1SP4A

Crystal structure of ns-134 in complex with bovine cathepsin b: a two headed epoxysuccinyl inhibitor extends along the whole active site cleft
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
48
structure length
48
Chain Sequence
b'LPESFDAREQWPNCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHSNG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin B
publication title Crystal structure of NS-134 in complex with bovine cathepsin B: a two-headed epoxysuccinyl inhibitor extends along the entire active-site cleft.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 11
structure length 48
sequence length 48
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2004-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1sp4A01
3VMXA 5APWA 1MUUA 3TNUB 4C7NB 2XV5A 4JYCA 1A02J 3TNUA 4C7NA 1X8YA 5AW7B 2YO2A 1DH3A 1A02F 3HE4B 1FOSF 4AUWA 3KQGA 1H89A 3HE4A 1FOSE 3P7KA 3UIAA 2XU6A 3VTPC 3TYYA 1FAVA 3VMZA 2WPRA 2E43A 2R5DA 3M06A 3OAKA 1H8AA 3A5TA 2Z5IA 4I6MC 1T2KC 2E42A 1G2CB 5AW2B 2W6AA 1NAFA 1S9KD 3B8EB 5AW6B 5CMZA 3NFQA 1JUNA 2WTYA 1H88A 3M91A 1GTWA 4GT1A 5AW3B 2VRSA 3L36A 2WPQA 2C9NY 1CI6B 3LIDA 2BASA 2Z5HA 1CI6A 3HE5B 3NXSA 2P67A 2C9LY 5AVSB 2Q3IA 3IR9A 1GZLA 3HE5A 5AW0B 2Q7CA 5AVUB 1GU4A 5AVVB 5APVA 2QM7A 1HJBA 3KDPB 2KP8A 2IPPA 1NWQA 1OXZA 4RESB 3A7OA 4KHXA 5AVTB 5AVWB 1KQLA 5APQA 2ZFCA 1J2JB 5AVYB 1T2KD 4XE5B 1CSBA 3VMYA 3MGNA 2N9BA 4I2LC 1GK6A 4LC1A 4C46A 5AW9B 1YYCA 2WPSA 2W27A 1HBWA 1GK4A 5AW4B 1SP4A 3MD0A 4GKGA 5APTA 5AW8B 3SWFA 2H7HA 3I5CA 2P2UA 4M3LA 3M9HA 2WT7B 1HWTC 1MV8A 3HTKA 3V4QA 3A3YB 1HUCA 5APUA 5AVRB 4DZOA 1IO4A 1CZQA 5APYA 1S9KE 3NMDA 3P32A 3NTNA 5AVQB 3M9BA 5AVZB 3VN0A 2R32A 3A2AA 4HYTB 1GD2E 3TK1A 3LIEA 2YNYA 2Q5UA 3M0DA 2P7JA 3L37A 5AVXB 2WWWA 1SLQA 3M0AA 3V5BA 4AYCA 2JJLA 2QM8A 2YO3A 3L35A 5APXA 3VYIA 5AW1B 3T97A 1GU5A 2WT7A 4EOTA 4JYBA 3P8MC 1JNMA 1MFZA 2R3CA 5APSA 5AW5B 3V4WA 1OWAA 4AQRD 2R5BA 4B86A 2ZXEB 2XZRA 3O8ZA
chains in the Genus database with same CATH superfamily
3PH0A 1OFCX 1GL2D 3S1KA 2FYNC 3S4RA 4U3FE 2K88A 3P7KA 2XU6A 3TGUE 3TGUG 1BGYD 1U7MA 3Q5PA 3OAKA 1YHQP 2BCCE 2W6BA 3H1HD 1IZNB 2AXTE 2WTYA 1NHLA 2FFDA 1W2EA 3AE4C 2P67A 1L4AA 1QVFO 5AVVB 2K37A 3CCUP 5M1BA 2AXCA 1T3JA 3KZIH 4KHXA 5AVTB 2ZFCA 1T8ZA 2QJPC 1CSBA 1JEKA 2KK7A 1ZR2A 1HBWA 4D6TJ 2ZYGA 3I5CA 2WZ7A 1IFPA 3H1KD 3LW5J 1VQ4P 3H1JJ 1PGQA 3L70J 3U59A 3RGUA 3NTNA 3USSA 4LLHA 4WB4A 1KB9H 4HKZH 2IBZG 2FYUK 3RL0g 1BCCE 3L35A 1BCCG 3L71E 3WU2H 1ZP0C 3P8MC 4K3AA 4B86A 4IL6H 4C7NB 5KLIC 1DH3A 3CCVP 4ZKUA 3CC4P 1FAVA 2NPSD 1PP9E 1NTKJ 3E1RA 3E1IA 4OGQB 3ITKA 1IFIA 1SQXG 2W6AA 4GODA 2KSJA 1LTSC 1VQLP 2Z5HA 3CWBD 3D71A 4U3FD 5AVUB 3AEAC 1NWQA 1KQSO 1SQPJ 1SFCB 4RESB 3A7OA 1KQLA 2RMZA 1AFOA 2BCCD 4UB8E 2E5YA 4MN4C 3RK2C 3B5NA 1XTGB 3W68A 2O01H 4OVNF 2HPCB 3G4SP 2N1TD 5E79E 4PV1C 3H1LJ 3P8CD 3JCUH 5APUA 2ZYDA 3LW5H 2LXCB 1IO4A 4GOEA 3CL3D 4HJGH 2H88C 2FXPA 2M5AA 3GF7A 1IC2A 2QJPB 1L0LE 3PP5A 1SQBE 1L0LG 1PPJG 1SQBG 1NAYA 2YNYA 4N6JA 3L37A 2D2CB 3H1IJ 3L75E 3L75G 3MP7B 3PJSK 3V4WA 3C1LA 4RKUJ 4JYCA 3OJAB 5CCHA 2HYNA 1EQ7A 1FOSF 3F89A 5CJ4A 2QJKC 1VPCA 2DW3A 3M06A 2J58A 3V2NA 2FFDC 3L71D 1NU1J 2Z5IA 1L4AD 3BCCG 4CPGA 4JQ0D 3CD6P 1JMBA 3IR9A 2QM7A 1JCCA 1ZOYC 1OXZA 5KLIB 1ZN5A 1T2KD 1JTHA 3RL0D 1KILC 1MZ9A 1AV1A 1KFNA 1Q81Q 5KLVD 1SQVD 2IDBA 4GKGA 2Y0DA 4DCKA 5AW8B 3SWFA 2FXMA 1HWTC 1K05A 3L73E 1YBKA 1KB9I 1NTME 2JR8A 1NTMG 2CPBA 2GUSA 5AVQB 4DJGA 2Y9YA 3HD7C 1EDLA 3PRJA 2GM4A 1JY2P 3RK2B 3G6EP 2CK3H 3CX5H 1M8OB 2IYOA 3PLNA 2FKWB 2YMKA 4C7NA 2LKMA 2POHA 1H89A 1DIPA 1M90Q 1OMIA 3BCCJ 2L5GB 1KTMA 2HG5D 1BE3E 1QEXA 1H88A 1FZFA 1CI6B 1EDIA 4IL6X 3L74G 3AE3C 1LTJB 2KP8A 4UB8H 3B5ND 1VQMP 1S2EA 2B9BA 4WY4B 3MGNA 3TSIA 2QJKB 3ABVC 4I1LA 1VQ6P 2OTLP 2E76C 2KIKA 1MFTA 2OTJP 2ZJSE 2HPCA 1KZUB 1HUCA 2P10A 3KZIE 1CZQA 1KMIZ 2MKVA 3L72D 1LGHB 1X9VA 2R32A 1SQQJ 3SSUA 1KILB 1SLQA 1FS0E 1JY3P 2YXQB 2E75B 2J59M 5CCHD 1ZR4A 5APXA 3L73D 5GTHH 1YJNP 1X79B 1M1KQ 3O8ZA 2HR3A 3MIWA 2KZIA 4H44D 1NO4A 1X0TA 3CLQA 4W80A 1KB9E 1L0NJ 1AA0A 2QA4P 3HD7B 1G2CB 3WU2E 2FYUD 1JY2N 2P1JA 1LT1A 1J1EC 2ZT9C 5AVSB 1GU4A 2NZ2A 4BXLA 2E5TA 2Z4EA 3AEGC 2AEFA 2BEQD 3AE2C 4L75A 5KLVK 1EZVI 4O9BA 3OA7A 1FJPA 3EFGA 1BE3D 4C46A 1PGPA 2ZXXA 2PGDA 3FWNA 4N78E 1KV4A 4HH2A 1LTBC 1SP4A 2WMMA 5GTIH 4OH8B 1X22A 4ASWA 1M7LA 1S9KE 3JSVC 2ZVOB 3P32A 3CCJP 1KN7A 4TT3H 1DD4A 3Q2YA 4ZMDA 2P7JA 1K9MQ 3H1KG 4BWNA 2E76B 1SQBK 4RJTA 3D70A 4D6TE 1JNMA 2YKPA 3JCUE 1OWAA 1Z56A 3VMXA 3GW6A 1JB0J 5APWA 4YXDC 2R3SA 1VQOP 3H1JE 2Q6QA 3L70E 1M57D 1AQTA 1Q2NA 5AW7B 2QEXP 3HE4B 4OGQC 2PFXA 2AEJA 2MJZA 2QRXA 4YPCA 2B87B 2PP6A 2OYHC 1JY3N 5CCGC 1BGYJ 1SFCC 1CI6A 1URQC 1EXJA 2FBWC 2NRGA 1LTJA 2P58A 3Q3DA 3H1HJ 2QE7H 5CBOA 2WSFJ 1R5SA 1NTZG 3HUSC 3CCLP 3BVHA 1NTKE 1N86A 1NTKG 5KAIH 2WSEJ 4JPZB 4H13B 1YI2P 2A06E 3PTZA 1IFJA 2A06G 1GK4A 2V4HA 2I8DA 2J5UA 2OQQA 1NKZB 1J1EB 2ZT9B 4R4MA 3H25A 2B89A 1SQPE 2SPZA 1SQPG 2D2CC 1NTMK 2C0XA 4N78D 1G1JA 3H1KJ 5KTBA 1EZVE 1KQFB 1KILA 5AVXB 1EZVG 3M0AA 4PJ0H 2JJLA 3FWLA 4EYYQ 2WT7A 3CMEP 2W8ZA 1ZV8A 1YTZT 3H1LE 2R5BA 1ZLLA 1N2DC 3H1LG 3HRNA 1KYOI 5BU8B 1KQGB 1G1IA 1IK7A 2KS1B 2IBZE 3KQGA 4L76A 1VQPP 3V6IA 1RF0C 1HJ0A 3HD7A 4D6TD 1HF9A 3AECC 3H1IE 1G2CA 3CX5E 3H1IG 3VP9A 1RQUA 3M91A 4Y99C 5AW3B 2C9NY 2O3JA 4N3YB 1VQNP 3KYQA 1K04A 3AEDC 3BATA 1NTZJ 1HH0A 2WSFH 1LTAC 1ZRTE 1SQXE 3CWBJ 1KILE 4PD4I 4U3FJ 1NU1E 2KLVA 1NU1G 1Q90D 1M56D 4C7RA 3AEBC 5APTA 2OYHB 3TGUD 2WVRA 1PZQA 2FYZA 1J1DC 1EDJA 5DJUB 1URQB 1N7LA 4DZOA 1OZHA 3VOPA 3VN0A 4U7JA 2HLOA 1SQVG 3RK2D 1PFIA 3HUSB 2O1KA 1LP1B 3TDKA 1T3UA 4AYCA 3EWKA 2KNCB 4PV1D 3F5HA 1AJYA 1P84I 2Y0CA 1JO5A 4R4LA 1S4XA 2YXRB 1EC5A 3K5BA 1PPJE 3B71A 3HE4A 1IFNA 4A7PA 1ZW0A 1NH4A 1AQ5A 2OARA 3G9RA 1LTJC 3D6YA 4ZNCA 5GTHE 4L73A 3M9QA 2IFMA 1HVVA 2C0WA 2IBZD 3L71J 4TLFA 2LXBA 4WY4C 5C39A 3Q5RA 1RE3C 1BCCD 3M0DC 1VF5C 3MTUE 3BCCE 3IFMA 1EDKA 1YYCA 1CW5A 5KAFH 3EQ2A 3CI9A 1DEEG 1QGKB 3AE8C 5KJ7C 2H7HA 4Y99B 3WUTA 1PP9D 2IZ0A 4WVZA 5KLVJ 1Q7YQ 1SQVJ 1SQXD 2KI7B 2YKOA 1KILD 5DJTB 3M9BA 5AVZB 3CCSP 2E75C 4HYTB 1GD2E 1LWUC 1NOHA 2OYIB 3T97B 4KJMA 4PD4E 3EFFK 3CXHI 5GTIE 1J1DB 4OWFA 1Y8AA 3ZDMA 2IX7C 3HD7D 2O1JA 2KS1A 4QMAA 5BVZA 3BASA 1UIIA 1YJ9P 1SQQE 1SQQG 2HODB 1PGJA 3AE5C 5AW6B 2KYVA 5EFWB 1USDA 3GHGC 1OW7A 2BASA 1L0LD 1PPJD 1SQBD 1N73C 3KHUA 1P84E 1L0NE 4YTPC 3L75D 3VMYA 1L0NG 3SFDC 3L74E 4GDOA 4JF7A 2OGUA 1NTKK 2E74C 1VQ5P 5K5GB 3HTKB 2OYHA 1PL5A 5CCGA 1SFCA 1URQA 3E7KA 1NYHA 1SS1A 1RH5B 1LTIC 1Y9BA 5KAIE 1SQPK 1VF5B 2E76D 3HUSA 4W7ZA 1AVYA 1LP1A 1FJKA 4WWIA 3L72J 5TISH 4EOTA 3AE9C 2I1KA 2WPVB 3TNUB 2PRRA 4H0LC 1A02J 3CCMP 1X8YA 2CPSA 2KSEA 1RQVA 1T6AA 3L73J 3BRTB 3GF3A 2WPRA 5CJ0A 3SFEC 4GOFA 1H8AA 4PJ0E 1LWUB 3V2PA 3VP8A 1UIXA 1NTMD 1NAFA 3H6PA 1ZMEC 2ZAEB 1BDCA 1BDDA 4JBZA 1RY3A 5KKZB 3RK3E 3JC22 3HE5B 1FDMA 2Q3IA 4DOJA 4IFDK 2YMYA 1KYOH 3CXHE 4IFFA 1OW8A 2FYUJ 4H13C 1J2JB 5AVYB 2W90A 2L91A 1FE6A 4I2LC 3MUDA 1S72P 4UB6H 5AW9B 1RF0A 5H2FH 1ZXGA 1SQXK 1BSHA 2ZT9D 3O6QB 2Q1KA 1BGYE 3GHGB 1BGYG 4M3LA 3V4QA 5AVRB 1N73B 5APYA 3H1HG 2GUVA 1E79H 3BRVB 1HGZA 1KFMA 3L74D 3TK1A 3S9OA 2M0BA 4PD4H 2YO3A 3VYIA 3FXEA 3T97A 2E74B 2R3CA 5APSA 2XDJA 1GDTA 4AQRD 5B5EE 2XV5A 4EDFA 1AVOA 1U7JA 3N4XA 4HB1A 4KT0J 1RF1C 3H1KE 4XA4A 1L2PA 1L0LK 2HODA 5CMZA 1FZCB 1OX3A 2VRSA 1OVUA 2WPQA 1N7SC 3LIDA 4I7ZC 2Q7CA 1P84H 2K1AA 1SVFA 4OGQD 2WITA 4H0LB 3A0BE 1S5LH 1TU3F 5BU5A 1U57A 1FZBA 1YIJP 2JP3A 4LC1A 3RK3C 2K9YA 5CCGD 1RHZB 1SFCD 2WSCJ 1URQD 3H32B 3IN6A 4Z1MH 3MD0A 1QL2A 3C9IA 2P2UA 1KB9D 3M9HA 3AE6C 3HTKA 2GA1A 1NTZE 2W83C 1W2BO 3N7NA 2KLUA 4WY4A 1WMKA 1GL2C 1OW6A 1RE3A 3CWBE 3PHLA 1HGVA 3CWBG 3LIEA 4U3FG 3M0DA 1VQKP 4H44B 5KAFE 5B66H 1YTZI 1PV3A 2BCCG 5KJ7A 3CPWO 3FGAD 3TNUA 3CCEP 2D2CD 1A02F 1KC8Q 3OW2O 3FX0A 1N8RQ 2YKQA 3TYYA 1RE4C 2E43A 3P8CE 1IFDA 1R5LA 1JTHB 1JM0A 1LWUA 4IFMA 5AW2B 1S9KD 2LR2A 5L8RJ 3NFQA 1JUNA 1SQQK 2A45I 2KOGA 2O01J 3HE5A 3CXHH 4EI2A 2IPPA 3MUDC 1GMJA 2H43A 5AVWB 1M1JC 3QH9A 1JOCA 1HTLC 2FXOA 4XE5B 3W67A 1RF1B 1VQ8P 2N9BA 2KUBA 2WPSA 3Q1MA 3H1JD 3L70D 1L0NK 2WSCH 1K8AQ 5AW4B 2QVAA 3O6QA 3MHVA 1IFMA 1N7SB 2W6JH 3GHGA 3L71G 1XTCC 4I7ZB 1N73A 1LT9B 4Y28J 1PIXA 2WSEH 3TGUJ 2ZVNB 2OYIC 2Q5UA 1JY2O 3CC2P 2NPSC 4YXWH 1PP9G 2BCCJ 3FXDA 3RK3B 1W5CE 2FY8A 5AW1B 4ASVA 3WMM0 4JYBA 1MFZA 1NTZD 2HFED 5B5EH 2XKMA 1YQ3C 1NTKD 1KORA 5KLVE 1SQVE 3SWKA 3R4YA 5KLVG 1USEA 1Q82Q 3KPEA 3I55P 4EIJA 1FC2C 2A06D 2K3RA 3UIAA 1FZEA 3VTPC 1GL2B 3RBZA 2FYNB 3A5TA 5TISE 1OVRA 1IJDB 1SQPD 2XNXA 1FZCA 3A0HH 2C9LY 5AW0B 5APVA 1EZVD 3A0BH 1HJBA 1DD3A 2N1TC 2WSSH 1NJIQ 1OVVA 3H1LD 3G3ZA 1GK6A 2B87A 4LGDE 1BCCJ 3H32A 3V2QA 3I56P 3Q5SA 4WY4D 2M8RA 2QIWA 1KYOE 2A45G 3CMAP 3NMDA 1S5LX 1VF5D 1WT6A 3H1ID 3CX5D 2O01N 1M1JB 1NVOA 1PP9J 1LTTC 4UB6E 1JY3O 3V5BA 1SQXJ 5H2FE 3G71P 3GG2A 5KJ7D 2AXTH 4BRYB 1L4AC 1ZRTD 1S3JA 1OIPA 1H0TB 3CCRP 1NGMB 1MUUA 1NU1D 2JEEA 2YO2A 2E75D 1YJWP 3VMZA 3WUUA 3GLMA 3MZWB 4RO0A 1WRGA 1T2KC 2E42A 3KXDA 5KKZC 3RL0C 4IOIH 2N9YB 3L72E 2NPSB 1LNQA 3L72G 1FDIA 4GT1A 2IYPA 3TF5A 1YITP 3VMAA 4WBAA 3KDPB 2XNDH 1VQ7P 3L73G 1GW4A 4NPDA 2YIUC 3CCQP 1L0LJ 1FDOA 1SQBJ 1RF1A 2K9JB 1Y47A 2KXPB 3L75J 2G8YA 2QJYC 1GW3A 1FBMA 1N7SA 3SWYA 2N1TB 1S5LE 2FYUE 4PV1B 2FYUG 3WUVA 4K35A 1LT9A 1NTZK 2I1JA 2E74D 3L4FA 3GMAA 2Q3EA 2IZ1A 1KYOD 2H8PD 5AW5B 2ZXEB 1BE3G 5TJHA 3BCCD 3AE1C 3II6A 2Q9IA 2Y9ZA 3QWOC 1QVGO 5CBNA 1VL2A 1FZCC 1GL2A 3IAOA 3B5NC 4I6MC 2KNCA 3AEEC 5B66E 1BSNA 2IFNA 3B8EB 2FFDB 1LTGC 1GTWA 4H0LD 3L36A 1FZGA 2G3AA 2B88A 1QLED 1L4AB 2JDIH 3D6ZA 5E79H 1GZLA 1NKNA 2OYOA 2KB7P 2ITAA 2KZJA 1NTMJ 1MKMA 1QL1A 4PD4D 2H89C 3B4SA 3U1AA 2PAJA 1RE4A 2V7QJ 3C8VA 2WQYC 1D7MA 2W27A 3RL0B 4L74A 4DT0A 2JO1A 1PGOA 2A45H 3AE7C 5CCHC 2WT7B 1SQQD 3V2RA 1VDFA 1S1CX 2M3BA 2RH0A 4H13D 2ZYAA 1R8EA 4H44C 1M1JA 2YIUB 2WWWA 1NU1K 1JCDA 1YQ4C 2Y0EA 1EXIA 1P84D 2UWJE 4W7YA 1BE3J 1GU5A 3R2PA 2JWAA 4BRYA 3H1HE 1L0ND 3L74J 1IK9A 2QJYB 5APQA 1H0TA 4IL6E 1Q86Q 1FZAA 4AUWA 1FOSE 2QG4A 1QX8A 5CHXA 1SQVK 2R5DA 2OYIA 1KD1Q 2NPSA 3NXSA 2BEZF 2JWDA 4GIFA 2IBZI 3AEFC 1JMMA 3RBXA 2JKVA 4ZKPA 2OTKE 3B5NB 1FU1A 2V7QH 3CX5I 1K73Q 1N7SD 2K9JA 2QSIA 2M3EA 1DEBA 3A0HE 1MV8A 1LT9C 3A3YB 4NPFX 1DX7A 4D6TG 2RKLA 1E5WA 2N1TA 2M5AB 3H1JG 3L70G 3A2AA 3RK3D 2R44A 2RN0A 3U1CA 1VQ9P 3CC7P 3IF4A 2AEMA 2QM8A 3CXHD 1LJ2A 4NPEA 4XFJA 2XZRA
chains in the Genus database with same CATH topology
1J1DB 3MIWA 1GL2D 1NO4A 3KPEA 2IX7C 3HD7D 2O1JA 4EIJA 3CLQA 5BVZA 4W80A 3BASA 3P7KA 3UIAA 2XU6A 1FZEA 3VTPC 1GL2B 3OAKA 2HODB 3HD7B 3A5TA 1G2CB 2W6BA 1IJDB 5AW6B 2KYVA 2XNXA 2WTYA 1FZCA 1JY2N 3GHGC 1NHLA 2P1JA 2FFDA 2BASA 1J1EC 1W2EA 2P67A 1L4AA 5AVSB 1GU4A 2C9LY 5AW0B 1N73C 5AVVB 5APVA 1HJBA 2Z4EA 2N1TC 1T3JA 4KHXA 5AVTB 5KLVK 4O9BA 2ZFCA 3OA7A 1FJPA 1T8ZA 1CSBA 3VMYA 3EFGA 3G3ZA 1GK6A 4C46A 1ZR2A 4LGDE 4N78E 4JF7A 1HBWA 1NTKK 3H32A 4HH2A 1LTBC 3V2QA 1SP4A 3I5CA 4WY4D 3HTKB 2M8RA 2OYHA 2WZ7A 4OH8B 5CCGA 1SFCA 1URQA 2A45G 1M7LA 1S9KE 3NMDA 3P32A 3U59A 3NTNA 1WT6A 4LLHA 4WB4A 1M1JB 1LTIC 1LTTC 1SQPK 3HUSA 2FYUK 4W7ZA 2P7JA 1JY3O 3V5BA 1FJKA 5KJ7D 3L35A 1SQBK 4EOTA 3P8MC 1JNMA 1L4AC 2I1KA 2YKPA 1OWAA 4B86A 1Z56A 3VMXA 5APWA 1MUUA 3TNUB 4C7NB 1A02J 1X8YA 5AW7B 2CPSA 2JEEA 2YO2A 1DH3A 3HE4B 4ZKUA 3BRTB 1FAVA 3VMZA 2NPSD 2WPRA 5CJ0A 2MJZA 1H8AA 3E1IA 1WRGA 1LWUB 1T2KC 3V2PA 2E42A 3VP8A 3RL0C 1IFIA 2W6AA 1NAFA 2NPSB 3H6PA 2KSJA 1LTSC 2PP6A 2OYHC 4GT1A 1JY3N 1RY3A 5CCGC 1SFCC 2Z5HA 1CI6A 1URQC 3HE5B 1FDMA 2Q3IA 4DOJA 4IFDK 5AVUB 1LTJA 4WBAA 3KDPB 1NWQA 2YMYA 1SFCB 4RESB 3A7OA 4IFFA 1KQLA 1GW4A 1J2JB 5AVYB 1AFOA 3HUSC 3BVHA 1N86A 4I2LC 3MUDA 1RF1A 3RK2C 5AW9B 3B5NA 1RF0A 1SQXK 1XTGB 1IFJA 1GK4A 2O01H 2HPCB 2N1TD 3GHGB 4M3LA 3P8CD 1GW3A 1FBMA 1NKZB 1N7SA 3V4QA 1J1EB 3SWYA 5APUA 5AVRB 3LW5H 1N73B 1IO4A 5APYA 2GUVA 2N1TB 3CL3D 1LT9A 3BRVB 1IC2A 1HGZA 1KFMA 3PP5A 1NTMK 1NTZK 2C0XA 2I1JA 4N78D 3TK1A 1G1JA 5KTBA 2YNYA 4N6JA 1KILA 3L4FA 3L37A 5AVXB 3M0AA 2JJLA 2YO3A 3VYIA 3T97A 2WT7A 1ZV8A 2H8PD 2R3CA 5APSA 2XDJA 5AW5B 1GDTA 3V4WA 1YTZT 4AQRD 2R5BA 2ZXEB 1ZLLA 1N2DC 3HRNA 5BU8B 2XV5A 4JYCA 3OJAB 5CCHA 3II6A 2Q9IA 1G1IA 3N4XA 2HYNA 1EQ7A 1FOSF 3KQGA 5CJ4A 1RF1C 1VPCA 1FZCC 3M06A 1GL2A 2J58A 3B5NC 3V2NA 4XA4A 2FFDC 1RF0C 1L0LK 2HODA 2Z5IA 3HD7A 4I6MC 1L4AD 1G2CA 2IFNA 3B8EB 3VP9A 5CMZA 1FZCB 2FFDB 1LTGC 3M91A 1GTWA 4Y99C 5AW3B 2VRSA 3L36A 2WPQA 1FZGA 2C9NY 1N7SC 3LIDA 1L4AB 4N3YB 3KYQA 3IR9A 2Q7CA 1GZLA 3BATA 1SVFA 1NKNA 2QM7A 2KB7P 1JCCA 2WITA 1OXZA 1HH0A 1ZN5A 5BU5A 1QL1A 2WSFH 1LTAC 1T2KD 3U1AA 1JTHA 1FZBA 3RL0D 1KILC 1MZ9A 2PAJA 1KFNA 1RE4A 2KLVA 4LC1A 3RK3C 5CCGD 2W27A 3RL0B 1SFCD 1URQD 3H32B 4C7RA 4GKGA 3MD0A 1QL2A 3C9IA 5APTA 5AW8B 3SWFA 2OYHB 2P2UA 2A45H 3M9HA 2FXMA 2FYZA 1J1DC 5CCHC 2WT7B 1HWTC 3HTKA 1URQB 3V2RA 1VDFA 1N7LA 4DZOA 2M3BA 3VOPA 2CPBA 2GUSA 3N7NA 4WY4A 5AVQB 3VN0A 2HLOA 1GL2C 3RK2D 1M1JA 1RE3A 1PFIA 1HGVA 3HD7C 3HUSB 3LIEA 2O1KA 2GM4A 3M0DA 2WWWA 1T3UA 1NU1K 1JCDA 1JY2P 3RK2B 4AYCA 4W7YA 1GU5A 3R2PA 1YTZI 1IK9A 5APQA 1JO5A 2FKWB 5KJ7A 3TNUA 4C7NA 1A02F 2LKMA 1FZAA 2POHA 4AUWA 1H89A 1FOSE 3HE4A 1IFNA 2YKQA 3TYYA 1RE4C 2E43A 3P8CE 1NH4A 1SQVK 5CHXA 1IFDA 2R5DA 1AQ5A 2OARA 1JTHB 2OYIA 1LWUA 2L5GB 4IFMA 5AW2B 1S9KD 2HG5D 1LTJC 2NPSA 3NFQA 1JUNA 1SQQK 2A45I 1H88A 1FZFA 2KOGA 1CI6B 3M9QA 2IFMA 1HVVA 3NXSA 1LTJB 2C0WA 3HE5A 2KP8A 2IPPA 4WY4C 4GIFA 2H43A 1JMMA 1M1JC 1RE3C 5AVWB 3B5ND 1JOCA 1HTLC 4XE5B 4WY4B 3M0DC 3MGNA 3TSIA 3MTUE 1RF1B 2N9BA 3IFMA 4ZKPA 3B5NB 1FU1A 1YYCA 2WPSA 4I1LA 1CW5A 1N7SD 1L0NK 2WSCH 3EQ2A 3CI9A 5AW4B 1DEBA 5KJ7C 2H7HA 4Y99B 1IFMA 1N7SB 1KZUB 2HPCA 3GHGA 1MV8A 1LT9C 3A3YB 1HUCA 1DX7A 1XTCC 1E5WA 1CZQA 1N73A 2YKOA 1KILD 2N1TA 1LGHB 1LT9B 3M9BA 5AVZB 1X9VA 2WSEH 2R32A 3A2AA 3RK3D 2OYIC 4HYTB 1GD2E 1LWUC 1NOHA 1KILB 3U1CA 2Q5UA 1JY2O 1SLQA 2NPSC 1JY3P 2QM8A 2J59M 3RK3B 2OYIB 5CCHD 1ZR4A 5APXA 5AW1B 3WMM0 4JYBA 1MFZA 1X79B 2HFED 2XKMA 2XZRA 3O8ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VMX A;  5APW A;  1MUU A;  3TNU B;  4C7N B;  2XV5 A;  4JYC A;  1A02 J;  3TNU A;  4C7N A;  1X8Y A;  5AW7 B;  2YO2 A;  1DH3 A;  1A02 F;  3HE4 B;  1FOS F;  4AUW A;  3KQG A;  1H89 A;  3HE4 A;  1FOS E;  3P7K A;  3UIA A;  2XU6 A;  3VTP C;  3TYY A;  1FAV A;  3VMZ A;  2WPR A;  2E43 A;  2R5D A;  3M06 A;  3OAK A;  1H8A A;  3A5T A;  2Z5I A;  4I6M C;  1T2K C;  2E42 A;  1G2C B;  5AW2 B;  2W6A A;  1NAF A;  1S9K D;  3B8E B;  5AW6 B;  5CMZ A;  3NFQ A;  1JUN A;  2WTY A;  1H88 A;  3M91 A;  1GTW A;  4GT1 A;  5AW3 B;  2VRS A;  3L36 A;  2WPQ A;  2C9N Y;  1CI6 B;  3LID A;  2BAS A;  2Z5H A;  1CI6 A;  3HE5 B;  3NXS A;  2P67 A;  2C9L Y;  5AVS B;  2Q3I A;  3IR9 A;  1GZL A;  3HE5 A;  5AW0 B;  2Q7C A;  5AVU B;  1GU4 A;  5AVV B;  5APV A;  2QM7 A;  1HJB A;  3KDP B;  2KP8 A;  2IPP A;  1NWQ A;  1OXZ A;  4RES B;  3A7O A;  4KHX A;  5AVT B;  5AVW B;  1KQL A;  5APQ A;  2ZFC A;  1J2J B;  5AVY B;  1T2K D;  4XE5 B;  1CSB A;  3VMY A;  3MGN A;  2N9B A;  4I2L C;  1GK6 A;  4LC1 A;  4C46 A;  5AW9 B;  1YYC A;  2WPS A;  2W27 A;  1HBW A;  1GK4 A;  5AW4 B;  1SP4 A;  3MD0 A;  4GKG A;  5APT A;  5AW8 B;  3SWF A;  2H7H A;  3I5C A;  2P2U A;  4M3L A;  3M9H A;  2WT7 B;  1HWT C;  1MV8 A;  3HTK A;  3V4Q A;  3A3Y B;  1HUC A;  5APU A;  5AVR B;  4DZO A;  1IO4 A;  1CZQ A;  5APY A;  1S9K E;  3NMD A;  3P32 A;  3NTN A;  5AVQ B;  3M9B A;  5AVZ B;  3VN0 A;  2R32 A;  3A2A A;  4HYT B;  1GD2 E;  3TK1 A;  3LIE A;  2YNY A;  2Q5U A;  3M0D A;  2P7J A;  3L37 A;  5AVX B;  2WWW A;  1SLQ A;  3M0A A;  3V5B A;  4AYC A;  2JJL A;  2QM8 A;  2YO3 A;  3L35 A;  5APX A;  3VYI A;  5AW1 B;  3T97 A;  1GU5 A;  2WT7 A;  4EOT A;  4JYB A;  3P8M C;  1JNM A;  1MFZ A;  2R3C A;  5APS A;  5AW5 B;  3V4W A;  1OWA A;  4AQR D;  2R5B A;  4B86 A;  2ZXE B;  2XZR A;  3O8Z A; 
#chains in the Genus database with same CATH topology
 3PH0 A;  1OFC X;  1GL2 D;  3S1K A;  2FYN C;  3S4R A;  4U3F E;  2K88 A;  3P7K A;  2XU6 A;  3TGU E;  3TGU G;  1BGY D;  1U7M A;  3Q5P A;  3OAK A;  1YHQ P;  2BCC E;  2W6B A;  3H1H D;  1IZN B;  2AXT E;  2WTY A;  1NHL A;  2FFD A;  1W2E A;  3AE4 C;  2P67 A;  1L4A A;  1QVF O;  5AVV B;  2K37 A;  3CCU P;  5M1B A;  2AXC A;  1T3J A;  3KZI H;  4KHX A;  5AVT B;  2ZFC A;  1T8Z A;  2QJP C;  1CSB A;  1JEK A;  2KK7 A;  1ZR2 A;  1HBW A;  4D6T J;  2ZYG A;  3I5C A;  2WZ7 A;  1IFP A;  3H1K D;  3LW5 J;  1VQ4 P;  3H1J J;  1PGQ A;  3L70 J;  3U59 A;  3RGU A;  3NTN A;  3USS A;  4LLH A;  4WB4 A;  1KB9 H;  4HKZ H;  2IBZ G;  2FYU K;  3RL0 g;  1BCC E;  3L35 A;  1BCC G;  3L71 E;  3WU2 H;  1ZP0 C;  3P8M C;  4K3A A;  4B86 A;  4IL6 H;  4C7N B;  5KLI C;  1DH3 A;  3CCV P;  4ZKU A;  3CC4 P;  1FAV A;  2NPS D;  1PP9 E;  1NTK J;  3E1R A;  3E1I A;  4OGQ B;  3ITK A;  1IFI A;  1SQX G;  2W6A A;  4GOD A;  2KSJ A;  1LTS C;  1VQL P;  2Z5H A;  3CWB D;  3D71 A;  4U3F D;  5AVU B;  3AEA C;  1NWQ A;  1KQS O;  1SQP J;  1SFC B;  4RES B;  3A7O A;  1KQL A;  2RMZ A;  1AFO A;  2BCC D;  4UB8 E;  2E5Y A;  4MN4 C;  3RK2 C;  3B5N A;  1XTG B;  3W68 A;  2O01 H;  4OVN F;  2HPC B;  3G4S P;  2N1T D;  5E79 E;  4PV1 C;  3H1L J;  3P8C D;  3JCU H;  5APU A;  2ZYD A;  3LW5 H;  2LXC B;  1IO4 A;  4GOE A;  3CL3 D;  4HJG H;  2H88 C;  2FXP A;  2M5A A;  3GF7 A;  1IC2 A;  2QJP B;  1L0L E;  3PP5 A;  1SQB E;  1L0L G;  1PPJ G;  1SQB G;  1NAY A;  2YNY A;  4N6J A;  3L37 A;  2D2C B;  3H1I J;  3L75 E;  3L75 G;  3MP7 B;  3PJS K;  3V4W A;  3C1L A;  4RKU J;  4JYC A;  3OJA B;  5CCH A;  2HYN A;  1EQ7 A;  1FOS F;  3F89 A;  5CJ4 A;  2QJK C;  1VPC A;  2DW3 A;  3M06 A;  2J58 A;  3V2N A;  2FFD C;  3L71 D;  1NU1 J;  2Z5I A;  1L4A D;  3BCC G;  4CPG A;  4JQ0 D;  3CD6 P;  1JMB A;  3IR9 A;  2QM7 A;  1JCC A;  1ZOY C;  1OXZ A;  5KLI B;  1ZN5 A;  1T2K D;  1JTH A;  3RL0 D;  1KIL C;  1MZ9 A;  1AV1 A;  1KFN A;  1Q81 Q;  5KLV D;  1SQV D;  2IDB A;  4GKG A;  2Y0D A;  4DCK A;  5AW8 B;  3SWF A;  2FXM A;  1HWT C;  1K05 A;  3L73 E;  1YBK A;  1KB9 I;  1NTM E;  2JR8 A;  1NTM G;  2CPB A;  2GUS A;  5AVQ B;  4DJG A;  2Y9Y A;  3HD7 C;  1EDL A;  3PRJ A;  2GM4 A;  1JY2 P;  3RK2 B;  3G6E P;  2CK3 H;  3CX5 H;  1M8O B;  2IYO A;  3PLN A;  2FKW B;  2YMK A;  4C7N A;  2LKM A;  2POH A;  1H89 A;  1DIP A;  1M90 Q;  1OMI A;  3BCC J;  2L5G B;  1KTM A;  2HG5 D;  1BE3 E;  1QEX A;  1H88 A;  1FZF A;  1CI6 B;  1EDI A;  4IL6 X;  3L74 G;  3AE3 C;  1LTJ B;  2KP8 A;  4UB8 H;  3B5N D;  1VQM P;  1S2E A;  2B9B A;  4WY4 B;  3MGN A;  3TSI A;  2QJK B;  3ABV C;  4I1L A;  1VQ6 P;  2OTL P;  2E76 C;  2KIK A;  1MFT A;  2OTJ P;  2ZJS E;  2HPC A;  1KZU B;  1HUC A;  2P10 A;  3KZI E;  1CZQ A;  1KMI Z;  2MKV A;  3L72 D;  1LGH B;  1X9V A;  2R32 A;  1SQQ J;  3SSU A;  1KIL B;  1SLQ A;  1FS0 E;  1JY3 P;  2YXQ B;  2E75 B;  2J59 M;  5CCH D;  1ZR4 A;  5APX A;  3L73 D;  5GTH H;  1YJN P;  1X79 B;  1M1K Q;  3O8Z A;  2HR3 A;  3MIW A;  2KZI A;  4H44 D;  1NO4 A;  1X0T A;  3CLQ A;  4W80 A;  1KB9 E;  1L0N J;  1AA0 A;  2QA4 P;  3HD7 B;  1G2C B;  3WU2 E;  2FYU D;  1JY2 N;  2P1J A;  1LT1 A;  1J1E C;  2ZT9 C;  5AVS B;  1GU4 A;  2NZ2 A;  4BXL A;  2E5T A;  2Z4E A;  3AEG C;  2AEF A;  2BEQ D;  3AE2 C;  4L75 A;  5KLV K;  1EZV I;  4O9B A;  3OA7 A;  1FJP A;  3EFG A;  1BE3 D;  4C46 A;  1PGP A;  2ZXX A;  2PGD A;  3FWN A;  4N78 E;  1KV4 A;  4HH2 A;  1LTB C;  1SP4 A;  2WMM A;  5GTI H;  4OH8 B;  1X22 A;  4ASW A;  1M7L A;  1S9K E;  3JSV C;  2ZVO B;  3P32 A;  3CCJ P;  1KN7 A;  4TT3 H;  1DD4 A;  3Q2Y A;  4ZMD A;  2P7J A;  1K9M Q;  3H1K G;  4BWN A;  2E76 B;  1SQB K;  4RJT A;  3D70 A;  4D6T E;  1JNM A;  2YKP A;  3JCU E;  1OWA A;  1Z56 A;  3VMX A;  3GW6 A;  1JB0 J;  5APW A;  4YXD C;  2R3S A;  1VQO P;  3H1J E;  2Q6Q A;  3L70 E;  1M57 D;  1AQT A;  1Q2N A;  5AW7 B;  2QEX P;  3HE4 B;  4OGQ C;  2PFX A;  2AEJ A;  2MJZ A;  2QRX A;  4YPC A;  2B87 B;  2PP6 A;  2OYH C;  1JY3 N;  5CCG C;  1BGY J;  1SFC C;  1CI6 A;  1URQ C;  1EXJ A;  2FBW C;  2NRG A;  1LTJ A;  2P58 A;  3Q3D A;  3H1H J;  2QE7 H;  5CBO A;  2WSF J;  1R5S A;  1NTZ G;  3HUS C;  3CCL P;  3BVH A;  1NTK E;  1N86 A;  1NTK G;  5KAI H;  2WSE J;  4JPZ B;  4H13 B;  1YI2 P;  2A06 E;  3PTZ A;  1IFJ A;  2A06 G;  1GK4 A;  2V4H A;  2I8D A;  2J5U A;  2OQQ A;  1NKZ B;  1J1E B;  2ZT9 B;  4R4M A;  3H25 A;  2B89 A;  1SQP E;  2SPZ A;  1SQP G;  2D2C C;  1NTM K;  2C0X A;  4N78 D;  1G1J A;  3H1K J;  5KTB A;  1EZV E;  1KQF B;  1KIL A;  5AVX B;  1EZV G;  3M0A A;  4PJ0 H;  2JJL A;  3FWL A;  4EYY Q;  2WT7 A;  3CME P;  2W8Z A;  1ZV8 A;  1YTZ T;  3H1L E;  2R5B A;  1ZLL A;  1N2D C;  3H1L G;  3HRN A;  1KYO I;  5BU8 B;  1KQG B;  1G1I A;  1IK7 A;  2KS1 B;  2IBZ E;  3KQG A;  4L76 A;  1VQP P;  3V6I A;  1RF0 C;  1HJ0 A;  3HD7 A;  4D6T D;  1HF9 A;  3AEC C;  3H1I E;  1G2C A;  3CX5 E;  3H1I G;  3VP9 A;  1RQU A;  3M91 A;  4Y99 C;  5AW3 B;  2C9N Y;  2O3J A;  4N3Y B;  1VQN P;  3KYQ A;  1K04 A;  3AED C;  3BAT A;  1NTZ J;  1HH0 A;  2WSF H;  1LTA C;  1ZRT E;  1SQX E;  3CWB J;  1KIL E;  4PD4 I;  4U3F J;  1NU1 E;  2KLV A;  1NU1 G;  1Q90 D;  1M56 D;  4C7R A;  3AEB C;  5APT A;  2OYH B;  3TGU D;  2WVR A;  1PZQ A;  2FYZ A;  1J1D C;  1EDJ A;  5DJU B;  1URQ B;  1N7L A;  4DZO A;  1OZH A;  3VOP A;  3VN0 A;  4U7J A;  2HLO A;  1SQV G;  3RK2 D;  1PFI A;  3HUS B;  2O1K A;  1LP1 B;  3TDK A;  1T3U A;  4AYC A;  3EWK A;  2KNC B;  4PV1 D;  3F5H A;  1AJY A;  1P84 I;  2Y0C A;  1JO5 A;  4R4L A;  1S4X A;  2YXR B;  1EC5 A;  3K5B A;  1PPJ E;  3B71 A;  3HE4 A;  1IFN A;  4A7P A;  1ZW0 A;  1NH4 A;  1AQ5 A;  2OAR A;  3G9R A;  1LTJ C;  3D6Y A;  4ZNC A;  5GTH E;  4L73 A;  3M9Q A;  2IFM A;  1HVV A;  2C0W A;  2IBZ D;  3L71 J;  4TLF A;  2LXB A;  4WY4 C;  5C39 A;  3Q5R A;  1RE3 C;  1BCC D;  3M0D C;  1VF5 C;  3MTU E;  3BCC E;  3IFM A;  1EDK A;  1YYC A;  1CW5 A;  5KAF H;  3EQ2 A;  3CI9 A;  1DEE G;  1QGK B;  3AE8 C;  5KJ7 C;  2H7H A;  4Y99 B;  3WUT A;  1PP9 D;  2IZ0 A;  4WVZ A;  5KLV J;  1Q7Y Q;  1SQV J;  1SQX D;  2KI7 B;  2YKO A;  1KIL D;  5DJT B;  3M9B A;  5AVZ B;  3CCS P;  2E75 C;  4HYT B;  1GD2 E;  1LWU C;  1NOH A;  2OYI B;  3T97 B;  4KJM A;  4PD4 E;  3EFF K;  3CXH I;  5GTI E;  1J1D B;  4OWF A;  1Y8A A;  3ZDM A;  2IX7 C;  3HD7 D;  2O1J A;  2KS1 A;  4QMA A;  5BVZ A;  3BAS A;  1UII A;  1YJ9 P;  1SQQ E;  1SQQ G;  2HOD B;  1PGJ A;  3AE5 C;  5AW6 B;  2KYV A;  5EFW B;  1USD A;  3GHG C;  1OW7 A;  2BAS A;  1L0L D;  1PPJ D;  1SQB D;  1N73 C;  3KHU A;  1P84 E;  1L0N E;  4YTP C;  3L75 D;  3VMY A;  1L0N G;  3SFD C;  3L74 E;  4GDO A;  4JF7 A;  2OGU A;  1NTK K;  2E74 C;  1VQ5 P;  5K5G B;  3HTK B;  2OYH A;  1PL5 A;  5CCG A;  1SFC A;  1URQ A;  3E7K A;  1NYH A;  1SS1 A;  1RH5 B;  1LTI C;  1Y9B A;  5KAI E;  1SQP K;  1VF5 B;  2E76 D;  3HUS A;  4W7Z A;  1AVY A;  1LP1 A;  1FJK A;  4WWI A;  3L72 J;  5TIS H;  4EOT A;  3AE9 C;  2I1K A;  2WPV B;  3TNU B;  2PRR A;  4H0L C;  1A02 J;  3CCM P;  1X8Y A;  2CPS A;  2KSE A;  1RQV A;  1T6A A;  3L73 J;  3BRT B;  3GF3 A;  2WPR A;  5CJ0 A;  3SFE C;  4GOF A;  1H8A A;  4PJ0 E;  1LWU B;  3V2P A;  3VP8 A;  1UIX A;  1NTM D;  1NAF A;  3H6P A;  1ZME C;  2ZAE B;  1BDC A;  1BDD A;  4JBZ A;  1RY3 A;  5KKZ B;  3RK3 E;  3JC2 2;  3HE5 B;  1FDM A;  2Q3I A;  4DOJ A;  4IFD K;  2YMY A;  1KYO H;  3CXH E;  4IFF A;  1OW8 A;  2FYU J;  4H13 C;  1J2J B;  5AVY B;  2W90 A;  2L91 A;  1FE6 A;  4I2L C;  3MUD A;  1S72 P;  4UB6 H;  5AW9 B;  1RF0 A;  5H2F H;  1ZXG A;  1SQX K;  1BSH A;  2ZT9 D;  3O6Q B;  2Q1K A;  1BGY E;  3GHG B;  1BGY G;  4M3L A;  3V4Q A;  5AVR B;  1N73 B;  5APY A;  3H1H G;  2GUV A;  1E79 H;  3BRV B;  1HGZ A;  1KFM A;  3L74 D;  3TK1 A;  3S9O A;  2M0B A;  4PD4 H;  2YO3 A;  3VYI A;  3FXE A;  3T97 A;  2E74 B;  2R3C A;  5APS A;  2XDJ A;  1GDT A;  4AQR D;  5B5E E;  2XV5 A;  4EDF A;  1AVO A;  1U7J A;  3N4X A;  4HB1 A;  4KT0 J;  1RF1 C;  3H1K E;  4XA4 A;  1L2P A;  1L0L K;  2HOD A;  5CMZ A;  1FZC B;  1OX3 A;  2VRS A;  1OVU A;  2WPQ A;  1N7S C;  3LID A;  4I7Z C;  2Q7C A;  1P84 H;  2K1A A;  1SVF A;  4OGQ D;  2WIT A;  4H0L B;  3A0B E;  1S5L H;  1TU3 F;  5BU5 A;  1U57 A;  1FZB A;  1YIJ P;  2JP3 A;  4LC1 A;  3RK3 C;  2K9Y A;  5CCG D;  1RHZ B;  1SFC D;  2WSC J;  1URQ D;  3H32 B;  3IN6 A;  4Z1M H;  3MD0 A;  1QL2 A;  3C9I A;  2P2U A;  1KB9 D;  3M9H A;  3AE6 C;  3HTK A;  2GA1 A;  1NTZ E;  2W83 C;  1W2B O;  3N7N A;  2KLU A;  4WY4 A;  1WMK A;  1GL2 C;  1OW6 A;  1RE3 A;  3CWB E;  3PHL A;  1HGV A;  3CWB G;  3LIE A;  4U3F G;  3M0D A;  1VQK P;  4H44 B;  5KAF E;  5B66 H;  1YTZ I;  1PV3 A;  2BCC G;  5KJ7 A;  3CPW O;  3FGA D;  3TNU A;  3CCE P;  2D2C D;  1A02 F;  1KC8 Q;  3OW2 O;  3FX0 A;  1N8R Q;  2YKQ A;  3TYY A;  1RE4 C;  2E43 A;  3P8C E;  1IFD A;  1R5L A;  1JTH B;  1JM0 A;  1LWU A;  4IFM A;  5AW2 B;  1S9K D;  2LR2 A;  5L8R J;  3NFQ A;  1JUN A;  1SQQ K;  2A45 I;  2KOG A;  2O01 J;  3HE5 A;  3CXH H;  4EI2 A;  2IPP A;  3MUD C;  1GMJ A;  2H43 A;  5AVW B;  1M1J C;  3QH9 A;  1JOC A;  1HTL C;  2FXO A;  4XE5 B;  3W67 A;  1RF1 B;  1VQ8 P;  2N9B A;  2KUB A;  2WPS A;  3Q1M A;  3H1J D;  3L70 D;  1L0N K;  2WSC H;  1K8A Q;  5AW4 B;  2QVA A;  3O6Q A;  3MHV A;  1IFM A;  1N7S B;  2W6J H;  3GHG A;  3L71 G;  1XTC C;  4I7Z B;  1N73 A;  1LT9 B;  4Y28 J;  1PIX A;  2WSE H;  3TGU J;  2ZVN B;  2OYI C;  2Q5U A;  1JY2 O;  3CC2 P;  2NPS C;  4YXW H;  1PP9 G;  2BCC J;  3FXD A;  3RK3 B;  1W5C E;  2FY8 A;  5AW1 B;  4ASV A;  3WMM 0;  4JYB A;  1MFZ A;  1NTZ D;  2HFE D;  5B5E H;  2XKM A;  1YQ3 C;  1NTK D;  1KOR A;  5KLV E;  1SQV E;  3SWK A;  3R4Y A;  5KLV G;  1USE A;  1Q82 Q;  3KPE A;  3I55 P;  4EIJ A;  1FC2 C;  2A06 D;  2K3R A;  3UIA A;  1FZE A;  3VTP C;  1GL2 B;  3RBZ A;  2FYN B;  3A5T A;  5TIS E;  1OVR A;  1IJD B;  1SQP D;  2XNX A;  1FZC A;  3A0H H;  2C9L Y;  5AW0 B;  5APV A;  1EZV D;  3A0B H;  1HJB A;  1DD3 A;  2N1T C;  2WSS H;  1NJI Q;  1OVV A;  3H1L D;  3G3Z A;  1GK6 A;  2B87 A;  4LGD E;  1BCC J;  3H32 A;  3V2Q A;  3I56 P;  3Q5S A;  4WY4 D;  2M8R A;  2QIW A;  1KYO E;  2A45 G;  3CMA P;  3NMD A;  1S5L X;  1VF5 D;  1WT6 A;  3H1I D;  3CX5 D;  2O01 N;  1M1J B;  1NVO A;  1PP9 J;  1LTT C;  4UB6 E;  1JY3 O;  3V5B A;  1SQX J;  5H2F E;  3G71 P;  3GG2 A;  5KJ7 D;  2AXT H;  4BRY B;  1L4A C;  1ZRT D;  1S3J A;  1OIP A;  1H0T B;  3CCR P;  1NGM B;  1MUU A;  1NU1 D;  2JEE A;  2YO2 A;  2E75 D;  1YJW P;  3VMZ A;  3WUU A;  3GLM A;  3MZW B;  4RO0 A;  1WRG A;  1T2K C;  2E42 A;  3KXD A;  5KKZ C;  3RL0 C;  4IOI H;  2N9Y B;  3L72 E;  2NPS B;  1LNQ A;  3L72 G;  1FDI A;  4GT1 A;  2IYP A;  3TF5 A;  1YIT P;  3VMA A;  4WBA A;  3KDP B;  2XND H;  1VQ7 P;  3L73 G;  1GW4 A;  4NPD A;  2YIU C;  3CCQ P;  1L0L J;  1FDO A;  1SQB J;  1RF1 A;  2K9J B;  1Y47 A;  2KXP B;  3L75 J;  2G8Y A;  2QJY C;  1GW3 A;  1FBM A;  1N7S A;  3SWY A;  2N1T B;  1S5L E;  2FYU E;  4PV1 B;  2FYU G;  3WUV A;  4K35 A;  1LT9 A;  1NTZ K;  2I1J A;  2E74 D;  3L4F A;  3GMA A;  2Q3E A;  2IZ1 A;  1KYO D;  2H8P D;  5AW5 B;  2ZXE B;  1BE3 G;  5TJH A;  3BCC D;  3AE1 C;  3II6 A;  2Q9I A;  2Y9Z A;  3QWO C;  1QVG O;  5CBN A;  1VL2 A;  1FZC C;  1GL2 A;  3IAO A;  3B5N C;  4I6M C;  2KNC A;  3AEE C;  5B66 E;  1BSN A;  2IFN A;  3B8E B;  2FFD B;  1LTG C;  1GTW A;  4H0L D;  3L36 A;  1FZG A;  2G3A A;  2B88 A;  1QLE D;  1L4A B;  2JDI H;  3D6Z A;  5E79 H;  1GZL A;  1NKN A;  2OYO A;  2KB7 P;  2ITA A;  2KZJ A;  1NTM J;  1MKM A;  1QL1 A;  4PD4 D;  2H89 C;  3B4S A;  3U1A A;  2PAJ A;  1RE4 A;  2V7Q J;  3C8V A;  2WQY C;  1D7M A;  2W27 A;  3RL0 B;  4L74 A;  4DT0 A;  2JO1 A;  1PGO A;  2A45 H;  3AE7 C;  5CCH C;  2WT7 B;  1SQQ D;  3V2R A;  1VDF A;  1S1C X;  2M3B A;  2RH0 A;  4H13 D;  2ZYA A;  1R8E A;  4H44 C;  1M1J A;  2YIU B;  2WWW A;  1NU1 K;  1JCD A;  1YQ4 C;  2Y0E A;  1EXI A;  1P84 D;  2UWJ E;  4W7Y A;  1BE3 J;  1GU5 A;  3R2P A;  2JWA A;  4BRY A;  3H1H E;  1L0N D;  3L74 J;  1IK9 A;  2QJY B;  5APQ A;  1H0T A;  4IL6 E;  1Q86 Q;  1FZA A;  4AUW A;  1FOS E;  2QG4 A;  1QX8 A;  5CHX A;  1SQV K;  2R5D A;  2OYI A;  1KD1 Q;  2NPS A;  3NXS A;  2BEZ F;  2JWD A;  4GIF A;  2IBZ I;  3AEF C;  1JMM A;  3RBX A;  2JKV A;  4ZKP A;  2OTK E;  3B5N B;  1FU1 A;  2V7Q H;  3CX5 I;  1K73 Q;  1N7S D;  2K9J A;  2QSI A;  2M3E A;  1DEB A;  3A0H E;  1MV8 A;  1LT9 C;  3A3Y B;  4NPF X;  1DX7 A;  4D6T G;  2RKL A;  1E5W A;  2N1T A;  2M5A B;  3H1J G;  3L70 G;  3A2A A;  3RK3 D;  2R44 A;  2RN0 A;  3U1C A;  1VQ9 P;  3CC7 P;  3IF4 A;  2AEM A;  2QM8 A;  3CXH D;  1LJ2 A;  4NPE A;  4XFJ A;  2XZR A; 
#chains in the Genus database with same CATH homology
 1J1D B;  3MIW A;  1GL2 D;  1NO4 A;  3KPE A;  2IX7 C;  3HD7 D;  2O1J A;  4EIJ A;  3CLQ A;  5BVZ A;  4W80 A;  3BAS A;  3P7K A;  3UIA A;  2XU6 A;  1FZE A;  3VTP C;  1GL2 B;  3OAK A;  2HOD B;  3HD7 B;  3A5T A;  1G2C B;  2W6B A;  1IJD B;  5AW6 B;  2KYV A;  2XNX A;  2WTY A;  1FZC A;  1JY2 N;  3GHG C;  1NHL A;  2P1J A;  2FFD A;  2BAS A;  1J1E C;  1W2E A;  2P67 A;  1L4A A;  5AVS B;  1GU4 A;  2C9L Y;  5AW0 B;  1N73 C;  5AVV B;  5APV A;  1HJB A;  2Z4E A;  2N1T C;  1T3J A;  4KHX A;  5AVT B;  5KLV K;  4O9B A;  2ZFC A;  3OA7 A;  1FJP A;  1T8Z A;  1CSB A;  3VMY A;  3EFG A;  3G3Z A;  1GK6 A;  4C46 A;  1ZR2 A;  4LGD E;  4N78 E;  4JF7 A;  1HBW A;  1NTK K;  3H32 A;  4HH2 A;  1LTB C;  3V2Q A;  1SP4 A;  3I5C A;  4WY4 D;  3HTK B;  2M8R A;  2OYH A;  2WZ7 A;  4OH8 B;  5CCG A;  1SFC A;  1URQ A;  2A45 G;  1M7L A;  1S9K E;  3NMD A;  3P32 A;  3U59 A;  3NTN A;  1WT6 A;  4LLH A;  4WB4 A;  1M1J B;  1LTI C;  1LTT C;  1SQP K;  3HUS A;  2FYU K;  4W7Z A;  2P7J A;  1JY3 O;  3V5B A;  1FJK A;  5KJ7 D;  3L35 A;  1SQB K;  4EOT A;  3P8M C;  1JNM A;  1L4A C;  2I1K A;  2YKP A;  1OWA A;  4B86 A;  1Z56 A;  3VMX A;  5APW A;  1MUU A;  3TNU B;  4C7N B;  1A02 J;  1X8Y A;  5AW7 B;  2CPS A;  2JEE A;  2YO2 A;  1DH3 A;  3HE4 B;  4ZKU A;  3BRT B;  1FAV A;  3VMZ A;  2NPS D;  2WPR A;  5CJ0 A;  2MJZ A;  1H8A A;  3E1I A;  1WRG A;  1LWU B;  1T2K C;  3V2P A;  2E42 A;  3VP8 A;  3RL0 C;  1IFI A;  2W6A A;  1NAF A;  2NPS B;  3H6P A;  2KSJ A;  1LTS C;  2PP6 A;  2OYH C;  4GT1 A;  1JY3 N;  1RY3 A;  5CCG C;  1SFC C;  2Z5H A;  1CI6 A;  1URQ C;  3HE5 B;  1FDM A;  2Q3I A;  4DOJ A;  4IFD K;  5AVU B;  1LTJ A;  4WBA A;  3KDP B;  1NWQ A;  2YMY A;  1SFC B;  4RES B;  3A7O A;  4IFF A;  1KQL A;  1GW4 A;  1J2J B;  5AVY B;  1AFO A;  3HUS C;  3BVH A;  1N86 A;  4I2L C;  3MUD A;  1RF1 A;  3RK2 C;  5AW9 B;  3B5N A;  1RF0 A;  1SQX K;  1XTG B;  1IFJ A;  1GK4 A;  2O01 H;  2HPC B;  2N1T D;  3GHG B;  4M3L A;  3P8C D;  1GW3 A;  1FBM A;  1NKZ B;  1N7S A;  3V4Q A;  1J1E B;  3SWY A;  5APU A;  5AVR B;  3LW5 H;  1N73 B;  1IO4 A;  5APY A;  2GUV A;  2N1T B;  3CL3 D;  1LT9 A;  3BRV B;  1IC2 A;  1HGZ A;  1KFM A;  3PP5 A;  1NTM K;  1NTZ K;  2C0X A;  2I1J A;  4N78 D;  3TK1 A;  1G1J A;  5KTB A;  2YNY A;  4N6J A;  1KIL A;  3L4F A;  3L37 A;  5AVX B;  3M0A A;  2JJL A;  2YO3 A;  3VYI A;  3T97 A;  2WT7 A;  1ZV8 A;  2H8P D;  2R3C A;  5APS A;  2XDJ A;  5AW5 B;  1GDT A;  3V4W A;  1YTZ T;  4AQR D;  2R5B A;  2ZXE B;  1ZLL A;  1N2D C;  3HRN A;  5BU8 B;  2XV5 A;  4JYC A;  3OJA B;  5CCH A;  3II6 A;  2Q9I A;  1G1I A;  3N4X A;  2HYN A;  1EQ7 A;  1FOS F;  3KQG A;  5CJ4 A;  1RF1 C;  1VPC A;  1FZC C;  3M06 A;  1GL2 A;  2J58 A;  3B5N C;  3V2N A;  4XA4 A;  2FFD C;  1RF0 C;  1L0L K;  2HOD A;  2Z5I A;  3HD7 A;  4I6M C;  1L4A D;  1G2C A;  2IFN A;  3B8E B;  3VP9 A;  5CMZ A;  1FZC B;  2FFD B;  1LTG C;  3M91 A;  1GTW A;  4Y99 C;  5AW3 B;  2VRS A;  3L36 A;  2WPQ A;  1FZG A;  2C9N Y;  1N7S C;  3LID A;  1L4A B;  4N3Y B;  3KYQ A;  3IR9 A;  2Q7C A;  1GZL A;  3BAT A;  1SVF A;  1NKN A;  2QM7 A;  2KB7 P;  1JCC A;  2WIT A;  1OXZ A;  1HH0 A;  1ZN5 A;  5BU5 A;  1QL1 A;  2WSF H;  1LTA C;  1T2K D;  3U1A A;  1JTH A;  1FZB A;  3RL0 D;  1KIL C;  1MZ9 A;  2PAJ A;  1KFN A;  1RE4 A;  2KLV A;  4LC1 A;  3RK3 C;  5CCG D;  2W27 A;  3RL0 B;  1SFC D;  1URQ D;  3H32 B;  4C7R A;  4GKG A;  3MD0 A;  1QL2 A;  3C9I A;  5APT A;  5AW8 B;  3SWF A;  2OYH B;  2P2U A;  2A45 H;  3M9H A;  2FXM A;  2FYZ A;  1J1D C;  5CCH C;  2WT7 B;  1HWT C;  3HTK A;  1URQ B;  3V2R A;  1VDF A;  1N7L A;  4DZO A;  2M3B A;  3VOP A;  2CPB A;  2GUS A;  3N7N A;  4WY4 A;  5AVQ B;  3VN0 A;  2HLO A;  1GL2 C;  3RK2 D;  1M1J A;  1RE3 A;  1PFI A;  1HGV A;  3HD7 C;  3HUS B;  3LIE A;  2O1K A;  2GM4 A;  3M0D A;  2WWW A;  1T3U A;  1NU1 K;  1JCD A;  1JY2 P;  3RK2 B;  4AYC A;  4W7Y A;  1GU5 A;  3R2P A;  1YTZ I;  1IK9 A;  5APQ A;  1JO5 A;  2FKW B;  5KJ7 A;  3TNU A;  4C7N A;  1A02 F;  2LKM A;  1FZA A;  2POH A;  4AUW A;  1H89 A;  1FOS E;  3HE4 A;  1IFN A;  2YKQ A;  3TYY A;  1RE4 C;  2E43 A;  3P8C E;  1NH4 A;  1SQV K;  5CHX A;  1IFD A;  2R5D A;  1AQ5 A;  2OAR A;  1JTH B;  2OYI A;  1LWU A;  2L5G B;  4IFM A;  5AW2 B;  1S9K D;  2HG5 D;  1LTJ C;  2NPS A;  3NFQ A;  1JUN A;  1SQQ K;  2A45 I;  1H88 A;  1FZF A;  2KOG A;  1CI6 B;  3M9Q A;  2IFM A;  1HVV A;  3NXS A;  1LTJ B;  2C0W A;  3HE5 A;  2KP8 A;  2IPP A;  4WY4 C;  4GIF A;  2H43 A;  1JMM A;  1M1J C;  1RE3 C;  5AVW B;  3B5N D;  1JOC A;  1HTL C;  4XE5 B;  4WY4 B;  3M0D C;  3MGN A;  3TSI A;  3MTU E;  1RF1 B;  2N9B A;  3IFM A;  4ZKP A;  3B5N B;  1FU1 A;  1YYC A;  2WPS A;  4I1L A;  1CW5 A;  1N7S D;  1L0N K;  2WSC H;  3EQ2 A;  3CI9 A;  5AW4 B;  1DEB A;  5KJ7 C;  2H7H A;  4Y99 B;  1IFM A;  1N7S B;  1KZU B;  2HPC A;  3GHG A;  1MV8 A;  1LT9 C;  3A3Y B;  1HUC A;  1DX7 A;  1XTC C;  1E5W A;  1CZQ A;  1N73 A;  2YKO A;  1KIL D;  2N1T A;  1LGH B;  1LT9 B;  3M9B A;  5AVZ B;  1X9V A;  2WSE H;  2R32 A;  3A2A A;  3RK3 D;  2OYI C;  4HYT B;  1GD2 E;  1LWU C;  1NOH A;  1KIL B;  3U1C A;  2Q5U A;  1JY2 O;  1SLQ A;  2NPS C;  1JY3 P;  2QM8 A;  2J59 M;  3RK3 B;  2OYI B;  5CCH D;  1ZR4 A;  5APX A;  5AW1 B;  3WMM 0;  4JYB A;  1MFZ A;  1X79 B;  2HFE D;  2XKM A;  2XZR A;  3O8Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...