1SP4A

Crystal structure of ns-134 in complex with bovine cathepsin b: a two headed epoxysuccinyl inhibitor extends along the whole active site cleft
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
48
structure length
48
Chain Sequence
LPESFDAREQWPNCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHSNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of NS-134 in complex with bovine cathepsin B: a two-headed epoxysuccinyl inhibitor extends along the entire active-site cleft.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cathepsin B
total genus 11
structure length 48
sequence length 48
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2004-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1sp4A01
5APXA 3TNUB 3V4QA 5APVA 1GTWA 1SP4A 1OXZA 3NFQA 3TNUA 5AVQB 3M0AA 3HE4A 1GD2E 3M9BA 4XE5B 2XZRA 4DZOA 3P32A 3TYYA 2VRSA 5CMZA 2R5BA 5AVUB 5APSA 3VMXA 4RESB 2BASA 3MGNA 5AW0B 4EOTA 2ZXEB 3M91A 3P7KA 3VN0A 3A5TA 1IO4A 3A2AA 1A02F 1A02J 2WT7A 4KHXA 1JUNA 3L35A 4C7NA 2R32A 3I5CA 5AW3B 5AW4B 5AW6B 4C46A 2N9BA 1S9KD 1GU5A 1HUCA 3HE4B 3KDPB 4C7NB 1DH3A 5AW8B 3VMYA 1S9KE 5AW7B 5AVYB 1FOSE 5AVWB 2E43A 3M06A 1YYCA 2WWWA 2YO2A 3NMDA 1HJBA 3HE5A 2R3CA 3LIDA 2JJLA 2WTYA 2XV5A 4JYBA 2Q7CA 2WT7B 5AW1B 2ZFCA 3LIEA 3P8MC 1OWAA 2P67A 3A7OA 1JNMA 5AVTB 3SWFA 2QM7A 2C9LY 1CZQA 3L36A 5APWA 2Z5IA 5AVSB 3A3YB 5AW5B 5APTA 3UIAA 2E42A 3VTPC 1H88A 1GZLA 3O8ZA 3KQGA 1FAVA 1SLQA 1T2KC 3TK1A 3B8EB 3HE5B 4JYCA 2H7HA 3V5BA 4AUWA 2R5DA 2P2UA 2Z5HA 1HBWA 1MV8A 3M0DA 5AW2B 2WPQA 3HTKA 1CSBA 5APUA 4AQRD 3M9HA 3V4WA 3L37A 5APYA 5APQA 2XU6A 4AYCA 3MD0A 1KQLA 5AVRB 3OAKA 3IR9A 4I6MC 3VMZA 2W6AA 5AVVB 3T97A 1MUUA 4M3LA 4GT1A 2IPPA 4I2LC 3NXSA 3VYIA 1HWTC 1CI6A 2YNYA 3NTNA 1CI6B 5AVXB 1H8AA 2W27A 4GKGA 1NWQA 1GK6A 4HYTB 2WPRA 1T2KD 2Q3IA 4LC1A 2C9NY 1J2JB 1FOSF 2Q5UA 2WPSA 4B86A 5AVZB 2P7JA 1MFZA 1G2CB 1NAFA 1X8YA 2YO3A 1GU4A 5AW9B 1GK4A 2KP8A 1H89A 2QM8A
chains in the Genus database with same CATH superfamily
5APXA 4JPZB 3HD7C 3IAOA 3A0BE 3S4RA 1JY2P 4OVNF 4W80A 1SP4A 5KKZC 3L70E 2J59M 2C0XA 2ZT9D 1VQMP 1G1IA 1ZN5A 1EDKA 1LTBC 1R5SA 3HE4A 3VP9A 1VQ9P 3KXDA 1N7SA 2CPBA 3D70A 1W2EA 3V2PA 2DW3A 2ZVOB 2NZ2A 3AE7C 3KZIH 4H13B 1HGZA 2QJPC 4EYYQ 1QEXA 2B87A 3AE8C 1NYHA 1SQQD 3L4FA 4L76A 1K73Q 3RK2D 1DEEG 3P7KA 3R2PA 4EOTA 1IO4A 3HD7A 2QE7H 4PV1C 3CMEP 2OYHC 3N7NA 1IFDA 3H25A 3MUDA 4JQ0D 1M7LA 4IFDK 1A02J 3TGUG 2B89A 2W83C 1JUNA 2Y0DA 3PLNA 1FJKA 1SQQG 2I1KA 1G1JA 3L70G 4YTPC 1H0TB 1KILE 2W8ZA 3CCLP 3I5CA 1FS0E 5AW3B 3Q3DA 1LTJA 1KQSO 2K9JB 1Z56A 1RF1A 1BSHA 3AE5C 3KZIE 1X0TA 4GOFA 2IBZD 4WVZA 1UIIA 1KB9I 2A06G 3ABVC 2FYNC 1P84E 2ZYDA 3Q1MA 4BXLA 1VQ4P 2P10A 4YXWH 3WUTA 1ZOYC 1YJWP 1URQA 1W5CE 3L75E 1JMMA 2OGUA 5AVWB 4ASVA 1SFCC 4N78D 2A06D 1PPJE 2M3BA 2MKVA 2YO2A 4WY4C 2Y0EA 3CMAP 3FXDA 3L72G 3PRJA 1NOHA 1SQQE 1QL1A 2JDIH 2A06E 3GG2A 4N78E 1X22A 4UB8H 2Q7CA 4KJMA 2ZFCA 1PZQA 2KNCB 4UB8E 2P67A 1RF1B 4RJTA 1S5LE 1NKNA 2N1TA 2QJYC 1GL2D 3MTUE 3AEEC 1DX7A 1SQXK 1L4AB 2L5GB 2Q6QA 2QM7A 1Y9BA 2WITA 3H1HE 1CZQA 3KPEA 3L36A 3V6IA 2KLUA 1KILC 2FYUG 3RK3D 5AW5B 2BCCE 5H2FE 1JO5A 5BVZA 1JMBA 5KJ7D 3CX5H 2E42A 1IC2A 2HFED 4PD4H 4PJ0H 4WB4A 3Q5SA 2D2CD 4PV1B 2OYHB 1AVYA 1JY3P 1ZLLA 1RQVA 1SQVJ 2KSJA 3CXHH 3L72E 3MP7B 2AXTH 3TK1A 2O01N 1T2KC 3HE5B 2Y9ZA 3H1JJ 3D6YA 2I1JA 2JP3A 1OVUA 1SQBG 1NTMD 1RF0A 4H44D 2YIUB 4AUWA 2FXOA 3IN6A 3TGUD 1MZ9A 1SQVK 1VQKP 2E74C 3H1JD 2Y9YA 3HTKA 4GDOA 5APUA 4AQRD 4D6TJ 3PHLA 3M9HA 2IDBA 2N1TB 3L37A 1AFOA 4AYCA 1AQ5A 2E75C 1KQLA 1L4AA 5AVRB 2V7QH 1EDLA 3AE6C 2RN0A 1VQ7P 1J1DC 4K3AA 2ZJSE 5AVVB 3T97A 5CCGD 2QVAA 2WSCH 1FZCA 3G9RA 4L75A 4M3LA 1FZCC 1NU1J 1Y47A 1NTZD 2I8DA 1CI6A 2WZ7A 3BVHA 4OWFA 2OTKE 2KIKA 1JB0J 4PD4I 4WY4B 1FJPA 2YNYA 1LP1B 3NTNA 1NH4A 2JR8A 2JEEA 2CPSA 1J1EC 4KT0J 1KYOI 3AEBC 5KLIB 1NWQA 1YI2P 2NPSC 1N7SC 1JY2O 3B5NB 2OARA 3M0DC 4GOEA 1T2KD 1KFMA 2LR2A 3TSIA 3V2RA 1SQQK 1N73B 1BSNA 5AVZB 1G2CB 3GHGA 1YJNP 1LWUC 1NAFA 5CJ0A 1X8YA 1VQLP 1GK4A 3H1IG 4WBAA 3VOPA 5K5GB 1N8RQ 3KYQA 3CC4P 1SQQJ 1L0LK 1OIPA 3AE9C 4BRYB 4PD4D 1LTSC 2XNXA 3V4QA 1USDA 2O3JA 3NFQA 3TNUA 3CC7P 1QLED 5AVQB 2FYUJ 1M90Q 1GD2E 3CWBD 1EDIA 1RE4A 2XZRA 3M9BA 3PTZA 4MN4C 4XE5B 1Q81Q 5KLVK 5CMZA 3BRVB 2R5BA 1DD3A 1JY2N 1KYOH 4IL6H 5AVUB 4RESB 2WPVB 3QH9A 3VMXA 2O1JA 3C1LA 1KB9H 2BASA 2QIWA 3PP5A 4EDFA 5B66E 1GMJA 1SFCD 2J58A 2K3RA 2RH0A 3U1AA 1AVOA 4A7PA 1EZVE 3L73G 2KS1A 3M91A 3CCUP 1USEA 2WVRA 3VN0A 1LT9C 5KTBA 4U3FE 3B4SA 2GUSA 1LTIC 2AEMA 3A2AA 3CCQP 2H89C 1BDDA 1VL2A 4H44C 1J1DB 3P8CD 1SQXE 2YXQB 2WMMA 4N3YB 4XA4A 1KC8Q 2V7QJ 3E1RA 3H1HJ 3L75J 2Q3EA 1M8OB 3WUUA 4C7RA 2K9JA 4C7NA 1FC2C 2NPSD 2R32A 1IK7A 1VDFA 1PP9G 4C46A 5AW4B 5AW6B 1NTZG 2N9BA 3FXEA 4D6TE 3HE4B 3KDPB 1DH3A 1U57A 4OGQC 3SWKA 1KYOE 5AW8B 5KLIC 3VMYA 4UB6H 3L71J 1YIJP 5AVYB 5KAIE 3JCUE 3M9QA 1M1KQ 3H6PA 2Y0CA 3GLMA 3EQ2A 2WSFJ 2KB7P 2KS1B 2E76C 3BATA 5L8RJ 2M5AA 4HKZH 3AEDC 3CX5I 2WWWA 3SWYA 1Q90D 1Q2NA 1E5WA 2R44A 2PFXA 1LWUB 1IFNA 3LW5H 2JJLA 4DT0A 2XV5A 1FDIA 4JYBA 2WSEJ 2E74D 1AQTA 1H0TA 3LIEA 3P8MC 4D6TG 1OWAA 1LTJB 1RY3A 1S2EA 1LJ2A 2O01J 2H43A 1OX3A 1VQ6P 3TDKA 1BCCD 1IFJA 1RF0C 5AVTB 3SWFA 5B5EH 2IBZE 2Q9IA 2C9LY 1DIPA 2JKVA 4D6TD 4K35A 1RF1C 3JC22 5AVSB 4RO0A 2J5UA 3UIAA 1GL2A 2IYPA 1T3JA 1QGKB 1URQB 1H88A 1GZLA 1LT9B 1ZXGA 3H1LD 1CW5A 5CBNA 1FAVA 3CL3D 3U59A 2HPCB 3B8EB 1GL2C 1EZVI 3H1KE 3L74G 5KAFE 3EFFK 1LWUA 3HUSC 5CJ4A 1FZEA 1SQBJ 1XTGB 3MIWA 3CLQA 1SQPK 2R5DA 2Z5HA 1SQBK 3V2QA 1NJIQ 1PGQA 1QL2A 1VF5B 2JO1A 1HH0A 5AW2B 3MZWB 2D2CC 1PP9D 3B5ND 1KORA 1RE3A 5APQA 3L71D 2KSEA 5CCHA 2YIUC 2OYIB 2C0WA 4W7YA 4XFJA 1NTMG 2YXRB 3Q5RA 1NTZE 1W2BO 2E74B 3H1IE 4H0LB 1L0LD 1FE6A 1N7LA 1GW4A 1MUUA 3USSA 4ZMDA 5KLVG 2K88A 2IPPA 1URQD 3NXSA 1VQNP 1NTKG 2KK7A 1BE3G 4IL6X 4IFFA 1PL5A 2POHA 1BCCJ 1KZUB 4OH8B 1IFPA 3A0HE 2WSFH 3L74E 1RH5B 2W27A 1DD4A 1QVGO 1H8AA 4GKGA 2W90A 1FZAA 4NPDA 3OJAB 4HYTB 2OTLP 2JWAA 4IL6E 1T8ZA 3AEAC 4I1LA 1J2JB 1FZGA 3HTKB 2Q5UA 1LTJC 2WSEH 2CK3H 3E1IA 2MJZA 3E7KA 1EC5A 5H2FH 3WUVA 4HB1A 3ZDMA 3CXHD 2NPSB 3B5NC 1EZVG 2PRRA 4IOIH 1NTZK 3H1LE 5DJUB 5B5EE 3TF5A 2OYIA 2KUBA 4TT3H 3JSVC 2W6BA 2FYUK 3T97B 1LTAC 1LT1A 3AEGC 1S5LH 1L0ND 5E79E 5KLVJ 3TNUB 1HJ0A 3RK3E 1PIXA 1NTKK 5APVA 1FBMA 1FZBA 2QEXP 2RMZA 3A0HH 3H1ID 1NTKJ 1IFMA 1ZV8A 1IZNB 1OVRA 1URQC 4Y99B 4ASWA 1L4AD 4DZOA 3P32A 4O9BA 3TYYA 4L73A 1FOSF 2VRSA 2WSSH 3WU2E 1K9MQ 1NU1E 1FDMA 1OZHA 1YITP 3TGUE 2WQYC 1NO4A 1NTME 5AW0B 1T3UA 1G2CA 3GHGB 3H1JG 2FXPA 5GTHH 3RL0B 3G6EP 1AJYA 2KOGA 2BCCG 1A02F 1KTMA 2RKLA 2IZ0A 1M1JB 2A45G 3H1HG 1VQ8P 2N9YB 2WT7A 4BRYA 2OYIC 5BU8B 2IX7C 3L35A 4N6JA 1KILA 3Q2YA 2AEFA 3MHVA 1KYOD 1EDJA 1KB9E 3FX0A 5B66H 1E79H 1KB9D 1NTMK 2H88C 3WU2H 1ZR2A 2B9BA 1ZR4A 1NU1K 2PAJA 1PGJA 1ZW0A 2IFMA 1FOSE 3C9IA 3H1KJ 3OA7A 3BCCG 2AEJA 2KZJA 5CBOA 2XNDH 1SFCB 1SQBE 1SQXD 1X9VA 2NRGA 3C8VA 1M57D 2HLOA 3AE3C 2E43A 3MUDC 1LTGC 3SFEC 2KYVA 1OW6A 1EZVD 1AA0A 3GF7A 3LIDA 3VP8A 2WTYA 2HODB 2WT7B 1NU1D 1JTHB 5AW1B 3RK2B 2E5TA 1HF9A 1EXJA 2XKMA 3GW6A 1LTTC 1KFNA 1L0LJ 3H1IJ 2QJYB 3BASA 4NPEA 3F89A 4YPCA 2P1JA 4ZKPA 2FFDB 2BEZF 1UIXA 2A45I 4EIJA 3CI9A 2GUVA 1K8AQ 4DJGA 1PP9J 1PFIA 1NU1G 4Y99C 3LW5J 3AECC 5APTA 2GM4A 1SFCA 1BE3J 2G8YA 5KLVE 2HPCA 1BCCG 3AE1C 2ZVNB 2ZYAA 3KQGA 5TJHA 2O01H 1SLQA 3V2NA 3WMM0 2R3SA 3GHGC 1M1JC 1N7SD 4JYCA 3RL0D 1IFIA 2BEQD 2M3EA 2HODA 3V5BA 2K37A 2QJKC 4H13D 3CD6P 1ZRTD 2P2UA 1Q82Q 3SFDC 2ZYGA 3M0DA 1RE3C 1HVVA 2GA1A 1DEBA 2N1TC 2O1KA 2WPQA 4JBZA 2KI7B 5CCHC 3HUSB 1S5LX 3L74D 4RKUJ 2ZT9B 2KLVA 4Z1MH 3L75G 3OAKA 3PH0A 4I6MC 4R4MA 5TISE 3BCCE 4ZNCA 4HH2A 4EI2A 3L70D 1SVFA 1RHZB 1U7JA 3R4YA 4WY4A 3D6ZA 4I2LC 3BCCD 2AXCA 4PD4E 1LP1A 2LXBA 2V4HA 3VYIA 1FZCB 1K04A 3L71G 1HWTC 3H1LJ 2IBZG 3G3ZA 3GMAA 5GTHE 4H0LC 1WRGA 1ZP0C 4H0LD 1YJ9P 5AVXB 3B5NA 1L0NJ 3QWOC 1L2PA 1N7SB 2QSIA 3OW2O 3CXHE 3H1JE 1GK6A 1L0NK 1LGHB 1J1EB 1PV3A 2IFNA 3O6QB 2YMKA 2WPRA 1ZRTE 1NTKD 1RQUA 1S4XA 2HYNA 3AE4C 2UWJE 4LC1A 1NTKE 2B87B 2FBWC 2WPSA 2Z4EA 4B86A 1NHLA 1MFZA 1OFCX 1TU3F 2P7JA 4U7JA 3HD7B 2YO3A 1GU4A 1MFTA 5AW9B 3Q5PA 1OMIA 1H89A 2FFDC 2OTJP 2HR3A 3FWNA 3U1CA 4QMAA 1PGOA 2QM8A 1JY3O 3D71A 4JF7A 3ITKA 2LXCB 2P58A 1M56D 1WMKA 2QRXA 2XDJA 1GTWA 2YMYA 1L0LE 1OXZA 3HD7D 1KMIZ 2ITAA 3M0AA 4H13C 3G71P 1P84H 3H1LG 4L74A 3JCUH 2FYUD 4DCKA 1L0NG 2FY8A 5APSA 3H1KG 4NPFX 4HJGH 3O6QA 3L73E 3W68A 1FDOA 1BGYG 2WSCJ 2E75D 1HTLC 1XTCC 2QJKB 3MGNA 4IFMA 5TISH 1D7MA 3CCJP 2ZXEB 3EFGA 2IYOA 3L73J 3RK3C 2N1TD 1JY3N 3A5TA 1M1JA 3CCSP 2M8RA 4U3FG 3H1KD 4UB6E 2ZAEB 1SQBD 2ZT9C 3HRNA 3L75D 3PJSK 1IJDB 1BGYD 4H44B 4Y28J 3BRTB 2HG5D 4KHXA 5BU5A 3RL0C 1L0LG 3FWLA 1SQPJ 5KLVD 3S9OA 2KNCA 1EQ7A 1EXIA 2BCCD 1S9KD 4GIFA 1GU5A 1HUCA 1BE3D 1SQPE 4WY4D 4C7NB 3CC2P 1BE3E 1SQPD 5KJ7C 5C39A 3H1HD 1S9KE 4OGQB 1BCCE 5AW7B 2YKQA 2ZXXA 3CCEP 1KILD 2JWDA 3BCCJ 1YTZI 1U7MA 2B88A 2K1AA 3CXHI 4I7ZC 1QX8A 1SQVG 1RE4C 2M5AB 2OYOA 2AXTE 2LKMA 1JCCA 3GF3A 2YKPA 3M06A 5E79H 1N86A 1KN7A 3II6A 1YYCA 3NMDA 3RBXA 4YXDC 2E76B 1SS1A 3CX5D 4CPGA 1HJBA 1JOCA 3CX5E 3HE5A 1JTHA 1PPJD 2R3CA 1NVOA 3SSUA 4BWNA 3VMAA 5CCHD 1OW8A 3AE2C 1L4AC 2Q1KA 4W7ZA 2FXMA 4WWIA 3TGUJ 2FFDA 3H32A 3CWBJ 3I55P 2A45H 3A7OA 3L70J 1KILB 1AV1A 3N4XA 1P84D 2PP6A 1JNMA 1VQ5P 4LLHA 1T6AA 1X79B 2IBZI 2OQQA 3CWBE 5EFWB 5GTIH 5KJ7A 1S3JA 1VQOP 1JCDA 1YQ3C 3EWKA 1NTZJ 3RK2C 5APWA 3CCVP 2QA4P 2Z5IA 5CCGC 1WT6A 1K05A 3A3YB 1FU1A 1L0NE 3F5HA 5KKZB 1Q7YQ 2QG4A 3S1KA 3KHUA 3VTPC 1SQXJ 1PGPA 3IFMA 2M0BA 3O8ZA 1BGYE 1GL2B 1R8EA 3P8CE 3L74J 1Y8AA 1OVVA 1LT9A 3B71A 2OYHA 3RK3B 1BGYJ 4U3FD 1YQ4C 2QJPB 5CCGA 2H7HA 4ZKUA 2E75B 5DJTB 5M1BA 3RGUA 3CCMP 5KAIH 1S72P 2SPZA 3H32B 1HBWA 1MV8A 2BCCJ 1JEKA 1LNQA 2D2CB 1CSBA 3L73D 4PV1D 2KXPB 4U3FJ 1ZMEC 1KQFB 2W6JH 1VF5C 3V4WA 1NGMB 5APYA 2XU6A 2FYUE 3MD0A 4DOJA 1N2DC 2K9YA 1MKMA 1KQGB 1SQPG 1SQVE 2H8PD 2W6AA 3FGAD 3IR9A 1NTMJ 4R4LA 2E5YA 5CHXA 3VMZA 3G4SP 3CPWO 4OGQD 1QVFO 3CCRP 4GT1A 1KV4A 2FKWB 1YHQP 4PJ0E 1SQVD 1HGVA 1IK9A 1VQPP 1SQXG 4I7ZB 3L71E 1GW3A 1FZFA 1PP9E 1CI6B 2L91A 4TLFA 1N73C 1YBKA 5KAFH 3RL0g 2E76D 2IZ1A 2PGDA 3RBZA 1PPJG 2FYNB 5GTIE 1S1CX 2KZIA 1P84I 2Q3IA 3L72J 4LGDE 1Q86Q 1BDCA 3K5BA 3W67A 1VPCA 2NPSA 1YTZT 3HUSA 2YKOA 2FYZA 2C9NY 1NKZB 4GODA 2G3AA 1JM0A 3AEFC 3L72D 1R5LA 1OW7A 1N73A 2KP8A 3A0BH 1KD1Q 3CWBG 1GDTA 3IF4A 1NAYA 3I56P 1VF5D
chains in the Genus database with same CATH topology
5APXA 3HD7C 1JY2P 4W80A 1SP4A 2J59M 2C0XA 1G1IA 1ZN5A 1LTBC 3HE4A 3VP9A 1N7SA 2CPBA 1W2EA 3V2PA 1HGZA 3L4FA 3RK2D 4EOTA 3P7KA 3R2PA 1IO4A 3HD7A 2OYHC 3N7NA 1IFDA 3MUDA 1M7LA 1A02J 1JUNA 1FJKA 2I1KA 1G1JA 3I5CA 5AW3B 1RF1A 1LTJA 1Z56A 1URQA 1JMMA 5AVWB 1SFCC 4N78D 2M3BA 2YO2A 4WY4C 1NOHA 1QL1A 4N78E 2Q7CA 2ZFCA 2P67A 1RF1B 1NKNA 2N1TA 1GL2D 3MTUE 1DX7A 1SQXK 1L4AB 2L5GB 2QM7A 2WITA 3KPEA 1CZQA 3L36A 3RK3D 1KILC 5AW5B 1JO5A 5BVZA 5KJ7D 2E42A 1IC2A 2HFED 4WB4A 2OYHB 1JY3P 1ZLLA 2KSJA 1T2KC 3TK1A 3HE5B 2I1JA 4AUWA 1RF0A 1MZ9A 1SQVK 3HTKA 5APUA 4AQRD 3M9HA 2N1TB 3L37A 1AFOA 4AYCA 1AQ5A 1KQLA 1L4AA 5AVRB 1J1DC 5AVVB 5CCGD 3T97A 1FZCA 2WSCH 4M3LA 1FZCC 1CI6A 2WZ7A 3BVHA 4WY4B 1FJPA 2YNYA 3NTNA 1NH4A 2JEEA 2CPSA 1J1EC 1NWQA 2NPSC 1N7SC 3M0DC 1JY2O 2OARA 3B5NB 1T2KD 1KFMA 3TSIA 3V2RA 1SQQK 1N73B 5AVZB 3GHGA 1G2CB 1LWUC 1NAFA 5CJ0A 1X8YA 1GK4A 4WBAA 3VOPA 3KYQA 1L0LK 1LTSC 2XNXA 3V4QA 3NFQA 3TNUA 5AVQB 1GD2E 3M9BA 1RE4A 2XZRA 4XE5B 5KLVK 5CMZA 3BRVB 2R5BA 1JY2N 5AVUB 3VMXA 4RESB 2O1JA 2BASA 3PP5A 1SFCD 2J58A 3U1AA 3M91A 3VN0A 1LT9C 5KTBA 2GUSA 1LTIC 3A2AA 1J1DB 3P8CD 4N3YB 4XA4A 4C7RA 4C7NA 2NPSD 2R32A 1VDFA 4C46A 5AW4B 5AW6B 1DH3A 2N9BA 3HE4B 3KDPB 5AW8B 3VMYA 5AVYB 3M9QA 3H6PA 3EQ2A 2KB7P 3BATA 2WWWA 3SWYA 1E5WA 4IFDK 1LWUB 1IFNA 3LW5H 2JJLA 2XV5A 4JYBA 3LIEA 3P8MC 1OWAA 1LTJB 1RY3A 2H43A 1IFJA 1RF0C 5AVTB 3SWFA 2C9LY 1RF1C 5AVSB 3UIAA 1GL2A 1T3JA 1URQB 1H88A 1GZLA 1LT9B 1CW5A 1FAVA 3CL3D 3U59A 2HPCB 3B8EB 1GL2C 1LWUA 3HUSC 5CJ4A 1FZEA 1XTGB 3MIWA 3CLQA 1SQPK 2R5DA 2Z5HA 1SQBK 3V2QA 1QL2A 5AW2B 1HH0A 3B5ND 5APQA 1RE3A 5CCHA 2OYIB 2C0WA 4W7YA 1N7LA 1GW4A 1MUUA 2IPPA 1URQD 3NXSA 4IFFA 2POHA 1KZUB 4OH8B 2WSFH 1H8AA 2W27A 4GKGA 1FZAA 3OJAB 4HYTB 1T8ZA 4I1LA 1J2JB 1FZGA 3HTKB 2Q5UA 1LTJC 2WSEH 1FOSF 3E1IA 2MJZA 2NPSB 3B5NC 2Q9IA 1NTZK 2OYIA 2W6BA 2FYUK 1LTAC 3TNUB 5APVA 1NTKK 1FBMA 1FZBA 1IFMA 1ZV8A 1URQC 4Y99B 1L4AD 4DZOA 3P32A 4O9BA 3TYYA 2VRSA 1FDMA 1NO4A 5AW0B 1T3UA 1G2CA 3GHGB 3RL0B 2KOGA 1A02F 1M1JB 2A45G 2WT7A 2OYIC 5BU8B 2IX7C 3L35A 4N6JA 1KILA 1NTMK 1ZR2A 1ZR4A 1NU1K 2PAJA 2IFMA 1FOSE 3C9IA 3OA7A 1SFCB 1X9VA 2HLOA 2E43A 1LTGC 2KYVA 3LIDA 3VP8A 2WTYA 2HODB 2WT7B 5AW1B 1JTHB 3RK2B 2XKMA 1LTTC 1KFNA 3BASA 4ZKPA 2P1JA 2FFDB 4EIJA 2A45I 3CI9A 2GUVA 1PFIA 4Y99C 5APTA 2GM4A 1SFCA 2HPCA 3KQGA 2O01H 1SLQA 3V2NA 3WMM0 3GHGC 1M1JC 1N7SD 4JYCA 3RL0D 1IFIA 2HODA 3V5BA 2P2UA 3M0DA 1RE3C 1HVVA 2N1TC 1DEBA 2O1KA 2WPQA 5CCHC 3HUSB 2KLVA 3OAKA 4I6MC 4HH2A 1SVFA 4WY4A 4I2LC 3VYIA 1HWTC 1FZCB 3G3ZA 1WRGA 5AVXB 3B5NA 1N7SB 1GK6A 1L0NK 1LGHB 1J1EB 2IFNA 2WPRA 2HYNA 4LC1A 2WPSA 2Z4EA 4B86A 1NHLA 1MFZA 2P7JA 3HD7B 2YO3A 1GU4A 5AW9B 1H89A 2FFDC 3U1CA 2QM8A 1JY3O 4JF7A 2XDJA 1GTWA 2YMYA 1OXZA 3HD7D 3M0AA 5APSA 3MGNA 1HTLC 1XTCC 4IFMA 2ZXEB 3EFGA 3RK3C 3A5TA 2N1TD 1JY3N 1M1JA 2M8RA 3HRNA 1IJDB 3BRTB 2HG5D 4KHXA 5BU5A 3RL0C 1EQ7A 1S9KD 4GIFA 1GU5A 1HUCA 4WY4D 4C7NB 5KJ7C 1S9KE 5AW7B 2YKQA 1KILD 1YTZI 1RE4C 2LKMA 1JCCA 2YKPA 3M06A 1N86A 3II6A 1YYCA 3NMDA 1HJBA 1JOCA 3HE5A 1JTHA 2R3CA 5CCHD 1L4AC 4W7ZA 2FXMA 2FFDA 3H32A 2A45H 3A7OA 3N4XA 1KILB 2PP6A 1JNMA 4LLHA 1X79B 5KJ7A 1JCDA 3RK2C 5APWA 2Z5IA 5CCGC 1WT6A 3A3YB 1FU1A 3VTPC 3IFMA 3O8ZA 1GL2B 3P8CE 1LT9A 2OYHA 3RK3B 2H7HA 5CCGA 4ZKUA 3H32B 1HBWA 1MV8A 1CSBA 3V4WA 5APYA 2XU6A 3MD0A 4DOJA 1N2DC 2H8PD 3IR9A 3VMZA 2W6AA 5CHXA 4GT1A 2FKWB 1HGVA 1IK9A 1GW3A 1FZFA 1CI6B 1N73C 2Q3IA 4LGDE 1VPCA 2NPSA 1YTZT 3HUSA 2YKOA 2FYZA 2C9NY 1NKZB 1N73A 2KP8A 1GDTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5APX A;  3TNU B;  3V4Q A;  5APV A;  1GTW A;  1SP4 A;  1OXZ A;  3NFQ A;  3TNU A;  5AVQ B;  3M0A A;  3HE4 A;  1GD2 E;  3M9B A;  4XE5 B;  2XZR A;  4DZO A;  3P32 A;  3TYY A;  2VRS A;  5CMZ A;  2R5B A;  5AVU B;  5APS A;  3VMX A;  4RES B;  2BAS A;  3MGN A;  5AW0 B;  4EOT A;  2ZXE B;  3M91 A;  3P7K A;  3VN0 A;  3A5T A;  1IO4 A;  3A2A A;  1A02 F;  1A02 J;  2WT7 A;  4KHX A;  1JUN A;  3L35 A;  4C7N A;  2R32 A;  3I5C A;  5AW3 B;  5AW4 B;  5AW6 B;  4C46 A;  2N9B A;  1S9K D;  1GU5 A;  1HUC A;  3HE4 B;  3KDP B;  4C7N B;  1DH3 A;  5AW8 B;  3VMY A;  1S9K E;  5AW7 B;  5AVY B;  1FOS E;  5AVW B;  2E43 A;  3M06 A;  1YYC A;  2WWW A;  2YO2 A;  3NMD A;  1HJB A;  3HE5 A;  2R3C A;  3LID A;  2JJL A;  2WTY A;  2XV5 A;  4JYB A;  2Q7C A;  2WT7 B;  5AW1 B;  2ZFC A;  3LIE A;  3P8M C;  1OWA A;  2P67 A;  3A7O A;  1JNM A;  5AVT B;  3SWF A;  2QM7 A;  2C9L Y;  1CZQ A;  3L36 A;  5APW A;  2Z5I A;  5AVS B;  3A3Y B;  5AW5 B;  5APT A;  3UIA A;  2E42 A;  3VTP C;  1H88 A;  1GZL A;  3O8Z A;  3KQG A;  1FAV A;  1SLQ A;  1T2K C;  3TK1 A;  3B8E B;  3HE5 B;  4JYC A;  2H7H A;  3V5B A;  4AUW A;  2R5D A;  2P2U A;  2Z5H A;  1HBW A;  1MV8 A;  3M0D A;  5AW2 B;  2WPQ A;  3HTK A;  1CSB A;  5APU A;  4AQR D;  3M9H A;  3V4W A;  3L37 A;  5APY A;  5APQ A;  2XU6 A;  4AYC A;  3MD0 A;  1KQL A;  5AVR B;  3OAK A;  3IR9 A;  4I6M C;  3VMZ A;  2W6A A;  5AVV B;  3T97 A;  1MUU A;  4M3L A;  4GT1 A;  2IPP A;  4I2L C;  3NXS A;  3VYI A;  1HWT C;  1CI6 A;  2YNY A;  3NTN A;  1CI6 B;  5AVX B;  1H8A A;  2W27 A;  4GKG A;  1NWQ A;  1GK6 A;  4HYT B;  2WPR A;  1T2K D;  2Q3I A;  4LC1 A;  2C9N Y;  1J2J B;  1FOS F;  2Q5U A;  2WPS A;  4B86 A;  5AVZ B;  2P7J A;  1MFZ A;  1G2C B;  1NAF A;  1X8Y A;  2YO3 A;  1GU4 A;  5AW9 B;  1GK4 A;  2KP8 A;  1H89 A;  2QM8 A; 
#chains in the Genus database with same CATH topology
 5APX A;  4JPZ B;  3HD7 C;  3IAO A;  3A0B E;  3S4R A;  1JY2 P;  4OVN F;  4W80 A;  1SP4 A;  5KKZ C;  3L70 E;  2J59 M;  2C0X A;  2ZT9 D;  1VQM P;  1G1I A;  1ZN5 A;  1EDK A;  1LTB C;  1R5S A;  3HE4 A;  3VP9 A;  1VQ9 P;  3KXD A;  1N7S A;  2CPB A;  3D70 A;  1W2E A;  3V2P A;  2DW3 A;  2ZVO B;  2NZ2 A;  3AE7 C;  3KZI H;  4H13 B;  1HGZ A;  2QJP C;  4EYY Q;  1QEX A;  2B87 A;  3AE8 C;  1NYH A;  1SQQ D;  3L4F A;  4L76 A;  1K73 Q;  3RK2 D;  1DEE G;  3P7K A;  3R2P A;  4EOT A;  1IO4 A;  3HD7 A;  2QE7 H;  4PV1 C;  3CME P;  2OYH C;  3N7N A;  1IFD A;  3H25 A;  3MUD A;  4JQ0 D;  1M7L A;  4IFD K;  1A02 J;  3TGU G;  2B89 A;  2W83 C;  1JUN A;  2Y0D A;  3PLN A;  1FJK A;  1SQQ G;  2I1K A;  1G1J A;  3L70 G;  4YTP C;  1H0T B;  1KIL E;  2W8Z A;  3CCL P;  3I5C A;  1FS0 E;  5AW3 B;  3Q3D A;  1LTJ A;  1KQS O;  2K9J B;  1Z56 A;  1RF1 A;  1BSH A;  3AE5 C;  3KZI E;  1X0T A;  4GOF A;  2IBZ D;  4WVZ A;  1UII A;  1KB9 I;  2A06 G;  3ABV C;  2FYN C;  1P84 E;  2ZYD A;  3Q1M A;  4BXL A;  1VQ4 P;  2P10 A;  4YXW H;  3WUT A;  1ZOY C;  1YJW P;  1URQ A;  1W5C E;  3L75 E;  1JMM A;  2OGU A;  5AVW B;  4ASV A;  1SFC C;  4N78 D;  2A06 D;  1PPJ E;  2M3B A;  2MKV A;  2YO2 A;  4WY4 C;  2Y0E A;  3CMA P;  3FXD A;  3L72 G;  3PRJ A;  1NOH A;  1SQQ E;  1QL1 A;  2JDI H;  2A06 E;  3GG2 A;  4N78 E;  1X22 A;  4UB8 H;  2Q7C A;  4KJM A;  2ZFC A;  1PZQ A;  2KNC B;  4UB8 E;  2P67 A;  1RF1 B;  4RJT A;  1S5L E;  1NKN A;  2N1T A;  2QJY C;  1GL2 D;  3MTU E;  3AEE C;  1DX7 A;  1SQX K;  1L4A B;  2L5G B;  2Q6Q A;  2QM7 A;  1Y9B A;  2WIT A;  3H1H E;  1CZQ A;  3KPE A;  3L36 A;  3V6I A;  2KLU A;  1KIL C;  2FYU G;  3RK3 D;  5AW5 B;  2BCC E;  5H2F E;  1JO5 A;  5BVZ A;  1JMB A;  5KJ7 D;  3CX5 H;  2E42 A;  1IC2 A;  2HFE D;  4PD4 H;  4PJ0 H;  4WB4 A;  3Q5S A;  2D2C D;  4PV1 B;  2OYH B;  1AVY A;  1JY3 P;  1ZLL A;  1RQV A;  1SQV J;  2KSJ A;  3CXH H;  3L72 E;  3MP7 B;  2AXT H;  3TK1 A;  2O01 N;  1T2K C;  3HE5 B;  2Y9Z A;  3H1J J;  3D6Y A;  2I1J A;  2JP3 A;  1OVU A;  1SQB G;  1NTM D;  1RF0 A;  4H44 D;  2YIU B;  4AUW A;  2FXO A;  3IN6 A;  3TGU D;  1MZ9 A;  1SQV K;  1VQK P;  2E74 C;  3H1J D;  2Y9Y A;  3HTK A;  4GDO A;  5APU A;  4AQR D;  4D6T J;  3PHL A;  3M9H A;  2IDB A;  2N1T B;  3L37 A;  1AFO A;  4AYC A;  1AQ5 A;  2E75 C;  1KQL A;  1L4A A;  5AVR B;  2V7Q H;  1EDL A;  3AE6 C;  2RN0 A;  1VQ7 P;  1J1D C;  4K3A A;  2ZJS E;  5AVV B;  3T97 A;  5CCG D;  2QVA A;  2WSC H;  1FZC A;  3G9R A;  4L75 A;  4M3L A;  1FZC C;  1NU1 J;  1Y47 A;  1NTZ D;  2I8D A;  1CI6 A;  2WZ7 A;  3BVH A;  4OWF A;  2OTK E;  2KIK A;  1JB0 J;  4PD4 I;  4WY4 B;  1FJP A;  2YNY A;  1LP1 B;  3NTN A;  1NH4 A;  2JR8 A;  2JEE A;  2CPS A;  1J1E C;  4KT0 J;  1KYO I;  3AEB C;  5KLI B;  1NWQ A;  1YI2 P;  2NPS C;  1N7S C;  1JY2 O;  3B5N B;  2OAR A;  3M0D C;  4GOE A;  1T2K D;  1KFM A;  2LR2 A;  3TSI A;  3V2R A;  1SQQ K;  1N73 B;  1BSN A;  5AVZ B;  1G2C B;  3GHG A;  1YJN P;  1LWU C;  1NAF A;  5CJ0 A;  1X8Y A;  1VQL P;  1GK4 A;  3H1I G;  4WBA A;  3VOP A;  5K5G B;  1N8R Q;  3KYQ A;  3CC4 P;  1SQQ J;  1L0L K;  1OIP A;  3AE9 C;  4BRY B;  4PD4 D;  1LTS C;  2XNX A;  3V4Q A;  1USD A;  2O3J A;  3NFQ A;  3TNU A;  3CC7 P;  1QLE D;  5AVQ B;  2FYU J;  1M90 Q;  1GD2 E;  3CWB D;  1EDI A;  1RE4 A;  2XZR A;  3M9B A;  3PTZ A;  4MN4 C;  4XE5 B;  1Q81 Q;  5KLV K;  5CMZ A;  3BRV B;  2R5B A;  1DD3 A;  1JY2 N;  1KYO H;  4IL6 H;  5AVU B;  4RES B;  2WPV B;  3QH9 A;  3VMX A;  2O1J A;  3C1L A;  1KB9 H;  2BAS A;  2QIW A;  3PP5 A;  4EDF A;  5B66 E;  1GMJ A;  1SFC D;  2J58 A;  2K3R A;  2RH0 A;  3U1A A;  1AVO A;  4A7P A;  1EZV E;  3L73 G;  2KS1 A;  3M91 A;  3CCU P;  1USE A;  2WVR A;  3VN0 A;  1LT9 C;  5KTB A;  4U3F E;  3B4S A;  2GUS A;  1LTI C;  2AEM A;  3A2A A;  3CCQ P;  2H89 C;  1BDD A;  1VL2 A;  4H44 C;  1J1D B;  3P8C D;  1SQX E;  2YXQ B;  2WMM A;  4N3Y B;  4XA4 A;  1KC8 Q;  2V7Q J;  3E1R A;  3H1H J;  3L75 J;  2Q3E A;  1M8O B;  3WUU A;  4C7R A;  2K9J A;  4C7N A;  1FC2 C;  2NPS D;  2R32 A;  1IK7 A;  1VDF A;  1PP9 G;  4C46 A;  5AW4 B;  5AW6 B;  1NTZ G;  2N9B A;  3FXE A;  4D6T E;  3HE4 B;  3KDP B;  1DH3 A;  1U57 A;  4OGQ C;  3SWK A;  1KYO E;  5AW8 B;  5KLI C;  3VMY A;  4UB6 H;  3L71 J;  1YIJ P;  5AVY B;  5KAI E;  3JCU E;  3M9Q A;  1M1K Q;  3H6P A;  2Y0C A;  3GLM A;  3EQ2 A;  2WSF J;  2KB7 P;  2KS1 B;  2E76 C;  3BAT A;  5L8R J;  2M5A A;  4HKZ H;  3AED C;  3CX5 I;  2WWW A;  3SWY A;  1Q90 D;  1Q2N A;  1E5W A;  2R44 A;  2PFX A;  1LWU B;  1IFN A;  3LW5 H;  2JJL A;  4DT0 A;  2XV5 A;  1FDI A;  4JYB A;  2WSE J;  2E74 D;  1AQT A;  1H0T A;  3LIE A;  3P8M C;  4D6T G;  1OWA A;  1LTJ B;  1RY3 A;  1S2E A;  1LJ2 A;  2O01 J;  2H43 A;  1OX3 A;  1VQ6 P;  3TDK A;  1BCC D;  1IFJ A;  1RF0 C;  5AVT B;  3SWF A;  5B5E H;  2IBZ E;  2Q9I A;  2C9L Y;  1DIP A;  2JKV A;  4D6T D;  4K35 A;  1RF1 C;  3JC2 2;  5AVS B;  4RO0 A;  2J5U A;  3UIA A;  1GL2 A;  2IYP A;  1T3J A;  1QGK B;  1URQ B;  1H88 A;  1GZL A;  1LT9 B;  1ZXG A;  3H1L D;  1CW5 A;  5CBN A;  1FAV A;  3CL3 D;  3U59 A;  2HPC B;  3B8E B;  1GL2 C;  1EZV I;  3H1K E;  3L74 G;  5KAF E;  3EFF K;  1LWU A;  3HUS C;  5CJ4 A;  1FZE A;  1SQB J;  1XTG B;  3MIW A;  3CLQ A;  1SQP K;  2R5D A;  2Z5H A;  1SQB K;  3V2Q A;  1NJI Q;  1PGQ A;  1QL2 A;  1VF5 B;  2JO1 A;  1HH0 A;  5AW2 B;  3MZW B;  2D2C C;  1PP9 D;  3B5N D;  1KOR A;  1RE3 A;  5APQ A;  3L71 D;  2KSE A;  5CCH A;  2YIU C;  2OYI B;  2C0W A;  4W7Y A;  4XFJ A;  1NTM G;  2YXR B;  3Q5R A;  1NTZ E;  1W2B O;  2E74 B;  3H1I E;  4H0L B;  1L0L D;  1FE6 A;  1N7L A;  1GW4 A;  1MUU A;  3USS A;  4ZMD A;  5KLV G;  2K88 A;  2IPP A;  1URQ D;  3NXS A;  1VQN P;  1NTK G;  2KK7 A;  1BE3 G;  4IL6 X;  4IFF A;  1PL5 A;  2POH A;  1BCC J;  1KZU B;  4OH8 B;  1IFP A;  3A0H E;  2WSF H;  3L74 E;  1RH5 B;  2W27 A;  1DD4 A;  1QVG O;  1H8A A;  4GKG A;  2W90 A;  1FZA A;  4NPD A;  3OJA B;  4HYT B;  2OTL P;  2JWA A;  4IL6 E;  1T8Z A;  3AEA C;  4I1L A;  1J2J B;  1FZG A;  3HTK B;  2Q5U A;  1LTJ C;  2WSE H;  2CK3 H;  3E1I A;  2MJZ A;  3E7K A;  1EC5 A;  5H2F H;  3WUV A;  4HB1 A;  3ZDM A;  3CXH D;  2NPS B;  3B5N C;  1EZV G;  2PRR A;  4IOI H;  1NTZ K;  3H1L E;  5DJU B;  5B5E E;  3TF5 A;  2OYI A;  2KUB A;  4TT3 H;  3JSV C;  2W6B A;  2FYU K;  3T97 B;  1LTA C;  1LT1 A;  3AEG C;  1S5L H;  1L0N D;  5E79 E;  5KLV J;  3TNU B;  1HJ0 A;  3RK3 E;  1PIX A;  1NTK K;  5APV A;  1FBM A;  1FZB A;  2QEX P;  2RMZ A;  3A0H H;  3H1I D;  1NTK J;  1IFM A;  1ZV8 A;  1IZN B;  1OVR A;  1URQ C;  4Y99 B;  4ASW A;  1L4A D;  4DZO A;  3P32 A;  4O9B A;  3TYY A;  4L73 A;  1FOS F;  2VRS A;  2WSS H;  3WU2 E;  1K9M Q;  1NU1 E;  1FDM A;  1OZH A;  1YIT P;  3TGU E;  2WQY C;  1NO4 A;  1NTM E;  5AW0 B;  1T3U A;  1G2C A;  3GHG B;  3H1J G;  2FXP A;  5GTH H;  3RL0 B;  3G6E P;  1AJY A;  2KOG A;  2BCC G;  1A02 F;  1KTM A;  2RKL A;  2IZ0 A;  1M1J B;  2A45 G;  3H1H G;  1VQ8 P;  2N9Y B;  2WT7 A;  4BRY A;  2OYI C;  5BU8 B;  2IX7 C;  3L35 A;  4N6J A;  1KIL A;  3Q2Y A;  2AEF A;  3MHV A;  1KYO D;  1EDJ A;  1KB9 E;  3FX0 A;  5B66 H;  1E79 H;  1KB9 D;  1NTM K;  2H88 C;  3WU2 H;  1ZR2 A;  2B9B A;  1ZR4 A;  1NU1 K;  2PAJ A;  1PGJ A;  1ZW0 A;  2IFM A;  1FOS E;  3C9I A;  3H1K J;  3OA7 A;  3BCC G;  2AEJ A;  2KZJ A;  5CBO A;  2XND H;  1SFC B;  1SQB E;  1SQX D;  1X9V A;  2NRG A;  3C8V A;  1M57 D;  2HLO A;  3AE3 C;  2E43 A;  3MUD C;  1LTG C;  3SFE C;  2KYV A;  1OW6 A;  1EZV D;  1AA0 A;  3GF7 A;  3LID A;  3VP8 A;  2WTY A;  2HOD B;  2WT7 B;  1NU1 D;  1JTH B;  5AW1 B;  3RK2 B;  2E5T A;  1HF9 A;  1EXJ A;  2XKM A;  3GW6 A;  1LTT C;  1KFN A;  1L0L J;  3H1I J;  2QJY B;  3BAS A;  4NPE A;  3F89 A;  4YPC A;  2P1J A;  4ZKP A;  2FFD B;  2BEZ F;  1UIX A;  2A45 I;  4EIJ A;  3CI9 A;  2GUV A;  1K8A Q;  4DJG A;  1PP9 J;  1PFI A;  1NU1 G;  4Y99 C;  3LW5 J;  3AEC C;  5APT A;  2GM4 A;  1SFC A;  1BE3 J;  2G8Y A;  5KLV E;  2HPC A;  1BCC G;  3AE1 C;  2ZVN B;  2ZYA A;  3KQG A;  5TJH A;  2O01 H;  1SLQ A;  3V2N A;  3WMM 0;  2R3S A;  3GHG C;  1M1J C;  1N7S D;  4JYC A;  3RL0 D;  1IFI A;  2BEQ D;  2M3E A;  2HOD A;  3V5B A;  2K37 A;  2QJK C;  4H13 D;  3CD6 P;  1ZRT D;  2P2U A;  1Q82 Q;  3SFD C;  2ZYG A;  3M0D A;  1RE3 C;  1HVV A;  2GA1 A;  1DEB A;  2N1T C;  2O1K A;  2WPQ A;  4JBZ A;  2KI7 B;  5CCH C;  3HUS B;  1S5L X;  3L74 D;  4RKU J;  2ZT9 B;  2KLV A;  4Z1M H;  3L75 G;  3OAK A;  3PH0 A;  4I6M C;  4R4M A;  5TIS E;  3BCC E;  4ZNC A;  4HH2 A;  4EI2 A;  3L70 D;  1SVF A;  1RHZ B;  1U7J A;  3R4Y A;  4WY4 A;  3D6Z A;  4I2L C;  3BCC D;  2AXC A;  4PD4 E;  1LP1 A;  2LXB A;  2V4H A;  3VYI A;  1FZC B;  1K04 A;  3L71 G;  1HWT C;  3H1L J;  2IBZ G;  3G3Z A;  3GMA A;  5GTH E;  4H0L C;  1WRG A;  1ZP0 C;  4H0L D;  1YJ9 P;  5AVX B;  3B5N A;  1L0N J;  3QWO C;  1L2P A;  1N7S B;  2QSI A;  3OW2 O;  3CXH E;  3H1J E;  1GK6 A;  1L0N K;  1LGH B;  1J1E B;  1PV3 A;  2IFN A;  3O6Q B;  2YMK A;  2WPR A;  1ZRT E;  1NTK D;  1RQU A;  1S4X A;  2HYN A;  3AE4 C;  2UWJ E;  4LC1 A;  1NTK E;  2B87 B;  2FBW C;  2WPS A;  2Z4E A;  4B86 A;  1NHL A;  1MFZ A;  1OFC X;  1TU3 F;  2P7J A;  4U7J A;  3HD7 B;  2YO3 A;  1GU4 A;  1MFT A;  5AW9 B;  3Q5P A;  1OMI A;  1H89 A;  2FFD C;  2OTJ P;  2HR3 A;  3FWN A;  3U1C A;  4QMA A;  1PGO A;  2QM8 A;  1JY3 O;  3D71 A;  4JF7 A;  3ITK A;  2LXC B;  2P58 A;  1M56 D;  1WMK A;  2QRX A;  2XDJ A;  1GTW A;  2YMY A;  1L0L E;  1OXZ A;  3HD7 D;  1KMI Z;  2ITA A;  3M0A A;  4H13 C;  3G71 P;  1P84 H;  3H1L G;  4L74 A;  3JCU H;  2FYU D;  4DCK A;  1L0N G;  2FY8 A;  5APS A;  3H1K G;  4NPF X;  4HJG H;  3O6Q A;  3L73 E;  3W68 A;  1FDO A;  1BGY G;  2WSC J;  2E75 D;  1HTL C;  1XTC C;  2QJK B;  3MGN A;  4IFM A;  5TIS H;  1D7M A;  3CCJ P;  2ZXE B;  3EFG A;  2IYO A;  3L73 J;  3RK3 C;  2N1T D;  1JY3 N;  3A5T A;  1M1J A;  3CCS P;  2M8R A;  4U3F G;  3H1K D;  4UB6 E;  2ZAE B;  1SQB D;  2ZT9 C;  3HRN A;  3L75 D;  3PJS K;  1IJD B;  1BGY D;  4H44 B;  4Y28 J;  3BRT B;  2HG5 D;  4KHX A;  5BU5 A;  3RL0 C;  1L0L G;  3FWL A;  1SQP J;  5KLV D;  3S9O A;  2KNC A;  1EQ7 A;  1EXI A;  2BCC D;  1S9K D;  4GIF A;  1GU5 A;  1HUC A;  1BE3 D;  1SQP E;  4WY4 D;  4C7N B;  3CC2 P;  1BE3 E;  1SQP D;  5KJ7 C;  5C39 A;  3H1H D;  1S9K E;  4OGQ B;  1BCC E;  5AW7 B;  2YKQ A;  2ZXX A;  3CCE P;  1KIL D;  2JWD A;  3BCC J;  1YTZ I;  1U7M A;  2B88 A;  2K1A A;  3CXH I;  4I7Z C;  1QX8 A;  1SQV G;  1RE4 C;  2M5A B;  2OYO A;  2AXT E;  2LKM A;  1JCC A;  3GF3 A;  2YKP A;  3M06 A;  5E79 H;  1N86 A;  1KN7 A;  3II6 A;  1YYC A;  3NMD A;  3RBX A;  4YXD C;  2E76 B;  1SS1 A;  3CX5 D;  4CPG A;  1HJB A;  1JOC A;  3CX5 E;  3HE5 A;  1JTH A;  1PPJ D;  2R3C A;  1NVO A;  3SSU A;  4BWN A;  3VMA A;  5CCH D;  1OW8 A;  3AE2 C;  1L4A C;  2Q1K A;  4W7Z A;  2FXM A;  4WWI A;  3TGU J;  2FFD A;  3H32 A;  3CWB J;  3I55 P;  2A45 H;  3A7O A;  3L70 J;  1KIL B;  1AV1 A;  3N4X A;  1P84 D;  2PP6 A;  1JNM A;  1VQ5 P;  4LLH A;  1T6A A;  1X79 B;  2IBZ I;  2OQQ A;  3CWB E;  5EFW B;  5GTI H;  5KJ7 A;  1S3J A;  1VQO P;  1JCD A;  1YQ3 C;  3EWK A;  1NTZ J;  3RK2 C;  5APW A;  3CCV P;  2QA4 P;  2Z5I A;  5CCG C;  1WT6 A;  1K05 A;  3A3Y B;  1FU1 A;  1L0N E;  3F5H A;  5KKZ B;  1Q7Y Q;  2QG4 A;  3S1K A;  3KHU A;  3VTP C;  1SQX J;  1PGP A;  3IFM A;  2M0B A;  3O8Z A;  1BGY E;  1GL2 B;  1R8E A;  3P8C E;  3L74 J;  1Y8A A;  1OVV A;  1LT9 A;  3B71 A;  2OYH A;  3RK3 B;  1BGY J;  4U3F D;  1YQ4 C;  2QJP B;  5CCG A;  2H7H A;  4ZKU A;  2E75 B;  5DJT B;  5M1B A;  3RGU A;  3CCM P;  5KAI H;  1S72 P;  2SPZ A;  3H32 B;  1HBW A;  1MV8 A;  2BCC J;  1JEK A;  1LNQ A;  2D2C B;  1CSB A;  3L73 D;  4PV1 D;  2KXP B;  4U3F J;  1ZME C;  1KQF B;  2W6J H;  1VF5 C;  3V4W A;  1NGM B;  5APY A;  2XU6 A;  2FYU E;  3MD0 A;  4DOJ A;  1N2D C;  2K9Y A;  1MKM A;  1KQG B;  1SQP G;  1SQV E;  2H8P D;  2W6A A;  3FGA D;  3IR9 A;  1NTM J;  4R4L A;  2E5Y A;  5CHX A;  3VMZ A;  3G4S P;  3CPW O;  4OGQ D;  1QVF O;  3CCR P;  4GT1 A;  1KV4 A;  2FKW B;  1YHQ P;  4PJ0 E;  1SQV D;  1HGV A;  1IK9 A;  1VQP P;  1SQX G;  4I7Z B;  3L71 E;  1GW3 A;  1FZF A;  1PP9 E;  1CI6 B;  2L91 A;  4TLF A;  1N73 C;  1YBK A;  5KAF H;  3RL0 g;  2E76 D;  2IZ1 A;  2PGD A;  3RBZ A;  1PPJ G;  2FYN B;  5GTI E;  1S1C X;  2KZI A;  1P84 I;  2Q3I A;  3L72 J;  4LGD E;  1Q86 Q;  1BDC A;  3K5B A;  3W67 A;  1VPC A;  2NPS A;  1YTZ T;  3HUS A;  2YKO A;  2FYZ A;  2C9N Y;  1NKZ B;  4GOD A;  2G3A A;  1JM0 A;  3AEF C;  3L72 D;  1R5L A;  1OW7 A;  1N73 A;  2KP8 A;  3A0B H;  1KD1 Q;  3CWB G;  1GDT A;  3IF4 A;  1NAY A;  3I56 P;  1VF5 D; 
#chains in the Genus database with same CATH homology
 5APX A;  3HD7 C;  1JY2 P;  4W80 A;  1SP4 A;  2J59 M;  2C0X A;  1G1I A;  1ZN5 A;  1LTB C;  3HE4 A;  3VP9 A;  1N7S A;  2CPB A;  1W2E A;  3V2P A;  1HGZ A;  3L4F A;  3RK2 D;  4EOT A;  3P7K A;  3R2P A;  1IO4 A;  3HD7 A;  2OYH C;  3N7N A;  1IFD A;  3MUD A;  1M7L A;  1A02 J;  1JUN A;  1FJK A;  2I1K A;  1G1J A;  3I5C A;  5AW3 B;  1RF1 A;  1LTJ A;  1Z56 A;  1URQ A;  1JMM A;  5AVW B;  1SFC C;  4N78 D;  2M3B A;  2YO2 A;  4WY4 C;  1NOH A;  1QL1 A;  4N78 E;  2Q7C A;  2ZFC A;  2P67 A;  1RF1 B;  1NKN A;  2N1T A;  1GL2 D;  3MTU E;  1DX7 A;  1SQX K;  1L4A B;  2L5G B;  2QM7 A;  2WIT A;  3KPE A;  1CZQ A;  3L36 A;  3RK3 D;  1KIL C;  5AW5 B;  1JO5 A;  5BVZ A;  5KJ7 D;  2E42 A;  1IC2 A;  2HFE D;  4WB4 A;  2OYH B;  1JY3 P;  1ZLL A;  2KSJ A;  1T2K C;  3TK1 A;  3HE5 B;  2I1J A;  4AUW A;  1RF0 A;  1MZ9 A;  1SQV K;  3HTK A;  5APU A;  4AQR D;  3M9H A;  2N1T B;  3L37 A;  1AFO A;  4AYC A;  1AQ5 A;  1KQL A;  1L4A A;  5AVR B;  1J1D C;  5AVV B;  5CCG D;  3T97 A;  1FZC A;  2WSC H;  4M3L A;  1FZC C;  1CI6 A;  2WZ7 A;  3BVH A;  4WY4 B;  1FJP A;  2YNY A;  3NTN A;  1NH4 A;  2JEE A;  2CPS A;  1J1E C;  1NWQ A;  2NPS C;  1N7S C;  3M0D C;  1JY2 O;  2OAR A;  3B5N B;  1T2K D;  1KFM A;  3TSI A;  3V2R A;  1SQQ K;  1N73 B;  5AVZ B;  3GHG A;  1G2C B;  1LWU C;  1NAF A;  5CJ0 A;  1X8Y A;  1GK4 A;  4WBA A;  3VOP A;  3KYQ A;  1L0L K;  1LTS C;  2XNX A;  3V4Q A;  3NFQ A;  3TNU A;  5AVQ B;  1GD2 E;  3M9B A;  1RE4 A;  2XZR A;  4XE5 B;  5KLV K;  5CMZ A;  3BRV B;  2R5B A;  1JY2 N;  5AVU B;  3VMX A;  4RES B;  2O1J A;  2BAS A;  3PP5 A;  1SFC D;  2J58 A;  3U1A A;  3M91 A;  3VN0 A;  1LT9 C;  5KTB A;  2GUS A;  1LTI C;  3A2A A;  1J1D B;  3P8C D;  4N3Y B;  4XA4 A;  4C7R A;  4C7N A;  2NPS D;  2R32 A;  1VDF A;  4C46 A;  5AW4 B;  5AW6 B;  1DH3 A;  2N9B A;  3HE4 B;  3KDP B;  5AW8 B;  3VMY A;  5AVY B;  3M9Q A;  3H6P A;  3EQ2 A;  2KB7 P;  3BAT A;  2WWW A;  3SWY A;  1E5W A;  4IFD K;  1LWU B;  1IFN A;  3LW5 H;  2JJL A;  2XV5 A;  4JYB A;  3LIE A;  3P8M C;  1OWA A;  1LTJ B;  1RY3 A;  2H43 A;  1IFJ A;  1RF0 C;  5AVT B;  3SWF A;  2C9L Y;  1RF1 C;  5AVS B;  3UIA A;  1GL2 A;  1T3J A;  1URQ B;  1H88 A;  1GZL A;  1LT9 B;  1CW5 A;  1FAV A;  3CL3 D;  3U59 A;  2HPC B;  3B8E B;  1GL2 C;  1LWU A;  3HUS C;  5CJ4 A;  1FZE A;  1XTG B;  3MIW A;  3CLQ A;  1SQP K;  2R5D A;  2Z5H A;  1SQB K;  3V2Q A;  1QL2 A;  5AW2 B;  1HH0 A;  3B5N D;  5APQ A;  1RE3 A;  5CCH A;  2OYI B;  2C0W A;  4W7Y A;  1N7L A;  1GW4 A;  1MUU A;  2IPP A;  1URQ D;  3NXS A;  4IFF A;  2POH A;  1KZU B;  4OH8 B;  2WSF H;  1H8A A;  2W27 A;  4GKG A;  1FZA A;  3OJA B;  4HYT B;  1T8Z A;  4I1L A;  1J2J B;  1FZG A;  3HTK B;  2Q5U A;  1LTJ C;  2WSE H;  1FOS F;  3E1I A;  2MJZ A;  2NPS B;  3B5N C;  2Q9I A;  1NTZ K;  2OYI A;  2W6B A;  2FYU K;  1LTA C;  3TNU B;  5APV A;  1NTK K;  1FBM A;  1FZB A;  1IFM A;  1ZV8 A;  1URQ C;  4Y99 B;  1L4A D;  4DZO A;  3P32 A;  4O9B A;  3TYY A;  2VRS A;  1FDM A;  1NO4 A;  5AW0 B;  1T3U A;  1G2C A;  3GHG B;  3RL0 B;  2KOG A;  1A02 F;  1M1J B;  2A45 G;  2WT7 A;  2OYI C;  5BU8 B;  2IX7 C;  3L35 A;  4N6J A;  1KIL A;  1NTM K;  1ZR2 A;  1ZR4 A;  1NU1 K;  2PAJ A;  2IFM A;  1FOS E;  3C9I A;  3OA7 A;  1SFC B;  1X9V A;  2HLO A;  2E43 A;  1LTG C;  2KYV A;  3LID A;  3VP8 A;  2WTY A;  2HOD B;  2WT7 B;  5AW1 B;  1JTH B;  3RK2 B;  2XKM A;  1LTT C;  1KFN A;  3BAS A;  4ZKP A;  2P1J A;  2FFD B;  4EIJ A;  2A45 I;  3CI9 A;  2GUV A;  1PFI A;  4Y99 C;  5APT A;  2GM4 A;  1SFC A;  2HPC A;  3KQG A;  2O01 H;  1SLQ A;  3V2N A;  3WMM 0;  3GHG C;  1M1J C;  1N7S D;  4JYC A;  3RL0 D;  1IFI A;  2HOD A;  3V5B A;  2P2U A;  3M0D A;  1RE3 C;  1HVV A;  2N1T C;  1DEB A;  2O1K A;  2WPQ A;  5CCH C;  3HUS B;  2KLV A;  3OAK A;  4I6M C;  4HH2 A;  1SVF A;  4WY4 A;  4I2L C;  3VYI A;  1HWT C;  1FZC B;  3G3Z A;  1WRG A;  5AVX B;  3B5N A;  1N7S B;  1GK6 A;  1L0N K;  1LGH B;  1J1E B;  2IFN A;  2WPR A;  2HYN A;  4LC1 A;  2WPS A;  2Z4E A;  4B86 A;  1NHL A;  1MFZ A;  2P7J A;  3HD7 B;  2YO3 A;  1GU4 A;  5AW9 B;  1H89 A;  2FFD C;  3U1C A;  2QM8 A;  1JY3 O;  4JF7 A;  2XDJ A;  1GTW A;  2YMY A;  1OXZ A;  3HD7 D;  3M0A A;  5APS A;  3MGN A;  1HTL C;  1XTC C;  4IFM A;  2ZXE B;  3EFG A;  3RK3 C;  3A5T A;  2N1T D;  1JY3 N;  1M1J A;  2M8R A;  3HRN A;  1IJD B;  3BRT B;  2HG5 D;  4KHX A;  5BU5 A;  3RL0 C;  1EQ7 A;  1S9K D;  4GIF A;  1GU5 A;  1HUC A;  4WY4 D;  4C7N B;  5KJ7 C;  1S9K E;  5AW7 B;  2YKQ A;  1KIL D;  1YTZ I;  1RE4 C;  2LKM A;  1JCC A;  2YKP A;  3M06 A;  1N86 A;  3II6 A;  1YYC A;  3NMD A;  1HJB A;  1JOC A;  3HE5 A;  1JTH A;  2R3C A;  5CCH D;  1L4A C;  4W7Z A;  2FXM A;  2FFD A;  3H32 A;  2A45 H;  3A7O A;  3N4X A;  1KIL B;  2PP6 A;  1JNM A;  4LLH A;  1X79 B;  5KJ7 A;  1JCD A;  3RK2 C;  5APW A;  2Z5I A;  5CCG C;  1WT6 A;  3A3Y B;  1FU1 A;  3VTP C;  3IFM A;  3O8Z A;  1GL2 B;  3P8C E;  1LT9 A;  2OYH A;  3RK3 B;  2H7H A;  5CCG A;  4ZKU A;  3H32 B;  1HBW A;  1MV8 A;  1CSB A;  3V4W A;  5APY A;  2XU6 A;  3MD0 A;  4DOJ A;  1N2D C;  2H8P D;  3IR9 A;  3VMZ A;  2W6A A;  5CHX A;  4GT1 A;  2FKW B;  1HGV A;  1IK9 A;  1GW3 A;  1FZF A;  1CI6 B;  1N73 C;  2Q3I A;  4LGD E;  1VPC A;  2NPS A;  1YTZ T;  3HUS A;  2YKO A;  2FYZ A;  2C9N Y;  1NKZ B;  1N73 A;  2KP8 A;  1GDT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...