WS6A 2IOMA 1C5BH 5D7JD 3WMQA 4OJCA 5KOVC 2IWEA 4AZUA 1OAYH 4BRJA 2WZ5A 3REVB 1R3IL 3IFOB 4K5OA 1UM4H 1Q72L 1JF5A 2K6YA 1T2QH 4B9KC 3JTTB 5HYFA 5L8KB 3LNHA 4RAUB 3VD5A 1AI1L 1CDYA 4I77L 5B8CC 3IPFA 4XVUD 3QFJD 4W81A 2JKXA 3HMXA 4P4KD 1GZQA 1WZ1L 1MXDA 3ZKSD 4ACPA 3SJVD 3KDPB 3V4VH 4KZEH 1E7UA 4YHIB 4YVUA 3K91A 4UU9B 3WI9A 4R97C 3X3GH 4X8JB 3RWIA 4AUUA 2DQDH 2RHEA 3LKPB 3O6FD 2HAZA 1XL4A 2NNAB 1Q9KA 2GSMB 5E5MA 1KIUB 5I5JA 3TZVD 1JNLH 5FGBA 2B9AA 4WV1A 4Y5VC 1CGWA 4GEJA 1AFVL 3QRGH 1GPOH 1A9VA 1I8IA 3BKYH 4OUOA 1LL1A 3QFJE 4HH8A 3ILPA 35C8H 3FU9A 2M8XA 2CO3A 3MNDA 3SJVE 4JQIL 2IVFC 4LB8A 5EU7E 5I2IA 1CDJA 5HP5A 2BP5M 3RFZC 3MA7B 4OIBA 5D1XD 1SMOA 1HVXA 5EULV 3FRPA 4JHZA 4BA8A 5DK2A 3US0A 4KROC 4KK6C 2HLFC 2EH7L 4WV1C 4XPAH 4GKNA 4GQ9H 3HR6A 4WNJA 3WIHH 4ZNEA 1Q94A 2XG5B 3GZKA 4FHJA 3RJDA 1DDHA 3A6CL 4YIQA 4AEHH 5CBEA 4KVPA 5FA4A 1TZIB 2F18A 3VFNA 5DMYA 2B39A 1JCKA 4RVBA 1CFSB 4HFWB 1KIPB 1M6OB 3POCA 2WLIA 4G7VL 1C1EH 2QV4A 2WTRB 3VXOB 5D7KD 1MCWW 1C12B 4NZ8A 4PHXA 5ADOH 4LCCB 3KYKH 5MEPB 2CNYA 4X6FA 5IJKC 4KQ0A 5BZWA 2NY2D 3ZQXA 2WPGA 4PJDE 5FYKL 2W0PA 4N3UA 3FUEA 3FO9A 3TA3A 5EF2A 1HHJA 5E03A 1FG9C 1MJ7H 3QXAA 3WTWA 1I82A 1JTOA 1FDLL 1LO0L 4OLEA 1MG3C 2Q5BA 3TBVB 4XGZB 2AQRA 3MYZA 4WW1A 4MQ7B 1NGXB 1OGAD 3F5WB 2OQJA 4QHNB 2BOCA 4GRLC 4OJAA 5AAWA 3NCCB 2Y36L 5H4YA 4FJYA 5T1KB 2XQ0A 4WO4A 1I7ZB 1EJFA 1G6RH 4K3HA 4APXA 2IGTA 3NAAL 5I1LB 2XA8H 5EUKB 2XN9B 5HDBE 1X5XA 1TO5A 3SQOL 3QFGA 4PTTA 4PGBA 4BBWA 1A6VL 1OSPH 2MQCA 2BNRB 4JM2D 1AVAA 1C5DB 1OGAE 3D48R 3GRWH 5FYJL 2V6HA 2A1WH 4CL7A 1IAMA 3SE6A 4PGEA 5CEZH 5FUZL 2ZCZA 4OD2B 5JW4Q 4NKMA 3FTUA 4PRPD 2WCPA 3QQDB 4WO4C 3MRLB 2HTKD 2AEWA 1ZLVH 2FZ3A 4Q7DA 3PGDA 2AJUL 2K4WA 4PGCB 4LVNC 4BFRA 3BZ4B 5EZPA 5TE7L 3GSVA 3VXMB 1ZVSA 2C7FA 1QW9A 1S4IA 4IIQB 4KJYB 4C59B 1EO5A 4A7UA 2PTVA 3DX9A 5DC0A 4XP5L 1FLRL 2R2EB 3BQUC 1QPKA 3CZFB 3HUJE 5DHVA 4P5MA 2GUOB 3WFBH 4AITA 4JGNA 3FQ1A 3L81A 3UERA 4HJGB 5JIMA 1HZHL 3RWCA 1WBZB 5ICXA 1KIRA 2R7EB 1INDL 2XYBA 4D0DB 1NDGB 1T21B 3TURA 1Q0YL 2DMGA 5E24E 1IGIL 2X6MA 3KYOA 2ADFH 3PHSA 4R2GB 1NEZG 4NDMB 3WKPA 3P0VH 2XRAL 5LGJA 3QHFH 2MNJB 4KXCA 2DWEB 4PJ9C 3G5VB 4HUKB 4XMUA 1LK2A 2O5ZL 2ARJB 3IDYC 3U0WL 2TSAA 3EH4B 3CBKB 5I66A 3HAEH 4X5XA 2X4UA 5ALBL 1NH6A 4GSDH 4E9LA 3IJSB 4WWNA 4XMKH 2ZOKB 3KXFD 3LRSA 1XGYL 5J8OA 1AD9B 3AJ7A 4F57L 3EJYD 3KJ4C 5E6RB 2WXKA 2WXGA 4I0PB 5T5FL 4A7VA 5JPNC 3KCPA 4ETQB 1VESA 2DF3A 2WLMA 1HI6A 3ULVL 3QJOA 1DQMH 4LXFA 3DMMB 4TTDD 4BWTA 5GJTH 1XCTB 3H3KA 4L8BB 4P5KA 1FGVH 5DUPH 1C5CL 4MNGB 5A2AA 1IC5H 1R46A 3OJ2C 4Y9BA 2AQ1A 2QV2A 3MCKA 2XFGB 4YBLC 5EC2A 4YFEA 5JHLA 1F3RB 2WNWA 1X5KA 3KXFE 4GG6F 2RTTA 2CDFA 4OD1H 3O4LB 1JPTL 1BQKA 1UA6L 5CGYC 4JVWA 4L5FH 4FABH 2ED6A 4YXLL 5E5LA 3P2BA 4HK0B 1AQMA 4DZBA 4FULA 1CGXA 3JV6A 4KXZH 1U36A 3TCTA 1JYNA 5IW6B 1P4IL 4YMPA 1KOAA 2BY2A 4JFYA 2R1WB 4K73A 4QIRA 1DSFL 3FU6A 5ENWA 1D7BA 1SVBA 3RWDA 1EMTL 3N55A 1MHHA 5CSZA 4ZMQA 1MUJA 1SFDA 2WUCH 1KN2L 1OB0A 5IJVA 1UEYA 2FUTA 2J6WA 4TVPE 1OSZA 4KV5E 2K45A 1G9MH 3IF1A 1M7UA 1U8LA 2YAQA 4D0CA 2P9RA 3PPSA 2YARA 3D25B 3CPUA 9PCYA 4LDCA 1RP9A 1S5IL 2GTWB 2NNFA 3WDIA 1JV2B 3AMLA 5A2LH 3U46B 1W80A 2DQGL 3HZYA 4G9FD 4N2HA 2UY7B 3BSZH 3QCTL 5HHOA 1JBJA 2F1EA 4MQXD 1PZBA 3MLVH 1F4AA 2BVOB 3O9WB 2UWEE 1D6EB 4NZFA 3KLSA 4JZNA 2X41A 1M9WA 4R8WH 3APFA 3AU1B 3QDGD 4F7CB 2B4CH 3OAUL 3ARED 4ZAKD 3MRIA 1ETZA 5DYFA 2V8LA 3D4ZA 2G5UA 2ED7A 2NXYD 3VM5A 3IDIA 3JWDL 1I9JH 4NKOB 4X6DB 5HJ3B 4H20L 5I19H 3Q3GA 3L3OA 4G9FE 4G8EB 2DIEA 4DK5A 3QCUH 5DDHB 2FWOA 5DD3L 4CJ0A 4TULH 3HZVA 4XVSL 2CKBA 4YSPA 3PWVB 3OAWA 2RQ8A 1HINL 3C12A 5EA0H 4QRQA 1G6VK 4GMTH 5C08D 3QEHA 3QDGE 3U9WA 3V4PL 4U6XA 5LB1A 2WXQA 2JXMB 4ANVA 4AC2A 5INCB 2MQ0A 4O2EB 1NC2D 5HDQH 5K9JL 3S35H 3FU0A 4A37A 1N26A 2O61B 2F53D 1RCYA 1P53A 1S9XB 2ITDB 3C6LD 1XH1A 4IU3B 3ZR6A 3P69A 3MBXL 3Q8BA 2PO6C 1CL7L 5D2NB 3BKJL 2H3KA 4CBPA 5CLXA 5FHBL 5JOPE 3T2QA 2F8VA 2YQ3A 2QGEA 4U2YA 1ADWA 4ODWB 1L6XA 4WJG3 5C08E 4AG4L 3LS5L 3C8KA 1YN7B 2DQMA 3UTPE 4YZFE 5HHXH 1GIGL 5DEJA 3WFZA 2DLFL 1J1PL 3QEQB 1L0XA 4J2QA 1I75A 1CBVH 2OP4L 2ZWLT 5KVFL 1BFOA 2NDGA 1CLCA 1SEQH 1JPST 4NBXB 4EUPA 1O75A 3GT6A 1WA0X 1I3RB 3DV4B 4U31A 4J1UA 1KB9K 3B37A 5TDNA 1KENL 2OCFD 2R1YB 5DJYB 1LE9A 3BPLB 1U3HA 2DH3A 2CO7B 4DOHE 1MRCL 2Y72A 5GS1B 1KJ3H 1LHZA 3CHSA 3WMSA 2WK2A 3WGVB 3JTSA 4HH9A 3GIVB 1WIUA 4Z7UA 1DVFD 4EN3A 2WLZA 3Q6GH 4LP5A 1AY1L 1XGZA 2N0MA 5H2BA 1FZOB 3K7UA 4M29A 3EDFA 1KCSL 1W0VB 4URTB 5D71H 3U4AA 1CLYL 2CLVA 1M05A 5IR1B 1JTPA 4OZGA 2O72A 2CZNA 3ESVF 1JYWA 1T66C 3ARFC 4J6RH 4R0LB 3OWRA 1UJ3C 2O26U 2WLLA 1RUKL 5CZKA 5TQ2H 3MV9D 2DDQH 3C09B 1MI5B 4OGXL 1CFNB 2H6UA 4NO5B 4Y4FA 1C7TA 1ZHLA 2MNUA 4WFFD 1EAQA 4EN3C 1U3ZA 1MWAL 4DKDC 5EEXA 4O51B 4RETB 3LKSB 4AJYV 3H9HB 2PR9A 1CLOH 3CK0H 1QSED 4NLHA 1GGUA 1U95A 5CJBA 5GZND 5AB9A 3GTTA 4JJ5B 5E6IA 3WY2A 1EVTC 4OGAD 3NCFB 2ICCA 5JXEA 2HFEB 3RKPA 3CLFL 1OTUD 3MV9E 3HAEG 4JREB 1WZAA 4Y4FC 3ULSB 4Q9CA 4PJFA 2JV6A 2DS4A 4WFFE 4X83A 5DTFB 5F96H 1RIUH 1TQBB 3ROLB 4FQXC 1O6VA 2YRPA 2R1XA 4G1MB 4H2AA 3AUWB 2BFVL 3D2UA 3DIDA 2X6CA 4UM9A 4MA8H 5F93C 1KCRH 3ARTA 4ZZKA 4ZOEA 1DQVA 1MCEA 3O6KL 3IXTB 4GRWH 4ELME 1BD2B 1SEBA 3HRZA 3RAJH 3VRJB 1OD9A 3IFNL 4AI7A 1ZKAA 4HDIA 2X87A 4N0YH 3UTTE 1NGQH 3O2VH 2IBZY 1NCAH 1XX9C 4OKVA 4ZW3A 3B1UA 1BBJA 2D7PA 4H25B 1XBDA 1JK8B 4Y4HC 3L6FB 4MCYA 1YY9C 4AV5A 4FNLL 4ODHH 4Y2DB 3WUWG 4NN5B 4Q89A 4BSWB 2NMSA 2WN2A 3FTXA 2ZYRA 3BH4A 3IFOA 3O3DA 4L2LA 4UMSA 3REVA 4JDEB 1G1CA 3JTTA 3ZMNA 3HRZC 4RAUA 2HX8A 5FKAB 5DHMC 4LLUB 1Z9LA 3FHEA 4KKAD 1FV1B 1NIFA 5I8KH 4N9GB 4YHIA 1JRHL 3BAIA 4JRFA 4Q9BA 3CE1A 3JYCA 4UU9A 5FGSA 4X8JA 5KS9F 1NC4D 2W95A 1XB6A 1JHKH 1IAII 3LKPA 3HTLX 5JOFB 1WPCA 4ZW8A 3C5ZC 2E9JA 3KPQB 2NNAA