1SOKA

Crystal structure of the transthyretin mutant a108y/l110e solved in space group p21212
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
116
structure length
116
Chain Sequence
CPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIYAELSPYSYSTTAVVTNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transthyretin
publication title The beta-strand D of transthyretin trapped in two discrete conformations
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 23
structure length 116
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 1sokA00
5L4FA 4AC2A 4Y9BA 4YDMA 1DVUA 3CN3A 5TTRA 2B14A 3TFBA 3I9AA 3DJZA 3KGUA 1OO2A 4TNEA 4Y9FA 5CR1A 3D7PA 1KGIA 2B16A 3NEXA 4HISA 1TLMA 5K1NA 4N87A 3DK0A 3TCTA 4TQPA 5AKVA 1QWHA 1DVSA 1TT6A 4ABUA 5IHHA 3CN0A 1TZ8A 1DVTA 1TTAA 2QGCA 3IMRA 4L1TA 3QVAA 5DEJA 2NOYA 2H4EA 1U21A 3DGDA 5CN3A 2F8IA 4ACTA 4DEUA 4FI6A 3P3UA 3KGSA 2G3ZA 4PMFA 1G1OA 2QPFA 3GPSA 3IWUA 3GS4A 4PVLA 3ESPA 4WO0A 5EZPA 3DIDA 2IGLA 4L1SA 4FI8A 3ESNA 5E4OA 1ZD6A 3CXFA 4FI7A 3CFQA 4TL4A 2G9KA 3GLZA 4MRBA 3SSGA 3U2IA 5AKTA 4DERA 2WQAA 1IE4A 3B56A 5FW8A 3ESOA 4ABVA 3CFTA 3P3TA 1SOQA 4HJUA 4TLKA 4WNSA 2G4GA 4Y9GA 3CFNA 3GRGA 3A4DA 1QABA 5CNHA 4D7BA 3NESA 3NEOA 1SN2A 5A6IA 1GKOA 4YDNA 5AL0A 5HJGA 4DEWA 4HJSA 4PWEA 1E4HA 1TYRA 1DVXA 4HJTA 3CN2A 4IK6A 4IKLA 1BZDA 4QXVA 3NEEA 5CLZA 5JIDA 1THCA 1SN0A 2G2NA 1TFPA 3OZLA 3Q1EA 3IMVA 5AYTA 3DJRA 3W3BA 1IIIA 1X7SA 3FCBA 4I89A 2G3XA 1BZEA 1KGJA 4IKJA 2GABA 4TLUA 3U2JA 1GKEA 4PMEA 2B15A 1SN5A 4IIZA 4PWKA 4PWJA 1E5AA 4DETA 1IJNA 3CN1A 3GRBA 4PWGA 5BOJA 4Y9EA 1FH2A 2G2PA 4MASA 5E23A 3CN4A 3DJSA 4Q14A 4TL5A 1BM7A 4TQIA 3I9PA 3IPEA 2QGBA 1BMZA 4TLTA 5FW7A 2G4EA 4N86A 1E3FA 5CM1A 2H0FA 4QRFA 4IK7A 1Y1DA 2ROYA 2B77A 3P3RA 1DVQA 4PVNA 4PWIA 3OZKA 4WNJA 2TRHA 5CLXA 3IMUA 1ICTA 3A4FA 1TSHA 1ETA1 2B9AA 3DJTA 2H0EA 3A4EA 3IPBA 3M1OA 4TKWA 3FC8A 5AL8A 3IWVA 3GS7A 4DESA 5L4MA 5E4AA 1BZ8A 1TTRA 2QGEA 4ABWA 1DVYA 4PWHA 5AKSA 3P3SA 1FHNA 1TTCA 3D2TA 3I9IA 4MRCA 1RLBA 4PWFA 4ABQA 2H1XA 1F41A 5FO2A 1Z7JA 2PABA 3DK2A 5K1JA 2H6UA 2TRYA 5EN3A 2H0JA 4I87A 2G5UA 4PM1A 1THAA 3DO4A 4PVMA 3CFMA 5DWPA 2ROXA 4AC4A 2F7IA 3IMWA 3HJ0A 5JIMA 4IKIA 4TQ8A 1DVZA 4TLSA 3IMSA 3IMTA 4KY2A 1F86A 2FBRA 4HIQA 2FLMA 4IKKA 3BT0A 3BSZA 4QYAA 1ETB1 4Y9CA 5FW6A 5CLYA 2GPZA 3NG5A 3KGTA 5L4IA 5L4JA 1X7TA 5JIQA 4TM9A 3GS0A 4ANKA 4TNGA 2QGDA 1IIKA 4I85A 4TQHA 4N85A 1TTBA 3CBRA 1ZCRA 2QELA 4TNFA 1SOKA
chains in the Genus database with same CATH superfamily
5DJDA 4AQ1A 4R4ND 4K0OA 3FUFA 3BGMB 5IQNA 2BZ7A 3BFWA 2Y5QA 3HC4H 5HJ3A 3LZQA 1S6NA 5IHUL 4FCAA 2BNQB 2IPTH 4JGUA 15C8L 2F74A 3L1FA 4X6EB 3L3HA 2B1AL 2FGWL 2C9AA 5CN3A 1BMGA 2OTPA 3NJLA 1QLEL 4PMFA 4OCLC 1QW9A 1S9XA 1SDDA 2AXFA 3B5TA 3DRTB 4Z5RA 3ARGA 4UAHA 3L3GB 4FQPA 1RHFA 1UYWH 2B1OA 1QWNA 2WQAA 2VXQA 1IE4A 4AK2A 1NGWB 1WIOA 4PI2A 4YHOH 2DQFA 2Y7LA 2X6VA 1W8EA 3ARFA 5BV7L 1XAKA 3OKNA 3WNNA 4AEHH 1GJUA 3UX9B 1KPRB 1WA1X 2X40A 2E3VA 5CLZA 2R2BA 3G7TA 1FWXA 4NP4H 5DGRA 4EUPH 3OZLA 3RNQA 2WN2A 4G1EB 3BP7A 1YNKL 3E6FB 1DQDL 1KTJA 3LRSA 5DTFA 3A21A 1SLUA 3VXRE 1XV8A 2KUTA 4AXWA 2NQDA 5E8PB 1B6UA 1BYOA 2HJFA 3EO0A 4EOWL 2BLFA 3HR5A 3UYRH 1UJTA 4FXKC 1KV7A 4QXWA 4MNHB 2RJMA 3SDXF 3WLBA 1QLFA 1Y7VA 1PZ2A 4M1DL 1XCTA 2R39A 1W0VB 4Y1SA 3S34H 5CZRA 1IC4H 5EIIB 1JPSL 5EU5B 1DVQA 5IEHA 3PL6B 4Y16D 3BYTA 1IBGL 5DD1L 4XCCL 3ZDWA 3IMUA 1U58B 3FH7A 4HJ0C 4NQDA 4ZUWA 4CN1A 5INDB 2XIBA 4PRHB 2YLHA 4M7JL 3RWHB 4YSQA 1Q1JL 5IVXA 5D7IE 5EBGA 3N06B 1J8SA 5LAXA 4WW1A 1OF2B 3LAFA 5KSBE 1WCBB 2XV3A 4NNPH 2H0JA 1JOIA 4QTHA 5GPRA 1O9WA 5ID1A 4CSTA 3WTSA 1S7SB 4L1BA 4W9LC 1XGPA 1XSJA 4RRPA 5KVEL 1IZJA 4A2DA 2F53E 4TVPD 5IR1B 2O5XH 1KJ2H 5ICZA 2ZCZA 2WCGA 4XO8A 3B8YA 4B9PA 3GO1H 3VI3F 2DWTA 5DJCB 4LIQE 3EYVA 4Y4KC 2VN5A 5IUSA 5DJXB 5IZ7A 3TO2A 4AQAA 3QJUB 4LVOB 4PJFA 4UQ2A 3QXDB 3WKMH 1MFDL 4JQXC 3NQIA 2R9HC 5ID0A 2OSYA 3NPSC 5HYJB 4JG9A 3TIEA 2DJ4A 2KYIA 5F1OB 1GCYA 4F58L 4RAVB 2WYTA 1SFDA 2OMBA 3ZHLA 3P4LA 5KOMC 3U48A 5DK0B 3RFZC 5DURB 3FHAA 4JRYE 4KX8A 2W07B 1B3JA 5FM4A 3MRIB 4XODA 3EOAB 2EVGA 5E6ID 4Y4HD 2N1TE 2CR0A 2YOCA 5I66B 5D1XC 1F4XL 1QRNE 3FW6A 4HBCL 5D6CB 1X5LA 3C6SA 4WGVB 1U92B 2OAAA 3PU7A 4PRIE 3DI2B 1ZA6A 2EYSA 4JM2A 3T04D 1IARB 4JN1L 1VPOL 4R96B 1VDGA 2FJUB 4P46B 3MTRA 2OCJA 5T3ZE 1WZKA 3HHMA 3OQRA 4IBZA 5F8RC 4L23A 3WHXA 4D9QD 5KBPA 2EXYC 4YFEA 2ZOLB 1LEGB 1B2YA 4PQXA 4HGKC 4OCXL 1CU4H 1ZTXE 1XB3A 2P48B 3W0WB 5CN2A 3U6XA 1SVBA 3GFUA 3AMKA 3DETC 2OV0A 3SDXB 5F9WC 3V5HA 1HI6A 1IEAA 4S1SH 1H3UA 2K70A 4EF3A 4I4WB 2BFGA 4JVUA 3PRZA 4QOKA 5IJVB 1BJMA 4PV8A 4XMUA 4PJAA 3H2PA 5KYUA 1M3JA 2ZAGA 4K23H 3WFBL 2H0EA 1UFGA 3R06B 5CD5D 3ULUF 1TQVA 3S35X 2WXIA 3D52A 3G6JE 2D7TL 2H5UA 4OD1H 1OP9A 1NM9A 4JY4B 2FIRT 4C56A 5JW4Q 1BLIA 4L4TB 3LCYA 3GUTB 2DYPA 1VSCA 3MREB 1URLA 4D8PB 1I1YA 1FAIH 4AVHA 3ELAT 1P5VA 3TYGL 1DDHA 1YNTF 5CFAA 3EYFA 4XP4L 1B4JH 4UUJA 1A1OB 5CJ5A 1RK1A 4L3CA 1F86A 3GXDA 4JGMA 1RJZB 2MCG1 5BMFL 3O8XA 4AITA 1AD0B 1DQDH 3L13A 1U8MB 4WCYL 2R4SL 5GZOA 3QFJA 3VI3B 4N2HA 3MTXA 2XUWA 3II3A 5JXEA 3UERA 5GSRA 4HX1B 1HL5A 5K69A 1GZHC 4XNMA 4NHUA 2DQIL 4YDMA 3OSVA 3HE6C 5C0FA 4FDWA 3VH8B 5JA9A 4L29B 3FQRA 5DHVH 4M1DH 4DQAA 3MOQA 5FYJH 1MI5B 4Z3JA 1BCIA 1TPXB 4N0CC 3P4OB 3E38A 3IDNB 2EDJA 7PAZA 4F91B 3DXAB 5HHQA 5DD1H 5IM7B 2K6ZA 4X6CE 5HVWA 1YDPA 4U0QB 1MFNA 1B2WH 4FXTA 5CZVH 3QUZA 4HLZH 3ZOAA 3MJ8B 4KVNL 2W65A 4HUXB 3BUTA 4M4PA 3N42F 2CM5A 1ZHBA 5J3HD 1SMOA 1L0QA 3BCDA 3E6HB 1T83C 4YNYB 4J4PA 5EPMA 1OD9A 5J6HB 5IHWA 3GMNB 1XEDA 1XH3A 2P80D 5DFTA 2XWCA 2Y3AA 4LB8A 5DHYB 1NIFA 3QWNA 3L4TA 3VFUB 1U8QA 1GY1A 3JV0A 1D5XB 3H2QA 1KLFA 1FPTH 1HU8A 3QCTL 3BPLB 8PAZA 4H1LB 6CGTA 1EVUA 2K0RA 3BT2H 3M17A 2B7DT 1DQML 2FO4B 2X4OA 1D6EB 3LEXA 1HIML 2EH8H 2UY7A 3BKYH 5GRUL 1XSOA 1XGQB 4HKZB 4WJ5A 3NP4A 1F6FB 4EKJA 3FUJA 2I07B 4JUSA 4CC1A 4J3OC 1QBML 2GFBB 1GR7A 2HKFL 1AVAA 4DP9X 4OGAC 1C5DB 3B8SA 4R9HA 4GO6B 3FXIC 1H3VA 1ETJA 3BAJA 2DQTH 2DN7A 1PYWA 1SXZA 2DY2A 5L0QB 1KWGA 1TSHA 3ARPA 3MROA 4PCSA 2F58H 5A1AA 2IBBA 4OIIL 2ZZUT 1UB6A 1WFIA 4Y19A 5IROD 1OT4A 2O6PA 3FO2B 3IRCA 1I8KB 1KPUA 4JFVA 4U6HB 5ECGA 5H2BA 2FL5B 3DMMA 3GWJA 3GDCA 1CT8B 2OI9C 5T5NG 1RUPL 3CUPB 3RX8A 4Z3TA 1I9RL 4AQEA 5TDNB 1FNSL 2EIDA 3Q2CA 4F8PA 1YNTB 5JIMA 5E8OB 3T4YA 1BM3L 5KVDE 4CVZB 4KI5C 3JBG7 1I9IH 4IKKA 3V0HA 5D7JB 1HHHB 3PWPA 4P2YA 1J11A 5JUEH 4HH9A 2XWBA 2CIIB 1RUML 2JI2A 2R1WA 1QACA 3IDJA 1KCWA 4L0PB 1Q94A 5TK4A 3SQBA 1NLDH 4XNZB 1VGKA 3O6FA 3TJEL 3KNBA 1QHQA 3CDFA 1YVLA 3VSVA 5IF0A 3TV3H 1NCBL 1GY2A 3QDGE 4XPGL 3T0BA 4FTVB 4MA1B 4HFUL 5IIEB 3L4XA 5JO5A 3RX7A 4RDQG 4P48A 3RTQD 1T03L 4NHCL 1EO7A 2D0GA 1F97A 1P0SE 3TA3B 4HQQH 1HZLA 5CJ8A 2ICWA 3HE7D 2X42A 5EO9B 4UQ3B 3OGOE 4OUOA 4TUKL 3HHSA 5CR8A 2FHCA 5BQDA 2D7TH 2GJZB 1YLBB 3BP5B 3RX9A 3SCMC 4KAQH 5FYLE 3L3IA 2IH3B 3N42B 3PPEA 1NIEA 3IXTA 5CSZB 3QEGL 1S78D 2X4SB 5I6LA 5IV2B 5EWIH 4M29A 3N1GC 4MAYB 3VRJA 5E5RB 3ZU8A 3RGVB 5IVZA 2R23A 1NC2D 1KBGL 1MFVA 4Q74A 2WZPD 3WJJC 4TUUA 1NWOA 2YGOA 3IFLH 3JTSA 4FQXB 4PP2B 4F5CA 4Q9RL 1YO4A 4R4BB 4KXCA 4NRZA 4L18A 5EUOE 3T6VA 1PQZB 3KPSA 4OZFB 1MLBB 4R7DA 3ATAA 3H42L 2MCPL 3LKNB 5ITBH 4IRZL 4LCCB 3S98A 3DTDA 3EYQC 4YBQC 2FX9L 5FO8B 3IPEA 5AZEL 3CNKA 4UQIM 4XH2A 3SPGA 1F3DJ 2ICEC 2X87A 3CVIL 2X70B 3QP3A 4P9HL 5KSUB 3MLZH 5C08B 1FFTB 3VA6A 4I13B 5DJ8A 4ELME 1NUGA 1ACYL 4PWIA 2BVOB 1AYRA 1WBZA 4KK5D 1KC5H 1BAFH 2B9AA 4G8GD 5IFAH 2AJVL 4JDZB 3F5WA 3NCEB 4HKJA 1OE2A 3T8MA 3DWTA 3QAZB 1AOHA 3VFTA 5IWLA 5JIPA 1BV8A 3KYOA 3NSFA 4WNQA 2O61B 1L0YA 4MCZB 4PLJD 4M62H 3L16A 1OSEA 1G6RA 1OOWA 4G6AC 1DUZA 2ED7A 1XGTB 4KRNA 3MRDA 3MV8D 3KBFA 3RDTD 3VYPA 4EIZC 4J5VA 3FQ1A 5BCAA 4N0FA 2E27H 3HG4A 3LVTA 1HHGA 1RURL 2XIIA 4HIQA 5CEXB 4G8FB 4FFVD 4JG5A 1M4KA 3PGCA 4XMZA 2XNAB 3E0GA 1IMHC 3V4PA 3T1WA 3DO3A 2WNKA 1XF4A 3NOIA 1U93B 1TO4A 2P5PA 3W1ZA 1F3JB 1UGNA 5I6XB 5DRXB 2J6EA 3WXWH 1L9RA 3ZPDA 3WTXA 3ECBB 1WZLA 3TNNA 4KQ3L 4AX3A 4GKOA 4BFJA 1I82A 4BK8A 5E9DA 2YRZA 1KB9K 4JHZA 5CGBA 2DYSB 2E5EA 4PHZA 3SO3B 4E41E 1E50A 3PGDA 1SRDA 4PS4L 5K39A 3H53A 4N4YB 5I30H 3AQDA 4PY8I 1SXNA 3W39B 4JFQB 4YMPA 4A7TA 5BUGA 1BQHA 4HV8B 1U3YA 1N5AB 3BQUD 4OIIH 1E5ZA 5T5FH 1PJ9A 5CGTA 5FWRA 4MD5B 5AUMA 3B3IB 4KMQA 4JN2B 1X5XA 1R3HA 2XN9B 5EMYA 1BW8A 4RMUA 2YSSA 3EGXA 3FU7A 3HZVA 5DJZB 4DPRA 2X2IA 3GDBA 3F85A 4LKXA 3ULUL 1P9MA 3FTXA 3ARTA 3QZWG 1VFBB 3E3QC 1N12A 1UB5A 4J3OG 4X6FA 1B0IA 5CHNB 3VRIA 1NCAL 5CEYB 1UD4A 1CJYA 3GLEA 4M61B 4FADA 2NNCA 2ZOWA 4GRLA 4GUPA 1BG1A 4AEIH 2VLJB 3WHE0 3KW7A 1P4BH 3QFJB 5DC4B 3SOBH 3R0NA 5JIKA 3B9VA 3GTVA 5DJDB 5EU3B 4TLUA 4AQ1B 4FLHA 2XSKA 1IEBB 4FE9A 4NYLB 5H94B 4PJBE 3V5DB 3O9WC 4W9JC 4L9DA 5ERWA 4K71C 3A6CL 3JWOH 4EN2A 4O5LH 1BJ8A 2F19L 1KJVA 2F74B 1SNRA 2PR9A 3C5ZA 1K8IB 3L3HB 4RLDA 5AVTB 8FABA 4A2LA 3KYKL 3ARGB 4RIRB 1Q0XH 1UUSA 1U95A 3I6KA 5DQJB 4M8UA 1CFQA 2FATH 4ZFOB 5DA4A 2WXMA 4Q9QL 1AGEB 4PPTA 1ZJBA 5HHOE 3MV9D 2MNUA 5BQ7A 2Y69B 3KAAA 4P23D 2IO5A 5B1AB 2DQFB 4BELD 4ZXBD 3RNKA 3FTGA 4TVSa 1ORQA 4HS8L 4XC1H 3DUSB 2OYKA 3K6SA 3JTTA 3OKNB 1GS7A 4NCC1 3VWKA 1BBDH 3H55A 1A21A 4MFHA 5GS1C 4GY4A 2ZUTA 4MDJA 1CTOA 4ZS6C 2BS71 4HULB 3BP7B 5DEGA 5ANHA 1AO7D 3JVGA 2AJUH 2WO2B 5AVVB 5DI8A 1ZE3H 1P4IL 3SYQA 1P7KA 4V1DA 4AXWB 3VUAA 2BZCA 3T0DA 4PJHE 3EO0B 5C0RL 2ESVD 3T09A 2JJVA 1JXJA 3GXPA 5FFGA 5CCHE 3WLBB 4AE0A 3NJKA 4W4OA 3KPQB 1XCTB 4UIKH 4PJFE 3S35L 5DA0B 3ZDYE 1D2PA 5IEHB 4PJAF 4AM0A 1QWUA 1GAFH 3B6SA 1DVTA 3GHBL 1ACYH 2DLFL 4K55A 4KNTA 5GGQL 3GM8A 3HMXA 3Q8CA 2R0ZH 5HGBA 2IGLA 1U4FA 4ZSOE 4Q56A 4EI6A 4K3GA 3HZKA 3JWDL 1LO0L 3RIAK 5E9NA 5B39A 4OCYH 2BY3A 4R5TA 3R7QA 1JHKL 1Q1PA 2OX5B 1HWHB 1VGEL 4PJ6A 3M8OH 2A6IB 3BZ4B 2JLLA 1DL7H 2D9CA 1LD9B 3HG5A 2CBPA 4HEME 1GOGA 4K94H 4R5VA 4PS7A 5AD0B 3ZHDA 4ANWA 4C4KO 4UV4L 4Y1AD 4NNXA 5DEZA 4I3GA 2RTTA 1CD8A 1N59A 3EYVB 1F90L 1OAUH 5CD3A 2ZTBA 2XXCB 4P4RA 2F7PA 1U8NA 4P4KA 4W6YB 2V0AA 2AXJA 1BFVL 3IKKA 1ZA3B 2ICCA 1HXYA 1TQBB 3QYCA 2DQUL 4N8VG 4WZ9A 3TIEB 3LXAA 4OLVL 4MCMA 3VX1A 4XCFL 4ZMAT 2PCYA 1FG9C 4CU6A 1A3LH 3QRFM 2VABB 2JFCA 4APQC 2GI0A 3HN8A 5FO7A 1WWBX 1E90A 1UZ6E 2J56A 4NQVA 1MCCA 1MUJA 2Y3NA 4NSKA 4WNJA 4POUB 4ZAKA 5DT1H 1WF5A 3FUHA 1SZNA 4X8CA 5AL8A 3WO4C 2A3TA 1KV3A 5E4AA 1NMAH 1M6OA 5KS9F 1OAKL 4HGMA 1CZ8H 3LOWA 3QZPA 3STBA 1J5OL 5HVHC 1DLHB 1E5UI 1IQDA 4L05A 3JQOB 1DUYA 3KPMA 5SWZD 5D93C 2F7IA 2E9BA 2EYSB 5I5IA 2PWGA 2EIZA 2VQ1A 2OMVA 5EU4A 4LMQI 2RAMA 2FJSA 2HG5A 5DCCA 4HJ0D 3WHXB 5TPWL 1P5UA 2XYBA 2Q0ZX 1BDYA 5M94B 1PEWA 2AAAA 4J3XA 4YUEH 5D1ZC 5GGTL 4OGYL 3DX8B 3JUZA 4NO3A 1RZJH 5FM5M 3V5HB 3EF7A 1HI6B 1RUQL 3PXLA 4N22A 1KGIA 4Z3IA 3FYEB 2HTLC 1LK2B 1QVOA 1E4WL 3HMWL 3QQ9C 3CFBA 4U05A 5G55A 3V7MA 5HP5A 4JCLA 2CBMA 3GXUB 2ATKA 1HSBA 1WFOA 4FJZA 4PV8B 1X4XA 4H44C 1I85C 4PJAB 3VB8A 2UXVA 2X0VA 4IBVA 2ZSWB 2XG4B 5KYUB 3VA2C 4Y4KD 4ZBJA 3H2WA 1G9HA 4WGWB 4YSCA 4G7VH 2AMGA 2GVYA 2CO6A 1BVKA 1TNNA 2NY6B 3LHPL 3ZYOA 2DDQH 3Q8EA 5JR1H 4EXKA 4FNLL 4GBXC 2DYPB 4R84A 5AAWA 3KDMA 5T1LD 4NO5A 1P5VB 1EUUA 4IM8A 3U7WL 1DDHB 4KBPA 1BWMA 3QNZA 4UUJB 5DHDA 1GGBH 1KCBA 1S3RA 4ZFOL 1RK1B 4L3CB 4IW4C 4UQAA 2AKRA 1IBFA 4YXKH 4NZRH 3O8XB 4JPVH 3UAJC 5J13B 5INCA 4QLRA 3SJVB 5IB4B 3UROR 5EDSA 1MFEH 2A74A 5DO2D 5KVGE 1OLZA 4JW3A 4PJ5D 1F02I 4XNMB 1XR9A 4M3JA 4NHUB 3CHOA 3IAGC 3NFSH 43CAA 3KPRA 2JE8A 3RGHA 4WDIB 4NI3A 5D1XD 4XCYA 4RESB 1KIQA 5IBTL 3LIZH 4U1HA 1J0HA 2XYCA 5HSFA 7FABL 1T2XA 4OFKA 3NGBB 1K6QL 5D72H 3RWIA 5FA3B 2QGBA 2WLHA 5IMKA 4Z3EA 2P44B 5HHQB 2ZXBA 2VMJA 1JVLA 3RWFA 1Z32X 4TV3A 4PVNA 4AQ8C 4TSAH 4EN3A 1N4XL 2WQSA 5JHLL 3DHMA 2EXYD 1FVEA 3QUZB 1OGAE 4XMXA 3RYMA 4HXAL 2W65B 2YBRA 1KYFA 1SJEA 4U33A 2YO3A 3H9HA 4F9LC 4PLKC 4DKFH 1T6BX 3C08L 4J2QA 1M71A 2QKSA 4UIMA 5KS9B 5AW1B 1MW0A 1PX3A 3DETD 3ZKQD 1BBJA 1A7RL 1HL8A 3G5XA 2WXQA 4UINL 3PL6C 4K9EL 4LCWE 1UCBH 4EZMA 1OP3H 1E3ZA 3ZE1E 4W9CC 2ZWKA 5TQ0H 3JWNH 2MHAB 2W60A 2ARJA 3QQXA 2OW6A 4WTZA 2O5NA 1QSEB 2X4OB 4R4FH 3WIIH 4ZQTA 2AXWA 1AI1H 3LEXB 3N85L 1W80A 2UY7B 4GI8A 3BZFB 2HFGL 1SBBA 4BQ9A 4AEFA 4XP1H 3N0PB 5F7HA 4G3YH 4XGZB 2AV1A 4UZSA 5K9JH 1S3KH 3AXHA 1TETL 4NJ9L 1B0RA 3LZNA 4UI2A 4AIZA 1JGIA 1GS6X 2B16A 3OVUB 3I2CH 4LASH 4JRWA 5C0CA 1NFDF 2CO4A 32C2B 1MJ8L 2OTWB 4KQ4L 1TT6A 3VMOA 1TJMA 4WFED 1YUKB 5EEUA 1FE8L 3FBKA 3NIGF 4JRXE 3MROB 4LVOC 3ZW3A 4PVBA 5SWQA 3FQNA 2LVCA 1X6LA 4XN2A 3WNPA 4MAUH 4N2GA 4BGDA 1UB6B 4PCKA 4Y19B 5LKNA 2WLLA 2CDEA 5ELIA 2XQ0A 5F9JA 3HE6D 4NDMA 1TZHA 5H2BB 2NR6C 3DMMB 3MRJA 4EIBA 3ES6A 1AZUA 5E00B 3C09B 4YBLB 2BS8A 1AGDA 2KLTA 4AQEB 2BVPB 5D4JA 4N0CD 1HEHC 1UA6L 3QUMH 4PG9A 5C0IB 1BQKA 3FQWB 5C0BB 4JGJA 1BLNB 3LNFA 4UDUB 5JDSB 1JXFA 2XWBB 5D7LE 2R1WB 4K73A 1WAPA 3RVVC 2H32A 1ZT7A 2YEZB 3SQBB 1ZHKA 4D9RE 1VGKB 2WLKA 3VQLA 1EXUA 3KNBB 1BZEA 3V52L 2NX5E 2PN5A 3DGCR 4OKVA 5HDOA 1Z9LA 1SLVA 1ZK5A 2Z31A 4J3WA 3GSVB 2RGSA 3NJMA 3EH4B 1KGWA 4R8WL 3I02A 3FU3A 3CN4A 2GSGA 3FQ2A 1EGJA 5FYJU 3UBXG 1P7BA 4P46C 4QXUL 2R0KH 3NZHH 4HWEH 3MODL 2CAKA 4GXUN 4Q58C 1H8OA 4HXBH 1YEDA 5ESVA 2AVGA 3ZHNA 4N90E 3ZJAA 2ROYA 4X8GA 5D7KD 3FUDA 4Y2DB 3WS6A 5D2NA 3V4UH 2AEIT 1W8OA 4Y5YA 1X5GA 3ETTA 4RSVA 4WUUD 5LBSH 4XMVA 1E5CA 1XSIA 4XN8A 3L3IB 1DVYA 2GJ6B 3IXTB 5ALBH 3JT0A 4E9SA 4J3OD 4IMKC 3B5HA 4PJ7A 5DUPL 3U9WA 3VRJB 4PU2A 5B4MC 4BFKA 2YPVA 4HK3J 1UCTA 2EUWA 2JQAA 4OGAD 4AQZA 2YD4A 1R5WA 1TG8A 1IT9H 3BUDA 5ECJE 4ENEC 3MCLH 3I75A 4NRZB 2IOMA 2DMHA 3VQ2C 4I1RA 1AYOA 4Q2ZA 1MVFA 3UL4A 4M3HA 3VD1A 4QUOA 3GSQB 1MEXL 4R7DB 1ZE3C 4XE5B 4LSVH 4AV5A 4A37A 2E8ZA 5ETUA 5MEQB 3AADB 4XWGL 4MJIE 4Q0XL 4I5BB 4IGBB 1LWRA 2CHNA 2X4TA 3FQTA 1EZVY 4A2EA 3BRDA 1NFDB 5DJ8B 4KI5D 4S10A 1WBZB 3UXFA 3VGAB 2BOCA 4P9HC 5J89A 3OPUA 3Q7JA 2CBTA 5FC9A 1T7WA 3H3PL 3NIGB 1OGPA 1G1CA 4XBPB 1EERB 3F5WB 1TVHB 4JJHA 1MG2C 3VGEA 4HXAH 4L1SA 1OAJA 4PW9A 1I1FA 1OPGH 5DU7A 3VFTB 1LE9A 3NZ8B 3GLZA 2A73B 1CICA 1DVFA 4NUQA 4WNQB 5A16B 5G4NA 2ODHA 2AXGA 1A2YA 2JB5H 1CG9A 1D5RA 3QHFH 1TPXC 5D5MA 4X6DF 3UO8B 2V5YA 2CKBB 4QRRD 1FYTA 4QYOB 1T6WA 1HHGB 1OGSA 4M43L 1QTYT 4MXWH 3BMVA 1QPKA 3MKKA 3PGCB 5GGRB 3NSCA 1TQSA 3D09A 3V4PB 5IFHL 1XF4B 1CLOL 1IO4C 2Q3XA 3UJJL 4DVBA 4BE5A 5LUMA 1H9VA 3IFPA 3MBXH 3D33A 3SCMD 5JLZA 1KPVB 1OK0A 4FHJA 4CSPA 3PHOB 5F96H 5LGJA 2BIPA 2J1YA 2EIMB 3CZSA 4P2QA 4AVJA 3MBWA 4N2MA 1NUFA 1R19A 2J5LC 2VRAA 3BSHA 3NCBB 4YZFF 3ZDXE 1S5HA 2FUTA 2ZXEB 5GISL 1M7IB 3PGDB 3VFOA 5TH2B 5EIIG 2EXSA 2H0FA 3CX5J 2TSAA 4R0LB 5E1AA 5TE7L 1EQWA 2NW2B 1BQHB 2H1PL 1GIGH 1K4DB 2ZG3A 4ZX6A 1A6WL 2NNRA 4L4VD 4OUUA 3MJ7B 2Y0SA 3APMA 5FAAA 3BX7C 1LMKA 3VMNA 1J5IA 2X53A 4CDHA 1UJ3A 1R3HB 2D8KA 1F00I 5EOTA 2ZOOA 3EYQD 4YBQD 4BYHA 2YSSB 3EGXB 3HZVB 5I23A 4FRWA 3KEDA 2DQCH 1X9LA 3UTSB 4NRXA 4K3DH 1WUNT 1NSNH 4LOVA 4PRPD 4X6FB 2XZQL 5DVMA 3VRIB 4P9ML 2VW4A 1I3VA 1OV8A 1AS7A 1IFGA 3D3VB 3FB7A 4GRLB 3IM1A 3PNRB 4XO9A 2VSDA 3SKOA 1ETB1 4GMSL 2X1XR 2ZG1A 2F61A 1VRSA 1UXWA 3MAWA 2J8UA 2J4WH 4TM9A 5DS8A 3ZKXC 3QNXA 3N3EA 3CV5A 5D96B 3WJMB 2RD0A 4QR7A 4Z7WF 1GC1H 5FB8A 1AC6A 1JCVA 1G4RA 1T80A 4WUKL 5HI5C 1PD1A 5ERWB 3WFEL 2N0KA 4YAQA 4NAMA 4G6AD 1S9YB 1M1XA 3NVQA 1KJVB 1RZJC 4AK1A 4OZGF 2XQYA 1QSFB 5D7JC 2V9UA 4R7LA 1RVFL 2ZT9C 4BZYA 2UY6A 1JWMB 3ZXAC 5JYLA 3IS1X 5E99H 2VLRA 5E03A 3WNIA 3HPLA 4L8SB 1PFCA 4ZQKB 4XNZC 3I6KB 1U95B 2MCAA 4GG6A 4M7KH 3NPZB 5BS0B 4RQQA 4CJ1A 2Q8AL 4D0BA 4MA1C 5BQ7B 3CFQA 4OIBA 1YEHL 4PJXA 3FTGB 4H13C 4OB5H 1ORQB 4XAWL 1S7VA 3QJZA 3TNMB 4F8OA 5AEAA 3TA3C 2X2JA 4X6DB 1R3LB 2Z91A 5ESQB 2D2OA 5DQ9B 4MDJB 4D7BA 4KO5A 3F83A 2W92A 1J18A 1IAMA 3FO0H 3O2DL 1WAAA 4DGYL 3P0VH 2WJ5A 3QWOB 4XZUB 4I48B 2JK5B 5EN2A 1DJSA 4QMEA 1FHGA 4K2UH 2R8SH 4LRNL 2QQLL 4AYMC 5C09E 1NGPL 4F8QA 2ZF9A 2WHVA 4JFXA 1QLRA 3CPUA 2XACC 4OW6A 2AAVA 1E65A 1IILE 1IU1A 4MAYC 5IMOB 2W0KA 3X1NA 3MJ9L 3WSQL 2CRIA 1G9EA 4H2CA 3RGVC 1HNFA 1PBYA 4ANUA 1FGNL 2BNRB 1UG9A 5IW1B 3NTCH 5KG9B 4FQXC 1IQWL 3MO1A 5DHMC 3B6SB 2DH2A 5J57B 4GAJH 1QRKA 1BZ9B 3ZE2E 4D3CL 2D7PA 5E6YA 4ODUA 2CLVA 5HGBB 2ZUUA 4I2XA 4AG4H 4EI6B 35C8L 4JFED 4AQOA 1CDCA 3HZKB 1MVUA 3TLRA 3LEVH 3OLIA 2ZXCA 5B39B 4LCCC 5CIPH 3OLEA 3FHEA 3T2PA 3P30L 3O9WD 2X4NB 2L04A 3JWDC 1YYML 4MJ4A 4XMLL 3SZ6A 6TAAA 4BFRA 1DTUA 4HCIA 4GQRA 2MOGA 1U8HB 2VW7A 1R3IL 4NNXB 1SEBA 3IMWA 3WAJA 4GXFA 5AENA 4NAJA 3PABA 4RGOL 2F54A 4HSQA 4P4RB 3TBWB 1U8NB 4QHUA 3X12A 4DKDC 3GJFA 3QAZC 1PLBA 1NH6A 3CMOH 4B9IA 4Y88A 2CKBL 3V0WH 1E5BA 3HLKA 3ZBMA 6FABL 4Z7WB 3QHZH 1OL0A 2D03L 4BHUA 5IT2L 3VH8G 1MJ7H 3V4PL 1MWAB 4JMXA 2KLSA 1NDGB 4DPAX 2WXGA 5HDLA 3O6LL 4PJDE 4OZGB 4ZS6D 5LDSA 2J6EL 1TZGH 5FO7B 1LTXA 4NQVB 4B0MM 3Q06A 1ZANH 3LHAA 4ZAKB 2CO7A 1CGXA 3CFKB 1EMTH 1GGIH 3DX6A 5DUMH 5I6XC 2CSPA 3EFFA 1BWWA 2Z92B 2F18A 5A2AA 1M6OB 3WIAA 1Z1WA 1UTDA 4L4JA 2P7TA 4U1SA 2V8LA 1DBJL 1YMHA 3E8UL 4G9FD 3SSGA 5BXFB 2E7LA 1LQSR 1PL3A 3SO3C 4WI0B 3INOA 4MYWB 2B59A 4TLKA 4XP9L 1MAMH 1WH0A 1GPOH 2NT0A 2WNWA 3EIFA 1B0GA 1A7BA 2EIZB 2VQ1B 1HNYA 2OMVB 3ARBA 4PRBA 1ROCA 1FLTX 5EU4B 5I15H 5KBKA 5FYJD 1WWCA 2JTYA 2X5PA 3K4ZA 1P5UB 4NQEA 2R69L 3IEAA 4H1LG 1SUJA 1VAHA 4FGMA 3RIFF 3EZJB 1NGZB 4Y8DC 5HHMD 4NO3B 3O4LD 3MSPA 5C8JA 3VACA 1MXGA 3RY6C 2CPUA 1E5AA 1LO5A 2XVBA 3TN0A 1QVOB 3CFBB 4Y9EA 5I1CH 1KGXA 4WFGD 4E5XB 1DQJA 3HNVH 2Q87A 2DLIA 1XCXA 2HRGA 2DQGL 3FFCE 4P2OA 5L2KD 3NJVA 4FZ8L 2ZXQA 3CSFA 1URZA 2PYEA 3X3GL 4AQ1C 3ZUCA 1UQSB 3CZEA 1U8IA 2C9XA 2O4EA 1G7QA 2F5BL 5FK9A 5C2BH 1BVKB 1VA9A 5D7IF 4AZUA 5F7EH 4NUJB 2KERA 5F7WC 3SE9L 3WY1A 5KSBF 3X17A 4BQ6A 4HFWA 3FN0H 1YAZA 3KDMB 1T1XB 4NO5B 3RWDA 2HVJB 3FB8B 4HGWA 1T0MA 2EILB 3QNZB 5KSAA 3NH7H 1SFHA 3WD5L 1OCZB 2Z9TA 2DRUA 4PVMA 2VDLH 3H4FA 3SBRA 1G9MH 2AKRB 4BXVA 3ARGC 4DK3A 4APQD 1A9EA 5INCB 4QIRA 5EZIL 3MYJA 4WKZB 1VB9A 2A74B 2C9PA 3OHMB 3WMQA 2HJKA 4OBSA 1JD7A 2ZUWA 3HG2A 1XR9B 3EJQA 3U2SA 5L4IA 3O3BA 4MKTA 2R2EB 43CAB 4OLXH 3KPRB 4FLRA 4YSRA 1ODAA 5FOBA 4M5ZH 2MSPA 4XCYB 3LPPA 4M6OL 1JNNH 1WTLA 1WBXB 4U1HB 3VXOB 5J11B 2I9LA 1IRAY 3EJUA 2HLFC 4BFIA 4H4NA 3RWIB 1ODUA 1T04A 5IMKB 3T4AB 2VZTA 1QP1A 2IGFH 1E27B 4G42A 1KJ3L 5K9QI 3U4EA 5C0AD 4PG2A 3IMBA 4UB0L 4M4RA 3RWFB 2C7UA 4CGUB 4M93B 4JGNA 3TBVB 3D51A 2DJMA 2EKSA 3FU9A 3GPSA 2YBRB 3MA9H 1SJEB 4YEEA 3H9HB 1DE4B 2M1KA 3QDJE 5FGCE 3TBSA 4XMKH 2E6QA 4UIMB 4YQXL 2GK2A 4JFPA 2BP5M 3VXSD 2LGNA 2UZIL 3G5XB 4GKLA 3VD0A 3WJLC 1DP0A 3QQ9D 1WA2X 4ZZKA 4HJUA 2VLKD 4HT1H 1OAQH 4G2AA 2OZNA 5KBMA 1R3IH 2W60B 3F7VA 3UTTD 1L0XA 3N40F 4K9EC 2XQBL 1X6NA 3C2AL 5E8EA 3VXRB 4UT9H 3QNYA 3FU6A 4M1GL 4O58L 2OR8A 1R4XA 3WKYA 5C7ZA 1JFQH 2B8OT 3FSZA 1FFNA 4GBXD 4OZFG 1A25A 2BNQD 2AV1B 2MNWA 4KKAC 1O7DC 2D03H 3OKLA 3IETB 4AIZB 3FSOA 5B38A 1Y6NR 5C0CB 4A04A 3O6LH 4Y16A 3SDDC 3N55A 1OARH 5J8OA 3BDXA 1P7QB 5BPPA 3V4VB 5KWYC 3FCUB 5K5YA 3MN8A 3UAJD 2PCXA 2EICA 3FB5A 3ULVE 3GINA 3BH9A 3G6JF 3QE5A 4GAYA 2WXKA 3FQNB 5T1DL 4F2ME 5SWQB 4FNPA 5HHVH 3RPIA 1MWAL 1TQBC 1KN2H 3E1ZA 3MOAL 4HHAA 2HUEA 4OJFL 4GMTL 2X4RA 1OM3H 5D7IB 5FGBC 5F9JB 4NBZB 4JJ5A 4KRPB 5EORH 3RL2A 1TZHB 5KSBB 2EDRA 1DO5A 5JOPE 3QDME 3OKMA 2GSIA 2NZIA 2YD0A 4ODSL 1XSKA 1UD8A 1AGDB 3GNML 2X4UB 4L9LA 3AU1A 2X05A 3AY4A 5DD3H 1AGFA 2Y23A 3U1SL 4A2GA 1DJWA 4N8UA 3ASWA 3VVWA 1BVOA 3CIAA 3AB0B 3FO1A 1KB5H 2OMTA 2OA9A 2H32B 4YHZL 1ZHKB 4HZAA 4WWID 2FEEI 3T0XA 2A6JB 5KTEL 1CXEA 1AZRA 2HWZH 3WIFB 4NUMA 4OKVB 3O6ML 3QPQC 4PLKD 3S9DB 3TH2T 2WQ8A 1AGBA 1LHZA 2AANA 3EYSH 4FD0A 4UOZA 5AB2A 3I02B 4PGJA 2FWOB 2DIJA 2JKNA 2WW8A 3PL6D 3VX0A 4YN3A 5FFOA 2FECI 3IDMA 4O4YH 4UNTA 3LPWA 4GQ9H 4X99B 1YEDB 5ESVB 3NACL 4JRYB 4X6CF 3DX3A 3TURA 4PRHD 1YC7A 3LQMA 5D2NB 2Z8VC 1QYGH 4Y5YB 4LOUD 5E6IA 3WN5C 1UWYA 4Y4HA 2X12A 4DP6X 1UOLA 4Z7NE 5D71L 3VQMA 3ESNA 5HHXL 4PTUA 1QRNB 5K9KB 1FO0B 2EYTA 3HI6L 3H9SD 4N9OB 2BS9A 2K8QA 3EBIA 2EDNA 3PXHA 5D9SB 1JHLH 1A7PH 1QASA 4OV6F 5B1BB 1K3IA 5IG7A 3I75B 2NY6C 4WW2F 1N0XL 3K6FA 4N2IA 4DGVH 1INQA 3RG1C 3EHBC 2EDKA 1BREA 4Q2ZB 5IJDC 1O6VA 1N5YH 5FYKH 1PZ5A 3B5GA 4Y7MA 1C1EH 3P02A 4G5ZL 5AYUL 4YLQT 4KVPA 5DC2A 4JFFA 3L95B 5F7UA 1HL9A 2NR6D 3H7LA 4F7CA 2HPOA 4F2EA 4YDKH 4E2OA 3G5VA 3RVXC 1J0ZA 9CGTA 3O8XC 5J13C 2FT6A 3UPCA 1REIA 2FZ3A 4HCGA 1A9BB 4K5OA 4W4NA 4WLCA 4YR6A 2DIBA 4JDTH 4ODVH 2CG9X 1P1VA 3DBSA 2BOCB 3FO9A 4RMWA 5I1LA 4I18A 2XPGA 4DO5A 3GLAA 4XB7A 5DZ9A 5CEZL 1EAJA 2C1PA 3G6JB 2EUVA 1XGUB 4AJVA 5C7XL 4OCSL 2HVBA 1LE9B 3J2PA 4IHOA 2F6AA 43C9A 1U8CA 3NGBC 2Q6WB 1UENA 1CG9B 1KTRL 1VACA 2FSDA 3DHPA 1GH7A 1MJUL 2YGNA 1V3JA 2CO3A 3N04A 1GS8A 4P46D 5HVGB 3VMPA 4JUTA 1WAAF 2GAZB 2RFXA 4GP4B 4NFBA 4X9IA 2ZYRA 1DSYA 1NL0H 3WBDA 3QUZC 3QXVA 4HC1H 3ZR6A 1WC7B 1UT1A 2E9WA 1RZGB 4P59L 4OGQC 1NPUA 3HLAB 4Z7OE 5IJCC 4DVBB 5I5RA 1MIMH 4O2CA 5JLZB 1FCGA 4P3DA 3DVGB 1OOAA 1FFOA 1N0LB 1WJ3A 4ZNCD 4TN9A 1A64A 3MBWB 3LRGA 1OGTA 3FRPA 2DZEA 4XCEB 1LE5B 4JG0H 1DQKA 5H37H 1S5HB 1R47A 1JVKA 4IQHA 5B4MD 2EEDA 2Z35B 2EE2A 5SV4A 4ALAH 5KJ7E 4ZUTA 4XPBL 4JQIA 3BGFB 1KY7A 1T5WA 1WFTA 5CILL 3X14A 3WEXA 4X6CB 4ENED 2L0DA 1MQKH 2C9QA 2FD6L 2EDMA 3D50A 4L4TD 1VESA 3V6OE 2P46B 3PIQB 3EJPA 4LCUA 4LNRB 4TVUA 4XC3L 5D2LE 3RY4A 4DTGH 4X5RA 1UJ3B 2QQNH 5D8JL 4Q9CA 4NQCE 3LKOA 1Q9OB 1BPLB 2P80A 3Q3GA 1KUMA 4M6NH 3SO5A 3TWCL 3QXAB 1H0DB 5K59E 1NLBL 1J1OH 4J3UA 2Y1AA 2YQGA 2DQEH 4WU5B 4CVWA 5H4ZA 2BO0A 5E6RB 3P9LA 4W9FC 3OR6A 5ENWA 1KDJA 1F42A 4UTCA 3PFQA 3PAVA 5A6IA 3SKOB 1YQ2A 4U6TA 3S37H 2DIAA 2QSTA 1WS8A 2IDCA 2Y25A 4WW2B 1NGYA 1UXWB 1CFNB 5DS8B 3PE9A 4J1UB 3DMMC 4MCYB 3C5XA 1XGZA 4Z78A 3NCWA 3C09C 4YBLC 1DSFL 5EA0L 1YEGH 4LIQL 4CDGC 1RZIB 3WTUA 3NCJH 3E9TA 3GXIA 1YUHB 2VIRA 3DXAD 5D55A 2OPCA 3DSFL 2UY6B 2J88L 5I6NA 4LKCB 2ZAHA 4I88A 5JW5B 1WFUA 4FQ2L 3HN5A 2KQMA 5CJBA 2JMRA 1BF8A 2VLRB 3C8KB 3HPLB 1CE1H 5EF1A 3NA9H 4OT1H 1ZRUA 4M56A 4K5MA 2K4WA 5IROA 2BXYA 4RQQB 5GGVL 1OTUC 2BSCA 4G8AC 4GQZA 1JSYA 2TRHA 4TNVK 4YL4A 5D71H 2EKJA 3IFOA 5AG8A 3OMIB 1KTBA 3ZSSA 2UYLA 5E08L 1Q9LA 3PJSA 1QBAA 4AEEA 2FRGP 4JHAH 1N10A 3B2UC 2MKLC 2C4FT 1KB3A 3QG7L 4Y2DC 3O6KL 2KT6A 1TXKA 3X11A 3VFRA 4QRAA 1FO0L 1G9MC 2HCZX 3KL3A 4M6MH 1GW0A 5BUAA 4FQIL 4HIIB 5EF0A 1QLRB 2A0LC 2V5RA 1A7OL 2YPVL 5I18L 2LHAA 4OI7A 3RKPA 2P3YA 4LEEA 5DFAA 3CFCL 4WJKB 3HEIB 4WU7A 5F3HA 3RTQA 5ISZE 2GEEA 3HA0A 4GSQA 2GG1A 3GZKA 3PJNA 4TNEA 1DBKH 3WDHA 3MO1B 3QFDB 3HE7A 1Z9OA 3UZVA 4C47A 3F64A 2AJXH 3AJ7A 3GMPA 3QJQB 4DUWA 2ZKHH 3F6JA 4N0UE 4M8QA 2FJFA 4KUZH 4ZMZA 1INEL 3Q2LA 1RU9L 3ILEA 5LNDA 1CCZA 2YD7A 5I8CA 5I75B 1JGUH 2HKAA 2XWTB 5HI5D 3L3OB 4IGBC 1BQSA 4L48A 1E6JH 4ZW8A 5FDWA 4G6JH 4JPIA 5BO1L 2FWUA 2H2SC 3DPDA 4JHWL 1NC2A 1OAXH 5D7JD 2QSCL 4FMKA 1RMFH 3VGAC 2WZPA 2WKLA 4JB9L 4O9HL 2BDNH 5HI3D 3KMDA 1G7PA 2EH7H 4D0CA 1I3RB 1EAOA 2DV6A 4HOZA 2VXUL 1CLYH 1QQDA 1FN4A 4XVUD 2AK4E 2BM3A 1NPNA 4FTVD 4WWKC 3KHQA 2C1OB 4KMTH 2EC9T 3S96A 4XOEA 2VDMH 2E4TA 1NCDH 4F1SA 3ARYA 2CQVA 4HZLA 2BNUB 2DQDL 2DS4A 2FJHA 4NJAL 2XETA 3TA3D 3KE0A 3L3KA 4KKNA 2GY7B 2D3NA 4YHKL 4HD9A 4Z3GA 5F7FA 2IJ0C 1MCPL 4DN3H 3D0VB 1K4CB 4Y2LA 1G9NH 2EQDA 3F01A 4G8GA 1AOZA 5GRVK 2CO7B 1TSRA 4QLWA 4MMXB 4D0DB 4JZJA 2IH9A 5DO8A 3EFFB 5C07D 3T0EE 4H8WH 4UU9A 2Y7QA 1KN4L 2IG2H 2EECA 3SE3A 2P7TB 2VMCA 5IK3A 3V4VH 1YMHB 5C6TL 4MAYD 4X4XA 3RDTA 4ANVA 3RGVD 1UT9A 4ZZFA 2CK0L 5AKSA 2B59B 2CU9A 1I8LC 2H26A 2R2HB 1WPCA 3B2VH 4R0LC 4FQXD 1D5IL 4WI4A 5FHBH 5EZLA 4PRBB 4A2FA 3RWJA 3LKPA 2BFVL 5I1EL 1YEKL 2W0FB 3APDA 2WTRA 4B97A 2K7QA 1NKRA 4LSUL 4HU2A 1G84A 3D0AA 3VSTA 2F8VA 2JXMB 4ATTA 1T0NB 5F1IB 3S8GB 4OV5A 3GMMA 3X1FA 1JHTA 5H8DA 3R4RA 1MFBL 2COQA 3BISA 1OB0A 1Q9KA 2D3JA 3CDZA 1LO5B 3TN0B 1AE6H 1XD0A 4XX5A 4YSPA 1NJ9B 4HWBL 4C4UA 1YAIA 5C08D 3IN0A 3R1GH 3RX5A 2OFQA 2YUZA 4BUHA 1RUKL 3I9AA 4XN7A 4GRLC 3QQDA 4HD5A 4P2OB 5DC9B 1R0AL 4LE8A 4N2EA 3RLSA 3QAQA 4YXHL 1HXKA 2PYEB 3TO4C 3BQUA 2C9SA 1A6AA 1U8IB 2Q76A 3HVNA 1L6ZA 5D96C 2EE3A 5SX4H 3FTSA 4LT7A 1A14H 4EDWH 1M1SA 4LXFA 1ASPA 3MUY1 4FXGA 1ULVA 1XEUA 1SY6H 4HFWB 3VXTA 4DWHA 3PGFL 5JIIA 1OQOA 1XL4A 4Y4FC 3GSUB 2JCCE 1I8AA 1TQCC 4QI3A 4AMKH 4ZD3L 1TZIB 5HPMB 3A6BH 2IFFL 3WGVB 5KSAB 1QG3A 4JM4L 1PZ3A 3Q8AA 4PRAB 2LE9A 5LJYH 4L8SC 2IH1A 3CMGA 1YEJL 2ZUYA 1A9EB 2IQ9L 4XN4A 3QC6X 3MYJB 3MRQB 1DO6A 3N40P 1A4BA 1A6VL 1RQ5A 5D4HA 5MEPB 1YQVL 3O3BB 4LU5L 2DQJH 4ETQA 5KVDL 5FOBB 2BWQA 5I1KH 2KZKA 2JJSC 5FX3A 1UVQB 1F4AA 4QTIL 5I1AB 5T3ZH 5L8KB 4BFIB 1WUZA 3FULA 4E9RA 1T04B 3F7PC 4U1KA 2ADIA 3DJ9A 3JVGC 1RIVH 4WHCA 4BH7A 5K9OB 2NY7H 1ZTXH 2W94A 1BPVA 3CHXA 2YD9A 4M4RB 2H9GB 2C7UB 3QO1A 3UJIH 1D5MB 1SVZA 2HKHH 2YZ1A 5EBWA 4ZW5A 5JPMB 1G5GA 3IGAA 5EV7A 4F37K 3D85B 4DAGH 4JO4H 4P23A 2XN9D 4IOIA 2DLHA 4XXWC 2FLRT 4ZXBA 4GYBA 2WY3B 5HYSB 5G4OA 2VZ3A 4X98B 3F2LA 3VFGH 4ZPVA 4WY7L 4TMPA 1N64L 4FP8H 4BJLA 2ENQA 4J23A 2VDNH 4HYTB 5DD5H 4XI5C 3IU4L 4JB9H 2PUQT 3F7VB 2VLJD 2ZWNA 1KEGH 2QV4A 2W9EL 4JPWL 4UTBL 4YPJA 3ZY7A 2NYYC 4G6KL 5E8NB 2ESVA 4BZ2H 5LB1A 4KPHL 2ADJA 4P49A 1E4XL 1FFNB 4DW2L 1BXUA 5I1IL 1ZJAA 4OCRH 1HQRB 1SJHA 2EDEA 3OKLB 4LEXL 3F7LA 4JFUA 4Q97A 1LVEA 1N67A 2R7EB 1JXKA 5B38B 5I8EB 1S7RA 1TJIH 3CPLA 1BX2B 2B14A 5F8QC 1KACB 5DZLA 3ARGD 1PZCA 2UWEE 3G3LA 3FB5B 4B50A 1KBVA 5DVPA 3BH9B 1JG9A 4GAYB 3EDKA 1DVSA 3RPIB 1T5XB 4ZSOB 2PR4H 3S0PA 1WK0A 1W6WA 2DTMH 4J3TA 5MHSD 1WWWX 1R3JA 3FCGA 2X4RB 3QCVL 4XMTA 3ARRA 4ACTA 4JJ5B 4N3TA 3RL2B 4WHTA 2GTWA 2P8MB 2QR0A 5GS0H 5DC0A 3GYRA 3K1KC 4GRWH 2HLFD 4H5SA 1NBZB 4L9LB 5TF1H 5FUZH 3SYOA 1KIRA 1AGFB 1TVBA 4FCHA 2JQZA 4Y1AA 3WLWC 4YHPA 1YYLL 4CILA 4ZAKC 1SGKA 3FQUB 3BEVB 2L4OA 3GBML 5DS1A 4F9PC 3UBGA 4BRVA 1JZ8A 3FO1B 4JFDE 4HDIB 4JDEB 4HA1A 4LLMA 4IHBA 4XVSL 1EPFA 4DF9A 2K6WA 1HOCA 3HBQA 4XMPH 5EH1A 1AGBB 2OR7A 3QCUH 2A83B 4MKMA 4F8LA 1T2QL 2B0SH 5LWYH 5KJRH 3EOTL 2D7NA 5HDQL 1QX1A 2PCPA 2ZUXA 4ISVA 1KXTB 2AQ2A 1P5UC 4G8EB 1KCUH 1OCWL 4KVCL 2QKIA 4HHGA 4HIXL 3CFUA 2A6KA 3ESVF 4KNQA 2WSKA 5BRZD 1E3FA 1RFDL 1BQHG 5I5JA 3ZRCC 4M1CC 3GRWH 4GKZB 4FXKA 4NZUH 5DJAA 5MI0C 4PS8A 2QMJA 3F7YA 4PTUB 2EYTB 4KKAD 4UQCA 3P0GB 2IV8A 4LZKA 5LCVA 5SWZA 1IVLA 3ZE1F 4HS3A 5HTSA 3MNZA 3N0AA 3CFJB 3SDDD 3PP4L 1KTDB 1X9UA 4X9YA 2ZCLL 4UT6A 1S4IA 4JX0A 2OZ4H 3OJMB 1NAMA 3UFIA 2F8XC 1ORSA 3BP4A 5TFSH 4U7KA 2RACA 3NDYE 1QPPA 4ZUVB 1DN2A 5C0EA 4JFFB 3NG5A 5DRNB 3FCSB 4F7CB 5B1CA 4Y5XC 4N85A 2E47A 1BAWA 1JGLH 3DDFA 5ABDE 1EEYA 2CPCA 3NDZE 1CQKA 2CHWA 2E74C 2FZ3B 4MZRA 4YR6B 5MERA 4WK4B 1TCRA 3IF1A 4X9HA 4MBOA 4QKTA 1NCNA 4Y4KA 3ZE0F 4MMYA 1U2YA 2F1AA 3WDIA 4I18B 1L7IL 3VFWB 5I1LB 5KYXA 5IEKB 1DJZA 2NNAA 2C1PB 4FFZH 4DGIH 5CZXC 2WB1A 4JKWA 3RB7A 4I7ZC 4JQXA 4ZJ9A 1PFOA 4DN4L 4QJ4B 1T89C 5M7QA 1H15A 5J11C 3VI4A 43C9B 3QPQD 1ZHLB 5T1LA 4DOHE 1BQUA 4MA8L 3PQYE 1QFOA 4JFYA 4MNQE 3T4AC 1XBDA 2XY1A 1VIWA 1LLAA 7PCYA 5J6GB 3RFZA 2E9JA 4F7PA 1KENL 2XA8H 4ESKA 4U3XA 1V27A 4M93C 4AZ8A 5FYLH 3FK3A 2RALA 4OQTH 2JI3A 4QGYA 3OHXC 3GXMA 1NGQL 3VYNA 4NM8L 1KTCA 4N2BA 4PJ5A 1F4YL 4PCYA 1Z5YD 1ZWIA 3FB6B 1F56A 3EZ8A 2NY2B 4IJ3B 4IMLA 4S2SA 2ZXGA 4O2CB 3MKGA 1FCCA 2BIOA 2OL3A 2YJLA 5D1XA 4P3DB 1FFOB 1YZZA 2BHZA 3ZL4L 3L81A 3SKNA 3BD4A 1OGTB 3PDOB 1OAYL 2CUHA 1ZT4A 3OXSB 4LSDA 1M7XA 3IFNH 5DXWA 3KJ6H 1P84K 2YAQA 4JL1A 3VB9A 2NTFA 4NUGL 3KLQA 1A6TB 1T5WB 1MFAH 3X14B 1EHLH 5I19L 2DMBA 1U8KB 2W81C 2ERJC 3PP3H 2VDKB 3EHBD 1OGAB 1XBRA 1MIEL 1CFSA 2LV4A 2DYPD 1Y1DA 1AQ8A 4AGOA 3CK0H 4ZG1A 1OKEA 4WI3A 3CE1A 3T6ZA 1VJSA 2K3HA 4RRPM 4FNSA 3Q3GB 4DQOH 1AKJA 1I1RA 2BVQB 5DD0L 4NWUL 4QXGL 2VR7A 4UCFA 4XBEL 3RVXD 3O8XD 3ZE1B 3WENA 4YFLI 4FQCL 1EH9A 3T9WA 2ZCKL 1CGSH 5ANME 4RISL 3SJVD 2ATPA 5SX4I 2PABA 3OR6B 5D70H 1L9SA 5I8KH 5EEYA 5HHNA 3LXCA 1CTNA 4PUBH 4RWYH 2H2PC 2ICES 3MLSL 3KPPA 1NGYB 1HZKA 4KRPC 4OTXH 5FYKU 2HRHA 5H37G 1ITBB 2CHDA 3UTQA 1Z3GL 5IY5B 4NM4L 5PCYA 5BRPA 3QIWB 1X9RA 3ZGIA 2HJLA 3GM0A 2VRQA 1MRDL 2ITDB 4GKSA 3CZLA 1UZ8A 4LARL 1RK0A 3KM1A 1CL7L 4E9LA 3K3QA 3V4LA 3FF7A 1K5NA 5IB2A 5KW9L 4HIXH 3QUZD 4JRXB 2V8MA 1O5PA 3ZE0B 1NZRA 3V5KA 2CBOA 4MB5A 3MXVH 5GJTH 5I0DA 3HE6A 1ZY9A 3I3EA 4XP6L 2OMYA 5JQ6H 2H47C 2UYLB 2YMXL 3DOSA 1TOXA 1JL8A 1MQ8A 1PCSA 1YPZA 5J0BA 4KFMA 2Q9OA 5EBLA 4RGNB 4A6YH 4TL4A 3BXNA 2R4RL 2EXWD 4FEIA 3MRRA 3GSNB 5BZZA 5FUCE 4Z7UA 4UNVA 5BZDA 1MCJA 3WS6C 2G5BA 2NY5L 4RETB 4J7RA 1QSED 4OZ4B 3X11B 3VFRB 4HIHA 3L7EA 4B7IA 5D7LB 1E7VA 1U3HB 4AL8H 1A65A 3BDYH 3ZHFA 5ABZA 5CCKL 3LQZB 5I73B 3AFLA 4YSDA 2EE9A 2VXQH 1V8HA 2Q8BL 3CHPA 2NX5B 1T83A 2C8NA 1SEQL 3MX0A 4BUGA 3RFRA 4OCNC 4WU7B 2H3XC 4RZKA 1CK0H 3LZOA 3OB0K 1A0QH 3LN5A 1D9KB 5F3HB 3ZDXF 4UTAH 3V7AE 5SV3A 1UACH 2E6JA 5IBLC 2AQNA 3ILQC 1OW0C 3HE7B 3BUIA 3KPNB 3MLUH 4E5XG 4JLRA 4HLJA 4ZMLA 1FL5A 3F58H 3DX4A 4M8QB 2FJFB 1AMYA 4WUUA 3P2TA 1JGDA 2WBJB 4JZOA 2QMKA 2ZJSH 2ENPA 5I8CB 1QFWH 4WI6A 3X3FH 1MREH 1MPAL 1DBAH 1EZSA 2WWNA 1E9QA 1S5IL 3D8MA 3B9KB 3NIDE 5FDWB 2AW2A 4BRJA 4YHMH 3INUL 3RU8H 2D7MA 5T1KB 4JPIB 2CKNA 1X5AA 5CUSH 3TFKC 1AKPA 1NC2B 2BJML 5C0BD 2MPAH 3OAUL 1FIGL 3TX4A 4GSXA 1G7PB 3DK2A 2A2QT 3BE1H 5F9OH 4KKZA 3MV8E 4KKCC 1ZLUH 1SJVA 2A9NH 1IM3D 2X2HA 1M9WA 1QQDB 1FN4B 1AXTH 1OTUD 2MQGA 5I6PA 1GHFH 4EUPB 5KYWA 3ZHKA 3BSZA 1QFHA 3S96B 6PCYA 3MRBB 3UTZA 3Q05A 2Y36L 3CVHB 2NPLX 2XV2A 4HZLB 1J1XL 4A2MA 2FJHB 3U7YH 4MJIB 5LAPA 1YMME 1BECA 4N2LA 4AM0Q 3B2UD 2ITCA 4BK4A 4OLUL 4Y2DD 3KH3A 3QPXL 4IS6A 4DP5X 5DLLA 3HFMH 1F3RB 4G8GB 3UAFA 2X1OA 3SE6A 4LNVA 4AIOA 3OJDA 1FNFA 4PEEA 3MOBL 1IAIM 1PGRB 1WZ1H 3MRCA 4LAJH 3GIZH 4GRMA 2VXSH 4KZDL 1GMIA 1NIBA 2GJ6D 3T3PB 3OXRA 2A0LD 1T66C 2UZYA 4PJ9B 1G0DA 4JQIL 4ONFL 3B2PA 5IK3B 2G3MA 4PB0L 3IRPX 4PVLA 3U83A 3RDTB 1GZQA 3CHSA 1D6VL 4AYID 2OSLB 2VDKL 3BGFC 4ELKA 1F58L 3CLFL 5E2WL 4GW5A 5FWQA 1ZVSA 2C3VA 5LNGA 3LKPB 3DDGA 1BFOB 1HZHL 3EH5B 1ED3B 5F89A 1V7NH 4QWWC 2WTRB 3MLRL 4WAFA 1PAZA 4B53A 1IFHL 4I9XA 2NSXA 3SCMA 4TTGA 5EC1B 2ALAA 1BHGA 3GMMB 4IK6A 3B9DA 2Y07H 3U36A 1C5CH 1MHPL 2IV9A 2KMWA 4KV5E 5DUBA 3GSXA 3MLWL 5CGMA 1OANA 3IMVA 1FG2A 4L5FL 1Q9KB 3A6OA 4IGBD 5FEBA 1H3TA 4FNQA 3KWWA 5EU6D 3AW5A 3ZDXB 1CDHA 2H2SD 3BPCA 4LLUA 5IFJB 4HALA 4Z0BL 3MMEA 3QQDB 4YPGB 5C0DB 4X5LA 4R7NB 1CGWA 4WW2C 3JWNE 3BQUB 4EUPA 4GAGH 1U8OA 1Z0MA 2YC1A 2Y2TA 4L4VA 4HPYL 1UD5A 4OLYL 2WBKA 3HUJE 1CFVH 3VXME 2VM3A 4WWKD 3CFEA 3VXTB 3QRGH 3EYOB 5DEFA 4BSVA 2VDOH 4O2EA 4Y5VC 5LXGH 4ZMPA 4FQ1H 2YPKA 3K72A 3Q6GL 3MDJA 2X1PA 3FQYA 5EEZA 3OKDA 3DYPA 3MV9E 3OC8A 3BVTA 2DM2A 1IKNA 4PRPA 3QDHA 2XTJD 3FT9A 2IH1B 5F6IC 4FA6A 3ROOB 4BWTA 3MRLB 2FO1A 1O6SB 1R3KB 3T3ME 1E8ZA 1QO3A 1XDTT 3TT3H 1MRCH 2XKNA 1BXXA 2V3EA 1CGTA 3NSYA 4C55A 3D4GA 3JUYA 5DWUH 1AO7E 2WWKT 3GSNL 3MUJA 4ETQB 2GITA 3BAWA 4LSQH 5CU5A 3RJOA 5TJWK 4YK4B 3EJTA 5FV1L 3W5MA 4MJHA 2J43A 5DVLA 1Q9WA 2B2XH 2HFFA 4KTEH 1TTBA 3FRUB 3MVSA 1RP9A 4RNRA 2ADIB 4MMZB 3QXTA 1LO4L 4MZ3A 4NT6A 2E9GA 2N4IA 5F1KC 4DJMA 4AYDC 1KJ2A 1NINA 2YAMA 2DLEA 5EBWB 3ARDB 3MR9A 3MLTA 5LQBH 3I74A 1JPTL 1NC4B 3HS8A 3RZCB 2OMWA 3QXWA 2VR8A 2OULB 3P0YL 4EDXA 4ZPVB 4FI8A 3UTSD 4H88H 3POHA 4JY5H 2VAAB 4GXVL 5J1AB 3LS5L 3OAUH 1AMXA 2YK1L 1GVIA 3D3VD 1XXDC 4S1RH 4X4MA 3O41A 4AWJC 4ONGH 5CJOL 2F9BT 1UM5H 3P3YA 2AQQA 4HVBA 1W8NA 3TO4D 1OSZA 3T5WA 3QS2A 4HUWA 4JKKA 3AREB 2F15A 5I75C 3LQAL 1IAIH 2GBAA 2H41A 3IJ7A 4P5MA 3L3OC 2XX1A 4FJ6A 4PY8J 5DR5H 3IK2A 1QHPA 4Y4FD 1C16B 2Y1YA 1QSFD 5GSVA 4GXUM 5E6SB 2LU5A 3CPLB 5KVGH 4A2HA 2EDYA 1A8JH 3IGKA 5BVPL 5IESL 3D34A 1W15A 3WG7B 2AEPH 3TP4A 1F1GA 3VM7A 1A47A 3F8UB 2VXVL 1WFMA 4J27A 2IGTA 5CINL 4N9GA 3CVHL 5BS0D 4JFEA 1DSWA 4OCWH 2QV2A 5C71A 1R3JB 3C12A 1UFUA 3P2DA 1HH9A 5E2UL 3VI4F 3D48R 1A22B 1DBBH 1NIDA 3MUGB 3TIDA 4WHTB 2GTWB 5T1MA 3M7FB 1RPKA 1WZAA 5FYKD 1RUAL 3I6LD 2JIXD 3L1OL 1T4KA 2EAEA 4AT6A 4H5SB 1YECH 3TONA 2F1BA 3GS7A 5F7AA 1F4WH 1PIFA 4BDVB 4BSWB 1KGCE 3FFDB 3PWJB 4LLWA 4Y1AB 5I1DA 4PWHA 4YHPB 3GSRA 2ARJQ 1Z6JT 2EE6A 3ZTEA 2AJSL 1DJXA 4KY1H 4MMXC 5KANI 1OVZA 4H20L 5I8OH 5F0LB 1WRFA 3MLRH 1PD6A 4OD2A 4FZEH 1GL4B 4CSZA 4QHNB 4LLMB 4ZNEA 5L7XH 1SHXA 2JELL 1D3CA 4TSBL 3L17A 2E7LC 1HOCB 2FWLB 3VG0H 4FAAB 1I7ZA 2HX7A 3S36L 3EDEA 2BNRD 3CFDA 1P53A 4I85A 2CGRL 4C83A 5ADOL 3IDGB 1LEIB 3Q6FB 1J9QA 3SKUD 4XI5D 2AV7A 1IKFL 1DVUA 4PJCE 2QKIB 3QEUA 4ERSL 2CWRA 3DKHA 4YDZA 4NKDB 2A6KB 3D4YA 1N6QL 3SKJH 5IJBC 4LLYA 2JSFA 3SPVB 5JOFA 3DK0A 4FL4B 2ED6A 4G6ML 4HJJH 4OJAA 1MZZA 4YGVB 5DJAB 4HG4K 5FPIA 1HKLH 1MCKA 3TN0C 3F7YB 4ICWA 5EUKA 3GXNA 2Y2WA 3ZTNH 1YA5A 4TSCH 2XZAL 2NXZB 4GW4A 5SWZB 5DHVA 3VAEA 2SEBB 4HS3B 3SQRA 4DZ8A 1OPOA 2F08A 1QW8A 4YSSA 2I7OA 4DERA 1A3RL 5DLML 1X5IA 1AH1A 4FQJL 3AITA 4FFWD 1E2ZA 1F6AA 1ORSB 1QFWI 3K2UH 3BP4B 3C60D 4ETYA 3ZYZA 3FMGL 4F92B 2VO5A 3L3JB 3O4LA 4ZMTA 4MHHG 1E30A 4P2AA 1SYVA 3IU3A 1YG9A 3LS4L 4AJYV 5KSAC 1BOYA 1MNNA 1FUNA 2FUQA 5GS2H 3RAJH 4BKLA 5DJYA 4KK8C 3OQ3B 5FO9A 1HEZA 3GHEL 5L2KA 4RMQA 1SN5A 1UADC 2WBXA 4KNUA 3AU0A 3FFCB 3ALXA 3IF1B 5MERB 3WLWD 3ULVF 1UOWA 1J8KA 2VQTA 5IGXL 3P9MA 1H6EA 4IJTA 4PGBA 3THML 2IFGA 2NNAB 1HILB 4I77H 1F45A 3P4MA 4XP5L 1RZFL 3IBOA 4CADB 1KFAL 4JO3H 1H8LA 2IMNA 4H25A 3VI4B 2A6DA 3OR7A 1SPDA 3IYLW 3WUWB 4PB9H 2FVNA 1FRGH 4TOYH 2A77H 2CJUH 3NIFE 4N8CL 5EO1A 5TE6H 3TEZA 1C9SA 1PSKL 1F0LA 2CRYA 4Z7UF 4GH7B 3RFZB 3A67H 4NLHA 4NZFA 4APQA 1S7QB 1BGXL 1VADA 3I9IA 5JPMC 4NBXB 5MENE 4TNWK 5F97E 4AGLA 4BH8B 4PJ5B 1HK6A 4IMLB 2QQQA 4J8RA 4S2SB 5G2NA 5DMGC 4M1CD 4YH6A 2F1EA 2OL3B 3UBXA 4APXA 1HINH 2FQDA 3SKNB 2FIKB 3SOTA 1G6RH 3MV7E 1ZT4B 1EUTA 2QSVA 5FIEA 2DWSA 2J3SA 1G7HB 2VW6A 2NTFB 3AY2A 3QW9A 1WBYB 5C0AA 5IESH 1G7JB 2NTSP 4I9WD 4Q6YA 5ALCH 5F72S 2HPTA 5CINH 1ZLSL 1DJGA 3CVHH 3HKZA 4HOWA 1GZPA 5FHAH 2X0UA 1CFSB 1FORH 4WFEE 3ZDZE 2J21A 4NOFA 3TVMD 1G6VK 5C6PB 3VXSA 2BRRL 2R56H 4WFFD 4BWUA 1AKJB 4QRBA 3ZUNC 5MP6L 3AVEA 4JO1L 2O5YL 4YE4H 1MY7A 5A2CA 4XBGA 5IUCA 1ZHNB 1QFUH 4WSKA 3T1FB 2ATPB 3O3AA 1E7UA 3T2NL 5HHNB 1ZTMA 1S7XA 1CBJA 1CD1A 3BGMA 4ZOAA 4R26H 3KPRD 1BZ7B 4KDTC 4MTMA 5CZXD 3UTQB 3PWNB 4GBXA 3AC0A 2BNQA 2X2UA 4PJ8B 1EX0A 1UEYA 4Z3FA 1HT6A 5I0ZA 1JZ4A 5A2IH 3NEEA 2GC7C 4L9LC 3S36H 2HJLB 3M07A 4OZIA 3AY4C 1B0WA 4GS7B 4Z7VE 2XFXB 5FGRA 4GKSB 1JV2A 2CGRH 3JV6B 4P99A 4I0CC 4RCAA 4AMWA 2JVUA 5E24E 4MJ6A 1RK0B 5AALA 3UZQA 3IT8D 3LKRA 3UAJA 5KJ4A 1ES0B 3L3GA 4LPWA 1K5NB 5IB2B 1KF9B 1NOAA 3TBBA 1NGWA 1T0PB 4F2FA 1CDJA 2CCLA 1KBKA 3EH1A 2A99A 3LZPA 1MSPA 3CXDL 1MFCL 3OAYH 3KCPB 4RH4A 5CGYD 3TJPA 3PS6A 4QEGA 4L2LA 2V7HA 3HIZA 4GIAA 5FW7A 1RAMA 1K85A 3CG8A 4U7MA 1J1PL 1O7VA 2W59A 1CF8L 2OMYB 3RHWK 5ADPH 1KPRA 4NN6B 4N28A 4OZHE 5EBLB 4QHMA 3TT1L 1NANH 4TQEH 4N2OA 3E6FA 5IHZA 2P49B 4E42B 4Z7UB 5LHDA 3AACA 5BZDB 3J07A 3VXRD 5E8PA 3KXFE 4AQ8A 3D69A 3LRMA 2V5SA 4Z7OF 1DN0A 2NY5C 3JZ7A 5D1QE 4OM1H 5LCVL 3PAYA 4P5RA 3LXUX 4HJGB 4N2FA 2OS7A 3LH8A 4LSPH 3MX0B 3ZYIA 3H6JA 1T3FA 3C6LB 5C0CD 3QUXD 5EU5A 1NCIA 2FYYB 3PL6A 4Z76A 1P7QD 1U58A 4L3EE 3ZMNA 1RL1A 2ZOTA 1Q0YL 1H3WM 1AZZC 2WNXA 2D4FA 3G6DH 2F0CA 2Y1VA 4JLRB 1IAII 3S7GA 1T6VN 3VXPA 4B60A 3D39A 1F8TL 3WELA 2H2PD 4WUUB 1OF2A 4KI5E 3OPZH 5FOJA 1WCBA 4HUMB 4JZOB 4AUUA 4ODHH 1S7SA 4LQFL 3SDYH 2B4CH 5D7SH 4QJ5B 3Q5OA 3H9SA 1LMIA 4KFZC 3QNFA 2HYMA 2GYSA 3P3UA 2F53D 2DYRB 1WEJH 2NZ9C 3NJGA 2J5WA 2Y06L 3VFSB 3MLVL 5DJCA 5DJXA 1AS8A 5A3ID 4KMLB 3J27A 4CC4C 1ANUA 2ZXAA 4FLOA 1J5DA 3HMXH 1FNEB 4QRRE 4W9HC 4YC2B 4PV1C 1T1WB 4LBAA 1JTOA 3GLDA 2EDWA 1LYQA 3ECQA 1O7SA 4XVTH 5B3JE 4TTDC 2YGVA 2IDUA 3B7YA 1MCNA 4GLRH 4YHLH 5T5FA 4EZKA 2XXMB 5AZUA 4YLCA 3ZR5A 1AQKL 4OLWL 4UILH 1CXHA 1DBML 2WUBH 4W6XB 5DK0A 2ITCB 4JRYD 1IBBA 4XN1A 1RZPA 3IAQA 3MRIA 2OL3L 3BLBA 2EDDA 1TMQA 2PWEA 5J5EA 5J7CC 3BRGC 1ZV5A 3F3HA 4DETA 2NY2C 2ZKWA 2C5DC 3E9UA 3OJDB 2NT1A 3MRCB 4Q14A 4KOCA 1BM7A 1QI5A 1J9SA 3ATBA 1FDLH 5D6CA 1QRND 2H6PB 2P47B 4EXPX 3AGVA 1ZIAA 2VE6A 3L7FB 1JV5B 3EO9L 4L8BA 3ZQXA 4RZCA 2RCSL 1GZQB 2YSTA 4MLIA 5HYSG 4R96A 4P46A 1VEPA 2Z93B 4QY8B 2GUOB 3M1OA 4X80H 1ZMYA 2J71A 1KCRH 5E8DL 1OF0A 2G60L 3ILQD 5H4YA 1BEYH 1DQLL 3C5SA 4LGPB 12E8H 1X5JA 2ZOLA 1LEGA 4DKEL 4LFHG 4U1JA 5F89B 1M3IA 1AXIB 3JV5A 4AE1A 4K07A 3SCMB 4Z7OB 1DEEA 1FZMA 4NOBA 3QJHA 3H7BB 3QARA 4Y7OC 2AQRA 2HRPH 3U36B 4CVXB 5GGSB 4OFPA 2ZCHL 4Q52A 3NA4A 3NUKA 4I4WA 1OP5K 2FLMA 4IMKA 1KB9J 3QPKA 2ICWI 3KWWB 3ZKNC 4DP2X 2DMGA 1MZYA 4X7DC 4XNXH 4H2AA 3TFKD 1UWFA 3ISWA 5B38G 2CJSA 2YHGA 1CO1A 2P43B 4LEBA 2YRLA 1EJ8A 1SDAB 2PF6A 3TXAA 3O11B 2VR6A 4FFYH 4PAZA 1IGIL 4U1MA 3UO1L 1OXYA 2YA0A 3HG1E 3RKDD 1U8OB 3CLWA 4KKCD 3VXQA 2FH6A 2W5PA 2YC1B 4JPKH 4L4VB 4ZMYA 2GEQA 4L4TA 3R0MA 1RZ7L 4AOFA 3MREA 3QIWC 3FN9A 3U4BL 2GT9B 2OR9H 3Q1SL 5L6YH 4ELDA 3SHSA 2OK0H 5DEFB 2ID5A 4BSVB 1ZPUA 4JRFA 1TTAA 4G7QB 4CGTA 1A1OA 3HI5L 3ULVL 1UURA 4XHJD 3K81A 3K6OA 3OKDB 1RJZA 1XZ0A 2O72A 1AD0A 5IHLB 4YX2H 2OP4H 1HWWA 4P06A 1FGVH 4HX1A 4TRPH 1NM4A 4F80A 3L9YA 1NCOA 5K93A 3QB7C 3GTTA 3QEQE 4ACPA 2HH0L 1J0YA 2XN0A 5KSVB 2P5EE 1T66D 5FDYA 2AI0L 5T1JA 4RGNC 1I3GL 4N68A 2QLVB 5EZJA 1UM4L 2VR4A 4AENA 5E7BA 3P4OA 4NFCA 4PYHA 5I82A 3X1GA 3CCHB 4QRQA 2G9HB 5IM7A 1CLZL 3O81A 3TGXA 1NMBL 3TEWA 3I9GL 4B9FA 1U3HC 4R97B 4PWJA 5JHDE 1VCBC 4YDIL 5I73C 1KJ2B 1ZEAH 3CVDA 2N3JA 3V6FB 1L9PA 2DJSA 1HQ4A 4QWWD 4ODTH 4BQCA 2AEOA 1OE3A 2I9TB 4YNYA 2VH5L 2MFNA 1A1NB 3OAZK 5J6HA 5LVEA 3D5OF 2KKQA 2Q7NA 5DHYA 1D9KC 3VFUA 1D5XA 4PJGE 2CD0A 2FX8L 1V7MH 1PU0A 4H1LA 3IPBA 1A3ZA 2A9ML 5HDWA 4H0IA 3V8OA 2P52A 2FO4A 4QAWA 1D6EA 4YWGL 1UXMA 2WXNA 4QCIA 1Q0EA 1XVSA 5KYYB 1OSZB 1R46A 2LTQB 2WBJC 1XGQA 3P73B 4HKZA 3EJRA 2YD5A 1R5IA 3TC9A 4BXSV 3CC1A 1GSMA 1PZUB 1S46A 3B9KC 2GFBA 4TULH 2W80C 1C12A 4DK6A 4BEIA 5E95B 1UKTA 1XHHA 3LQAC 1C5DA 5HYIA 2NY4B 4OGZA 1TMCB 1CD0A 4P2RE 1E43A 2DD8H 1KBWA 5I28A 4MJ2A 2X41A 2F2HA 2L7JA 3BSZL 4P05A 2FHFA 1BYNA 4N9GB 5FUOL 3TPKA 4N0UB 4NRYB 4Y9FA 4N6QA 2NDFA 3FO2A 2ED9A 2EEFA 2FL5A 4NZJA 1HH9B 1LO2L 3SGJC 5IKCA 3TIDB 1CDYA 3MA7B 4ABUA 3MLXL 2JCCF 1I8MA 1QUNA 4GP8B 3WKQA 5I16A 5IQ7L 1UD2A 2WSDA 4FG2A 3A47A 3SBWA 5D7JA 2AGJH 1CFTB 2XWDA 4R90H 5EZPA 4KK5C 1EJOH 4GQQA 2FO8A 1PDKB 4L3FA 4G9FE 1ZD6A 3GSRB 3CQQA 3DNKA 2OYMA 4W6WB 4PJIE 3NCMA 4UYPA 1PAMA 1C5BH 4N1EA 3NBNA 4KITB 4PRNB 2EIKB 4FQLH 4GSUA 4KROB 2QHLA 3HC4L 4WNSA 4PJ9C 3QDGD 1X7QB 3TV8A 5T3XH 2AK4B 1NANI 5IIEA 4QD2E 2IPTL 1L9NA 4AYBA 5JMOC 2QFRA 5AYQA 1BZDA 3CFDB 1XGRB 3SKMB 4M48H 5DRZB 3ZTJG 3SYCA 4C83B 2AQ3A 2FR4A 4WKXA 5EO9A 4Z6AT 4W9KC 4UQ3A 2H7WA 2AV7B 1ZLVK 1UYWL 4POYA 3QEUB 5CO1A 1AJ7H 1PLAA 3EOYG 2CZNA 3QIUC 3OAZH 1ZT1A 4YHOL 2IH3A 3ZRSA 5JOFB 5FYLD 5C07A 1E9PB 3T2LA 3T0EB 1E6OH 5KVEE 5IV2A 4AEHL 1P2CB 4MAYA 2DTSA 3P11H 5EUKB 1FVCB 1NCGA 3ARSA 3SDCB 5B1KA 3DTUB 3RGVA 5AAMC 4NP4L 3D05A 4GW4B 2YFOA 3CDYA 5DHVB 1BD2A 2WLIB 1EGJH 3LIZA 4DNLA 2WAQA 3ASNB 4R4BA 4Z8FH 4WTWA 5I76A 1PQZA 4A38A 1ILUA 3CSBA 4OZFA 3UYRL 1MLBA 4LEOB 3LKNA 4OLZH 1YY9C 4P07A 4EQ3A 1U36A 1A66A 4LCCA 5EN3A 1IGCH 3O4LB 1WYJA 3IU3B 4R2GB 3S34L 4LL9A 3PYCA 2VUYA 3UYOD 4OZIF 1IC4L 2X70A 5KSUA 1D7BA 1HWGB 3NJJA 5C08A 1YJDH 1VFAB 4ATWA 1HEZB 2EDTA 2Z0BA 5L2KB 2UWEF 3C75A 2AS5M 4QF1A 4F20A 2X10A 1LJMA 4TS6A 5EIQA 3QORB 2XV6B 1H6FA 2IWKA 4EVNB 3P9MB 4PGBB 4GLRI 3EOBB 3PHAA 2VM4A 2QADB 4M6AA 1DFBH 3LIUA 4NNPL 2OXGA 4OJYA 3VDBA 4MCZA 1EDHA 1A7QH 4YK4C 1XH1A 4H25B 5AW6B 2JKXA 4HIEB 2G3NA 2A6DB 2ZP9A 3OR7B 1OP4A 3HG3A 3SBPA 1E8YA 2JCCB 1XQ4A 1W72H 2O5XL 5EO1B 1KJ2L 4MMZC 3S48A 1GGCH 3FH8A 5CEXA 3GO1L 3C87A 3C9NA 4WO0A 3LPGA 2F5AH 2MQ0A 4G59C 1VADB 3ARDC 2PCFA 3TBTB 1UUNA 2XLLA 1U93A 4LAQH 3VW3H 2Y5EA 3G5YA 5AVZB 3BP6A 2VLKE 5DRXA 1MF2H 2OQJA 3RIKA 4YSAA 3ESOA 2XN1A 3ECBA 2WXJA 4NCC2 3UTTE 4NUPA 3RZCC 2ADFH 4DCQA 4EZJA 1PLGH 5DVNA 1A4KA 2RH0A 3QXUA 2YPLE 4ODXB 5HVHB 1MCWW 1WDAA 1KBPA 1W9XA 2CR6A 2HN7A 1NDMA 1ZLVH 4E41D 5LGHH 3W39A 3JV4A 5C0AB 1BXVA 2VKWA 4HMEA 3WIHH 1CR9H 3AXIA 5E2VH 1JZEA 2X7LB 1OALA 3AREC 2K78A 2CUIA 2WIIB 4GAAA 4LL1A 3UG5A 2XN9A 2XICA 1SHSA 3F6LA 3VXSB 1MRFH 1NCWL 3UGXA 3RY6A 2XC8A 3EFDH 2QHRH 5KSAD 3WKPA 2CJ3A 5TDOA 2LFGA 5CSBA 4KK8D 2XWXA 4M61A 4JVWA 4PW3A 3BH8A 3FT2A 3KWVA 2UVFA 3O3AB 2QGEA 2Z7ZA 3PDGA 5EU3A 1S7XB 2EUZA 3VRLE 1CD1B 1CU4L 3MRGB 5A2KH 4MNGA 1IEBA 4AKQA 4NYLA 4G83A 5H94A 3V5DA 2YUWA 5J1TC 4GBXB 1LDPH 2PYFA 4S1SL 1ADQH 4NZTH 4DVRH 5LBSA 1K8IA 4ZS7H 4P5TC 4E36A 4OZIB 3BEWA 3CIQA 4G80B 1JV2B 2XV0A 2O93L 4K23L 4XVOA 4LLDB 4MJ6B 3UZQB 3QWRD 4RIRA 1TJXA 3LKRB 3ML8A 5DQJA 1IGMH 2UWEB 3ARXA 4HW6A 4OD1L 4ZFOA 1AGEA 3D85D 4U6XB 1NCTA 4RMVA 3BKCH 3SY0B 2PP8A 2CRMA 3HFFA 4FG0A 5HHOD 2AQ1A 2WGNB 1VZHA 2V7HB 1FAIL 2RBLA 5DMGD 5K1NA 4AV4A 4PRHE 3DUSA 4Z9KB 2V3DA 5C9JB 4KWUA 3GJFK 2A38A 2BIQA 1PKQA 4ZDHB 1B4JL 2WM0A 4OJDH 4U31A 4AW7A 4XNUH 4QHMB 4LCIH 5IHZB 4K3JH 1G5AA 2TSBA 4LFHD 1JNLH 3ESMA 2QKIC 2VTFA 5A2FA 2GC4C 1TYEB 4TYUA 5AVSB 3BUQA 3WO3B 3II1A 2PP7A 3D69B 4FL4C 4MCNA 4WK2B 3MGAA 3QZBA 4JFDB 1DN0B 1IGFH 1KOAA 3NJIA 5B1JA 1L7TH 4YVUA 1U30A 3KPQA 5JHLA 2NXZC 4LPCA 4OU3A 5FYJL 1X5HA 1T3FB 4JVPA 2MTAA 1TYRA 2WJ7A 5HYJE 3WJLA 4Z76B 4KHTH 4FX5A 2BSBA 3NZSA 2V17H 5A2BA 5JXAH 5MEOA 4BBWA 2BVTA 4JO8A 1B2WL 1TCMA 5CZVL 3RTLA 1QTPA 3KW8A 3D6GA 5EZOH 2Q3ZA 5BRZA 3D39B 3VXPB 4OJEH 1I31A 3CWGA 1IJNA 3ME0B 1LP9A 2OX5A 2A6IA 3BZ4A 4LDCA 3IBEA 2ZD0A 1LD9A 2VLLA 3H9SB 3U30B 2IANE 5AD0A 3U0WH 1FPTL 3Q9PA 3CZKA