1SP4A

Crystal structure of ns-134 in complex with bovine cathepsin b: a two headed epoxysuccinyl inhibitor extends along the whole active site cleft
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
48
structure length
48
Chain Sequence
LPESFDAREQWPNCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHSNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin B
publication title Crystal structure of NS-134 in complex with bovine cathepsin B: a two-headed epoxysuccinyl inhibitor extends along the entire active-site cleft.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 11
structure length 48
sequence length 48
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2004-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1sp4A01
2WPSA 4M3LA 3O8ZA 1FOSE 5AW6B 2W27A 2Q7CA 4AQRD 4C7NA 1NAFA 1GTWA 4I6MC 5AVXB 1T2KC 2W6AA 2XU6A 1J2JB 1CI6A 4JYBA 3A7OA 3SWFA 1MFZA 2ZXEB 2QM7A 2P2UA 5AW9B 1H88A 5AVUB 2P67A 1A02J 3NXSA 5APQA 1KQLA 3M9HA 5APSA 2WWWA 3VMYA 5APVA 1HUCA 1GK6A 5AW0B 2N9BA 3HE4A 5AVSB 1GU4A 5AW5B 4GT1A 3I5CA 1MUUA 2ZFCA 1MV8A 3MD0A 3M91A 3P32A 5AW8B 3HE5B 1JUNA 1A02F 1CZQA 4I2LC 1JNMA 4DZOA 2IPPA 2H7HA 1HWTC 2WPRA 5AW2B 3P7KA 3TK1A 1FOSF 5APUA 3M9BA 5AW1B 3M0AA 3LIDA 3NFQA 2KP8A 1SLQA 3HTKA 3VTPC 4B86A 2R3CA 3VMZA 3VN0A 2JJLA 1GK4A 2R5BA 1IO4A 3KQGA 1T2KD 3M0DA 2YO3A 3TYYA 4KHXA 1GZLA 3L35A 2E42A 4RESB 3M06A 2Q5UA 4C7NB 3LIEA 2QM8A 3B8EB 2R32A 5CMZA 5APTA 5AVVB 2VRSA 5AVZB 3L36A 2C9LY 3A3YB 1FAVA 3A5TA 1SP4A 5AW4B 2WPQA 4AYCA 1S9KE 3L37A 1OWAA 1H89A 1DH3A 5AVYB 2YO2A 3TNUB 3V5BA 3HE4B 2WT7B 1GU5A 5APYA 5APXA 2E43A 1YYCA 2XV5A 3VYIA 2Z5IA 1X8YA 4LC1A 3KDPB 3UIAA 3V4WA 3VMXA 3P8MC 1CSBA 4EOTA 5AVQB 3IR9A 5AVTB 5AW3B 2R5DA 3HE5A 1G2CB 3T97A 4C46A 4JYCA 1H8AA 1CI6B 4AUWA 1S9KD 1NWQA 2P7JA 3NTNA 2WTYA 1OXZA 4GKGA 4HYTB 3V4QA 5APWA 2YNYA 2C9NY 2BASA 2Z5HA 3MGNA 1GD2E 2Q3IA 3TNUA 2WT7A 3A2AA 3NMDA 1HBWA 1HJBA 3OAKA 5AVWB 5AW7B 5AVRB 4XE5B 2XZRA
chains in the Genus database with same CATH superfamily
1LTTC 2Q9IA 4GDOA 1ZLLA 2E5YA 1FOSE 1KILE 5E79H 5KTBA 2KZIA 3CX5I 3SWFA 4H44D 1MFZA 1FZCC 1ZXGA 3RK3D 3FX0A 1S3JA 2IZ0A 5CJ4A 2QIWA 1NTKD 1PP9J 4DZOA 1K04A 3TK1A 3M0DC 3H1LE 3RK2B 3CCQP 1OVRA 2YIUB 3GHGC 2WPVB 1FJPA 2Q5UA 2HFED 4C7NB 5E79E 2DW3A 3PH0A 2QM8A 1N7SD 3P8CE 3E1RA 1J1DB 1KILC 2O01J 4HKZH 4Y99B 2IX7C 3CX5H 3N4XA 2E43A 3VYIA 3E1IA 2Z5IA 1M8OB 3P8MC 1TU3F 4ZKUA 1FDMA 5KLVJ 1NU1G 3H1IG 2BCCD 2JKVA 4N78D 3L73G 1CI6B 1OXZA 5APWA 1ZW0A 3M9QA 2BASA 2Q3IA 4DOJA 1GD2E 1EXJA 1NYHA 2WPSA 1U7JA 3H1HJ 3EWKA 1AA0A 1GW4A 2IBZG 3CI9A 1ZR2A 2PAJA 1NU1D 2NPSB 1W5CE 3H1KG 1SQVK 4L74A 3SFDC 3VOPA 2I1KA 2IPPA 2QJKB 2R44A 2QJYC 4WY4A 2FFDC 1L0LJ 2IBZD 1HVVA 1KILA 2D2CB 3H1KD 1AJYA 5GTHH 1VF5B 2UWJE 2PGDA 2C9LY 2VRSA 1FAVA 4ZKPA 2KI7B 1IFJA 3H1LD 4XA4A 4PV1C 2YKOA 2CK3H 3L72J 3SSUA 1NTZK 1CSBA 2W6JH 3CXHH 2W6BA 3P8CD 1H8AA 1AFOA 1NWQA 5BVZA 2WT7A 3A2AA 4XE5B 1GL2D 3L75G 2WMMA 5GTHE 3WU2H 1ZRTD 1LT1A 1YHQP 1URQB 1N73A 3LW5J 1QL1A 1SQBG 1YITP 5AW0B 1PL5A 2KYVA 4PJ0H 3Q5RA 3CXHE 2QE7H 4PV1D 1DD3A 2H7HA 1FOSF 1WMKA 3G9RA 1LTBC 2O1JA 3M0AA 3CCSP 1SQQE 1ZOYC 2QEXP 3VN0A 3FWLA 3CX5D 3KQGA 1IFMA 4K3AA 1BE3G 5CHXA 1SQBD 1Q90D 4OGQB 3CCMP 1WRGA 3MTUE 3WU2E 1EZVG 3HUSC 3CC7P 1KZUB 1FU1A 1J1EC 2A06G 1JMMA 1DH3A 3RBZA 2J58A 3AE4C 3WUUA 2OYIA 1IFIA 4PJ0E 1NAYA 1FE6A 3Q3DA 4GODA 4H0LB 1NTMG 2YXQB 2L5GB 1VQNP 3BRTB 1M90Q 1U57A 1VQ4P 1M57D 1R5LA 3L71E 2A06D 2XZRA 3G71P 4M3LA 2B88A 1JY2N 3N7NA 5CCHD 4I6MC 4YPCA 3ZDMA 1T2KC 1YJ9P 3AE9C 4IFMA 3KHUA 2WWWA 1S5LX 4GIFA 1KYOI 1N86A 1SQPG 1Q81Q 2G3AA 3MD0A 4XFJA 5KLVG 1DEBA 2KNCA 3GG2A 3II6A 1JTHB 3PP5A 2C0XA 3L74E 3MUDA 1L0LK 4KHXA 3M06A 1SQXG 1JY3P 2K9JA 2R32A 4K35A 1SQPD 1HJ0A 2NZ2A 1L0NE 2HPCA 1KMIZ 4EDFA 3K5BA 1SQQD 3Q5PA 3TF5A 1LGHB 5APYA 1IFNA 1WT6A 3PJSK 1RHZB 4JQ0D 4BXLA 3BCCE 2HLOA 2N1TC 3UIAA 1OVVA 3R2PA 4EOTA 1FC2C 3Q1MA 4WY4B 4GKGA 1N8RQ 1OVUA 1YTZI 2B9BA 1HJBA 1KQFB 3H1JE 1VL2A 5B66H 3HD7B 1T8ZA 1NAFA 4GOFA 2MJZA 2E76B 5AVXB 2W6AA 3B5NC 5KJ7C 2IZ1A 4OVNF 2XKMA 1YIJP 3RK3E 3AECC 4ASVA 5EFWB 1A02F 2D2CD 1NTKE 1IJDB 1LT9A 3H1LJ 3D6YA 1FBMA 3H32B 2CPSA 1FZEA 1SQVJ 1DEEG 1SFCC 2JDIH 2YO3A 1LTJC 1LWUA 3TYYA 1S5LH 3TDKA 2PFXA 2N1TA 3CC2P 3CPWO 5B66E 2LKMA 1HF9A 1N73B 2FKWB 3MZWB 3QWOC 2YO2A 3TNUB 1RF0A 4RO0A 1YYCA 2M0BA 4LC1A 3O6QA 1H0TA 1RF1A 3QH9A 3SWYA 3TGUG 4H44C 1OX3A 4R4LA 3CCVP 4JBZA 1BDDA 2WSCH 2RKLA 4DCKA 3B5NA 3F89A 5TISH 5KJ7A 3CCJP 3CCEP 3BCCD 1S5LE 2V7QH 1GTWA 4NPEA 1SFCD 2FYNC 2E74B 2ZXEB 1NU1E 3H1IE 1DX7A 2P2UA 2KOGA 3L73E 5APSA 2OYIB 1HH0A 1N7SC 3RL0B 3I5CA 2RN0A 2ZFCA 4R4MA 5L8RJ 2WVRA 2E75C 3CMAP 2JEEA 4O9BA 5TISE 2IBZE 3CC4P 3U1AA 3C8VA 1RE4C 3ITKA 2W90A 1W2EA 1LTAC 3L35A 1PV3A 3KZIH 3H1KE 4LLHA 4D6TG 3WUTA 3B8EB 4NPDA 2PRRA 2JWDA 1JY3N 2O3JA 1YJWP 2ZYGA 2LXCB 1SS1A 2BEZF 4BWNA 3JCUE 5KKZB 1BSHA 3PHLA 4YTPC 1M1JC 3RBXA 2ZVOB 3AEGC 1PGQA 1E79H 2G8YA 2KNCB 1JY2O 2M3EA 3A0BH 1EZVI 4IFFA 1IFDA 5K5GB 1OW6A 3E7KA 1KORA 2RMZA 2E75D 1NJIQ 5AW7B 5AVWB 1N7SA 1L2PA 3CWBG 1KC8Q 3KZIE 1XTGB 4HB1A 3AEFC 3CCRP 1ZRTE 3L70E 2HPCB 4JYBA 4HJGH 5C39A 5AW9B 3JC22 1BGYE 1FJKA 3AEBC 2WSEH 1FZCA 1FZBA 3Q5SA 4N6JA 5AW8B 1Q86Q 1SQQJ 3C9IA 2V4HA 3L75E 2LR2A 3A0BE 1LTIC 3VTPC 3H1ID 1Y47A 2IYOA 3L73D 1L4AC 1JCDA 3CX5E 3M0DA 3PRJA 4I7ZB 2K1AA 1SQBE 3GHGA 1PPJG 2JO1A 3S4RA 1SP4A 1GL2C 3GF3A 2M5AA 3S1KA 1UIIA 2FYZA 3BRVB 2QRXA 3IN6A 4H13C 1KQSO 1LT9B 2R5DA 2XNDH 1BE3E 4JYCA 3L71J 2ZVNB 3MIWA 4OWFA 1KFMA 3HRNA 1NHLA 1EZVE 3OA7A 2YKPA 1LWUB 1NH4A 2A06E 4U3FG 3L70G 2HODA 2WSSH 1RE3C 1L4AD 1BGYG 2FYUJ 2AXTH 1PP9E 1NTME 3AE2C 1RQUA 1YI2P 2BEQD 2QJPC 2WSFJ 4IOIH 4L75A 1USEA 3O6QB 1H0TB 3AE5C 1RF1B 1QVFO 4I1LA 1VQ6P 3C1LA 2ZXXA 5CCGC 4N3YB 3U59A 3L74J 3L70D 3USSA 2MKVA 5AW1B 3B5NB 3V2QA 2QA4P 1USDA 2OYHC 1BCCG 2R3CA 1GL2A 4H13D 1BGYD 1NTZG 2OARA 2FFDA 1W2BO 1L0NJ 2GM4A 1SQPE 3L75D 2ZT9B 4AYCA 5KLVE 2AXTE 2KSJA 3BCCJ 1X0TA 5CCHC 5APXA 3VP8A 3G4SP 1BCCD 2B87A 4U7JA 3MHVA 3IF4A 1BSNA 1RE3A 1SQXE 2IDBA 2WTYA 3RK2C 1UIXA 3H1JJ 1Q7YQ 1VQ8P 2E74D 1JCCA 5CCGD 2YIUC 3AE6C 5KLIB 4C7RA 3CCLP 1NKZB 2Q7CA 1PP9G 1HGVA 1BE3D 1KFNA 2XU6A 3RK3B 3V6IA 1OMIA 1J1DC 1EXIA 4Y99C 1T3JA 1RY3A 1R5SA 2OYHA 1EZVD 2ZAEB 1M1KQ 1KQLA 3M9HA 1IFPA 4UB8H 1L0LE 1NTKJ 2J59M 2H43A 1SQQK 1PP9D 4B86A 1NTMD 3EFFK 3GF7A 5CCHA 1VQKP 4WWIA 2O01N 3RK2D 1EQ7A 4NPFX 1OW7A 5AVVB 3EFGA 2AEFA 3A3YB 2NPSC 1X22A 3HUSA 1YBKA 1H89A 1VQLP 2OQQA 4WVZA 5KAIH 3FXEA 1FZCB 1BDCA 2LXBA 4UB8E 2BCCJ 5AVQB 3H1HG 5AVTB 3CLQA 2QJKC 2Y0EA 1MFTA 4AUWA 3BATA 2FXOA 5KLVD 1EDLA 4EIJA 2D2CC 3SWKA 1IK7A 3O8ZA 3GHGB 1VF5C 1OZHA 4AQRD 1KYOH 1FDOA 1NU1J 3H1IJ 3V2RA 3TGUE 3L73J 1CI6A 1SQXD 5KAFH 2A45G 1L0LG 2FYUK 1KILB 3VMYA 1FZFA 1HUCA 5KAIE 5AW5B 4ASWA 2NPSD 2N9YB 4A7PA 2GUSA 2YMKA 3JSVC 5BU8B 2WSCJ 1JNMA 1VQ7P 1G2CA 5APUA 1QLED 2PP6A 2NPSA 1ZR4A 1Q2NA 5TJHA 3H1KJ 3L72G 3PLNA 1L0LD 2E42A 1QGKB 3WMM0 2HODB 2SPZA 1KYOE 1U7MA 1X9VA 4OH8B 1KQGB 1NVOA 1L0NK 1URQC 1VQMP 1S9KE 1ZV8A 3BASA 1RH5B 5KAFE 1VF5D 5AVYB 2WT7B 1ZN5A 1SVFA 3V2NA 2FXMA 3KDPB 4RJTA 3W68A 1S72P 2KZJA 2ZJSE 3L72D 2L91A 2Z4EA 2QVAA 4C46A 4D6TE 1GL2B 3KYQA 4HYTB 2QJYB 3D71A 2AEJA 2FFDB 3AEAC 2M8RA 3NMDA 1HBWA 4IFDK 4OGQC 1T6AA 1AV1A 3CMEP 3CCUP 1YQ4C 2JR8A 5AVUB 5APQA 1N2DC 2B87B 1GK6A 1URQD 5AVSB 4PV1B 4WBAA 2QG4A 2KSEA 2YMYA 3L75J 3G3ZA 1NTKK 4H0LC 1CZQA 2H88C 3CWBE 1LTSC 1HWTC 2WPRA 5AW2B 2O1KA 3ABVC 3TGUD 1URQA 2KP8A 3HTKA 1SQBJ 1IO4A 3H25A 2P10A 2M3BA 1SFCA 1OIPA 1YQ3C 1LTJA 4RESB 2KLVA 5APTA 3L36A 5AW4B 1PGPA 3VP9A 2WSEJ 4OGQD 1FZGA 4CPGA 5DJUB 1X8YA 1BE3J 2YKQA 3IR9A 1KYOD 3T97A 1VQ9P 1NGMB 1S9KD 3OJAB 1PPJE 4EYYQ 4H0LD 4KT0J 2K3RA 1IZNB 3SFEC 5AVRB 1VQ5P 2K88A 1NTMJ 1PZQA 3FXDA 3HUSB 1RQVA 1NU1K 2IFMA 4D6TD 2QM7A 3AE7C 1J1EB 1A02J 3HE4A 1SQVE 1G1JA 2BCCG 1MUUA 1VDFA 2JP3A 2K9JB 5H2FH 1S4XA 2KXPB 4WY4C 4U3FE 4L76A 3LIDA 3AE3C 1SLQA 2WQYC 1GK4A 2R5BA 3OW2O 1EDKA 1OFCX 2P58A 4KJMA 1EC5A 1LP1A 3FGAD 3H6PA 1SQPJ 3B4SA 1RE4A 3HD7C 1VQOP 1NOHA 2E76C 5CMZA 4BRYA 3CWBD 3FWNA 1KTMA 1HGZA 1JTHA 3L37A 3IAOA 1AVOA 4HH2A 1KD1Q 2K37A 1BCCE 1JY2P 1M1JA 5GTIH 1NTZE 1SQXJ 2OTLP 5H2FE 1PGJA 1G2CB 1EDJA 1M56D 1LTGC 2XDJA 4DJGA 4JF7A 2FXPA 2FY8A 2IFNA 2GUVA 3CXHI 1QL2A 4WY4D 1K73Q 3PTZA 1KILD 1N73C 3H1LG 2KLUA 2KUBA 3A7OA 1PPJD 3HD7D 1SQVG 2E76D 3NXSA 1K8AQ 1JM0A 1QEXA 2O01H 2KS1A 2N1TB 5GTIE 1JUNA 4I2LC 2KIKA 3HD7A 2WITA 1JMBA 1JEKA 4UB6H 3V2PA 2Y9YA 4YXDC 2RH0A 1AQ5A 2A45I 1QX8A 1SQVD 3AEEC 1SQBK 1L4AA 3VMAA 3LIEA 4IL6X 1R8EA 5AVZB 1NO4A 2E74C 3IFMA 4U3FD 1FS0E 3H32A 2OTKE 2OYIC 3RL0C 2FBWC 4RKUJ 3R4YA 4TLFA 2Q6QA 1AVYA 3D6ZA 1Y9BA 2ZYDA 3HE5A 3HTKB 4LGDE 4UB6E 1KV4A 2P7JA 3NTNA 2YNYA 2HR3A 3TSIA 3MGNA 3TNUA 1SFCB 2OYOA 2A45H 1LTJB 3KPEA 3U1CA 2W27A 3TGUJ 1NTZD 2I1JA 5BU5A 4PD4I 2GA1A 2K9YA 1J2JB 3H1HE 1NTMK 2H89C 5KKZC 1H88A 4WB4A 1AQTA 3I55P 1EDIA 5APVA 2Q3EA 4GT1A 2YXRB 1MV8A 3M91A 2JWAA 3RGUA 2POHA 1FZAA 2H8PD 4H44B 3T97B 3RL0D 1GDTA 2I8DA 3M9BA 1E5WA 1ZMEC 5CCGA 2OTJP 3MUDC 2ZYAA 4TT3H 2CPBA 3MP7B 1VQPP 1FDIA 1Y8AA 3GMAA 1T3UA 3L4FA 2WSFH 1P84I 4ZMDA 1SQPK 1KN7A 1KB9I 1Z56A 5KLVK 2FYNB 1M7LA 3GW6A 1JY3O 4W80A 1XTCC 4PD4H 3S9OA 1OWAA 1DD4A 1YJNP 1GU5A 3HE4B 3LW5H 4EI2A 1N7SB 3A0HH 3B71A 4MN4C 4D6TJ 3L72E 5AW3B 2HYNA 4Z1MH 1SQXK 2Y9ZA 4IL6H 1S1CX 2E75B 3G6EP 1OW8A 2C9NY 2FYUE 2Z5HA 3OAKA 1LP1B 4I7ZC 3I56P 5CJ0A 5AW6B 2B89A 5M1BA 4BRYB 1SQQG 4C7NA 1P84H 1KB9H 4PD4E 4DT0A 5DJTB 2N9BA 3AE8C 1M1JB 3CWBJ 3P32A 3A0HE 1GMJA 3W67A 1LT9C 3CXHD 1DIPA 1QVGO 2R3SA 3P7KA 3KXDA 4IL6E 1IC2A 3H1HD 3NFQA 2M5AB 1LWUC 2QSIA 1HTLC 1T2KD 3CD6P 1PIXA 1GZLA 2C0WA 4L73A 2Y0DA 2KK7A 3L71G 1P84E 1N7LA 1PFIA 1KB9E 1RF0C 1MKMA 1G1IA 2OGUA 4ZNCA 2KS1B 4YXWH 1RF1C 2V7QJ 2AEMA 3WUVA 3VMXA 2P1JA 1GW3A 5B5EH 2Y0CA 2FYUG 2IYPA 4Y28J 3L71D 3GLMA 1NTKG 1L4AB 1ZP0C 1Q82Q 1CW5A 3L74G 2ZT9C 2IBZI 2N1TD 1S2EA 4W7YA 2Q1KA 2P67A 2FYUD 1K9MQ 3AEDC 1NKNA 1GU4A 1JO5A 5CBOA 2NRGA 1L0NG 4U3FJ 3L70J 2KB7P 3BVHA 3HE5B 3RL0g 4H13B 1JB0J 5B5EE 1BGYJ 3BCCG 4PD4D 3VMZA 2JJLA 3L74D 1MZ9A 2HG5D 5CBNA 1IK9A 1LNQA 3B5ND 1YTZT 5KLIC 1VPCA 2W83C 3EQ2A 5KJ7D 1PGOA 4GOEA 2ITAA 3CL3D 2BCCE 2W8ZA 4N78E 3RK3C 1L0ND 3A5TA 2WPQA 4JPZB 1BCCJ 3H1JG 2QJPB 3V5BA 1JOCA 4QMAA 1NTZJ 2XV5A 2ZT9D 1K05A 1X79B 3F5HA 3V4WA 3D70A 2WZ7A 4W7ZA 1LJ2A 3Q2YA 1P84D 3JCUH 3V4QA 2OYHB 1KB9D 2AXCA 2E5TA 3AE1C 2XNXA 1D7MA 2J5UA 3H1JD
chains in the Genus database with same CATH topology
1LTTC 2Q9IA 1ZLLA 4C7RA 1KILD 1FOSE 1NKZB 2Q7CA 3HD7B 1T8ZA 5KTBA 1NAFA 2MJZA 1HGVA 1N73C 5AVXB 1KFNA 2W6AA 2XU6A 3B5NC 3RK3B 1J1DC 3A7OA 4Y99C 1MFZA 3SWFA 5KJ7C 1T3JA 1RY3A 3HD7D 2OYHA 2XKMA 3NXSA 1KQLA 1FZCC 3M9HA 3RK3D 2O01H 2N1TB 5CJ4A 1JUNA 1A02F 4I2LC 3HD7A 1IJDB 4DZOA 2WITA 1LT9A 3TK1A 2J59M 1FBMA 2H43A 3V2PA 1SQQK 3H32B 2CPSA 4B86A 1FZEA 1AQ5A 3M0DC 2A45I 3RK2B 1SFCC 2YO3A 5CCHA 1LTJC 1LWUA 3TYYA 1SQBK 3GHGC 1L4AA 1FJPA 3RK2D 1EQ7A 2N1TA 2Q5UA 2HFED 4C7NB 3LIEA 2QM8A 1N7SD 5AVZB 2LKMA 5AVVB 1NO4A 3EFGA 3A3YB 3P8CE 3IFMA 1N73B 2FKWB 2NPSC 3HUSA 3H32A 1J1DB 1KILC 4Y99B 1H89A 2IX7C 2OYIC 2YO2A 3RL0C 3TNUB 3N4XA 1RF0A 2E43A 1YYCA 3VYIA 3E1IA 2Z5IA 1FZCB 4LC1A 3P8MC 1RF1A 3SWYA 5AVQB 4ZKUA 1FDMA 5AVTB 3HE5A 3CLQA 4N78D 1CI6B 4AUWA 3BATA 2WSCH 3HTKB 4LGDE 3B5NA 2P7JA 3NTNA 1OXZA 5APWA 2YNYA 3TSIA 3M9QA 5KJ7A 2BASA 3MGNA 4EIJA 2Q3IA 4DOJA 3TNUA 1GD2E 1SFCB 2A45H 1LTJB 2WPSA 3O8ZA 3GHGB 3KPEA 3U1CA 2W27A 4AQRD 2I1JA 5BU5A 1GTWA 1SFCD 3V2RA 1GW4A 1J2JB 3CI9A 1ZR2A 1CI6A 2PAJA 1NTMK 2ZXEB 2NPSB 1DX7A 2P2UA 2A45G 1H88A 2FYUK 4WB4A 1KILB 2KOGA 5APSA 3VMYA 1HH0A 1SQVK 5APVA 1HUCA 1N7SC 1FZFA 2OYIB 3RL0B 5AW5B 4GT1A 2NPSD 3I5CA 2ZFCA 1MV8A 2GUSA 3M91A 3VOPA 2POHA 1FZAA 5BU8B 2H8PD 1JNMA 3RL0D 1GDTA 2I1KA 2IPPA 1G2CA 2JEEA 5APUA 3M9BA 1E5WA 4O9BA 2PP6A 5CCGA 4WY4A 2NPSA 2CPBA 2FFDC 1ZR4A 1HVVA 1KILA 3U1AA 1T3UA 1RE4C 1W2EA 1LTAC 2WSFH 3L35A 3L4FA 2E42A 3WMM0 2HODB 4LLHA 1SQPK 1X9VA 3B8EB 4OH8B 2C9LY 2VRSA 1L0NK 1URQC 1Z56A 1JY3N 5KLVK 1FAVA 1M7LA 1ZV8A 3BASA 4ZKPA 4W80A 1JY3O 1S9KE 1XTCC 1OWAA 1IFJA 5AVYB 2WT7B 4XA4A 3HE4B 1GU5A 2YKOA 1ZN5A 1SVFA 3V2NA 3LW5H 1M1JC 2FXMA 3KDPB 1N7SB 1NTZK 1CSBA 2Z4EA 5AW3B 1JY2O 2HYNA 2W6BA 1SQXK 4C46A 3P8CD 1H8AA 1AFOA 1GL2B 3KYQA 4IFFA 5BVZA 1IFDA 1NWQA 4HYTB 2C9NY 2Z5HA 2FFDB 2WT7A 2M8RA 3A2AA 3NMDA 1HBWA 3OAKA 5AVWB 5AW7B 4IFDK 4XE5B 1GL2D 1N7SA 5CJ0A 5AW6B 1XTGB 4C7NA 2HPCB 1URQB 4JYBA 1N73A 5AW9B 5AVUB 1QL1A 5APQA 1N2DC 1FJKA 5AW0B 1GK6A 1URQD 2N9BA 2WSEH 5AVSB 4WBAA 2KYVA 1FZCA 1M1JB 1FZBA 2YMYA 4N6JA 3P32A 5AW8B 3G3ZA 1LT9C 1NTKK 1CZQA 3C9IA 2H7HA 1LTSC 1HWTC 2WPRA 5AW2B 3P7KA 1FOSF 1LTBC 2O1JA 2O1KA 1IC2A 3M0AA 1LTIC 1URQA 3NFQA 2KP8A 3HTKA 3VTPC 3VN0A 1LWUC 1HTLC 1IO4A 3KQGA 1T2KD 1L4AC 1JCDA 1IFMA 3M0DA 1GZLA 2C0WA 2M3BA 1SFCA 5CHXA 1LTJA 4RESB 2KLVA 3GHGA 1WRGA 3MTUE 5APTA 3L36A 3HUSC 1SP4A 1KZUB 1GL2C 5AW4B 1FU1A 1J1EC 1N7LA 1PFIA 3VP9A 1JMMA 1RF0C 1DH3A 1FZGA 2J58A 1G1IA 1X8YA 2FYZA 2OYIA 1RF1C 1IFIA 3BRVB 3VMXA 2YKQA 2P1JA 3IR9A 1LT9B 2R5DA 2L5GB 1GW3A 3T97A 3BRTB 4JYCA 3MIWA 1S9KD 3OJAB 1KFMA 3HRNA 1NHLA 3OA7A 2YKPA 1LWUB 5AVRB 1NH4A 1L4AB 2XZRA 4M3LA 1JY2N 2HODA 3N7NA 5CCHD 1CW5A 1RE3C 4I6MC 1L4AD 1T2KC 2N1TD 3HUSB 1NU1K 2IFMA 4IFMA 2QM7A 1J1EB 4W7YA 2P67A 1A02J 2WWWA 4GIFA 3HE4A 1NKNA 1GU4A 1G1JA 1N86A 1JO5A 1RF1B 1MUUA 3MD0A 1VDFA 2KB7P 3BVHA 3HE5B 4I1LA 1DEBA 5CCGC 4N3YB 3U59A 4WY4C 5AW1B 3B5NB 3V2QA 3LIDA 2OYHC 3II6A 1JTHB 1SLQA 3PP5A 2R3CA 1GL2A 3VMZA 2JJLA 1GK4A 1MZ9A 2C0XA 2R5BA 2HG5D 1IK9A 2OARA 3MUDA 2FFDA 3B5ND 1YTZT 1L0LK 1VPCA 4KHXA 3EQ2A 3H6PA 5KJ7D 1RE4A 3M06A 3HD7C 2GM4A 1JY3P 1NOHA 3CL3D 2R32A 5CMZA 4N78E 3RK3C 3A5TA 2HPCA 2WPQA 4AYCA 1HGZA 2KSJA 1JTHA 3L37A 4HH2A 5CCHC 3V5BA 1LGHB 1JOCA 5APYA 5APXA 2XV5A 1IFNA 1WT6A 3VP8A 1JY2P 2HLOA 2N1TC 1X79B 3UIAA 3V4WA 1M1JA 3R2PA 4EOTA 2WZ7A 4W7ZA 1G2CB 1RE3A 4WY4B 1LTGC 2XDJA 4JF7A 2WTYA 3RK2C 4GKGA 3V4QA 2OYHB 1YTZI 2IFNA 2XNXA 1JCCA 5CCGD 1HJBA 2GUVA 1QL2A 4WY4D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WPS A;  4M3L A;  3O8Z A;  1FOS E;  5AW6 B;  2W27 A;  2Q7C A;  4AQR D;  4C7N A;  1NAF A;  1GTW A;  4I6M C;  5AVX B;  1T2K C;  2W6A A;  2XU6 A;  1J2J B;  1CI6 A;  4JYB A;  3A7O A;  3SWF A;  1MFZ A;  2ZXE B;  2QM7 A;  2P2U A;  5AW9 B;  1H88 A;  5AVU B;  2P67 A;  1A02 J;  3NXS A;  5APQ A;  1KQL A;  3M9H A;  5APS A;  2WWW A;  3VMY A;  5APV A;  1HUC A;  1GK6 A;  5AW0 B;  2N9B A;  3HE4 A;  5AVS B;  1GU4 A;  5AW5 B;  4GT1 A;  3I5C A;  1MUU A;  2ZFC A;  1MV8 A;  3MD0 A;  3M91 A;  3P32 A;  5AW8 B;  3HE5 B;  1JUN A;  1A02 F;  1CZQ A;  4I2L C;  1JNM A;  4DZO A;  2IPP A;  2H7H A;  1HWT C;  2WPR A;  5AW2 B;  3P7K A;  3TK1 A;  1FOS F;  5APU A;  3M9B A;  5AW1 B;  3M0A A;  3LID A;  3NFQ A;  2KP8 A;  1SLQ A;  3HTK A;  3VTP C;  4B86 A;  2R3C A;  3VMZ A;  3VN0 A;  2JJL A;  1GK4 A;  2R5B A;  1IO4 A;  3KQG A;  1T2K D;  3M0D A;  2YO3 A;  3TYY A;  4KHX A;  1GZL A;  3L35 A;  2E42 A;  4RES B;  3M06 A;  2Q5U A;  4C7N B;  3LIE A;  2QM8 A;  3B8E B;  2R32 A;  5CMZ A;  5APT A;  5AVV B;  2VRS A;  5AVZ B;  3L36 A;  2C9L Y;  3A3Y B;  1FAV A;  3A5T A;  1SP4 A;  5AW4 B;  2WPQ A;  4AYC A;  1S9K E;  3L37 A;  1OWA A;  1H89 A;  1DH3 A;  5AVY B;  2YO2 A;  3TNU B;  3V5B A;  3HE4 B;  2WT7 B;  1GU5 A;  5APY A;  5APX A;  2E43 A;  1YYC A;  2XV5 A;  3VYI A;  2Z5I A;  1X8Y A;  4LC1 A;  3KDP B;  3UIA A;  3V4W A;  3VMX A;  3P8M C;  1CSB A;  4EOT A;  5AVQ B;  3IR9 A;  5AVT B;  5AW3 B;  2R5D A;  3HE5 A;  1G2C B;  3T97 A;  4C46 A;  4JYC A;  1H8A A;  1CI6 B;  4AUW A;  1S9K D;  1NWQ A;  2P7J A;  3NTN A;  2WTY A;  1OXZ A;  4GKG A;  4HYT B;  3V4Q A;  5APW A;  2YNY A;  2C9N Y;  2BAS A;  2Z5H A;  3MGN A;  1GD2 E;  2Q3I A;  3TNU A;  2WT7 A;  3A2A A;  3NMD A;  1HBW A;  1HJB A;  3OAK A;  5AVW B;  5AW7 B;  5AVR B;  4XE5 B;  2XZR A; 
#chains in the Genus database with same CATH topology
 1LTT C;  2Q9I A;  4GDO A;  1ZLL A;  2E5Y A;  1FOS E;  1KIL E;  5E79 H;  5KTB A;  2KZI A;  3CX5 I;  3SWF A;  4H44 D;  1MFZ A;  1FZC C;  1ZXG A;  3RK3 D;  3FX0 A;  1S3J A;  2IZ0 A;  5CJ4 A;  2QIW A;  1NTK D;  1PP9 J;  4DZO A;  1K04 A;  3TK1 A;  3M0D C;  3H1L E;  3RK2 B;  3CCQ P;  1OVR A;  2YIU B;  3GHG C;  2WPV B;  1FJP A;  2Q5U A;  2HFE D;  4C7N B;  5E79 E;  2DW3 A;  3PH0 A;  2QM8 A;  1N7S D;  3P8C E;  3E1R A;  1J1D B;  1KIL C;  2O01 J;  4HKZ H;  4Y99 B;  2IX7 C;  3CX5 H;  3N4X A;  2E43 A;  3VYI A;  3E1I A;  2Z5I A;  1M8O B;  3P8M C;  1TU3 F;  4ZKU A;  1FDM A;  5KLV J;  1NU1 G;  3H1I G;  2BCC D;  2JKV A;  4N78 D;  3L73 G;  1CI6 B;  1OXZ A;  5APW A;  1ZW0 A;  3M9Q A;  2BAS A;  2Q3I A;  4DOJ A;  1GD2 E;  1EXJ A;  1NYH A;  2WPS A;  1U7J A;  3H1H J;  3EWK A;  1AA0 A;  1GW4 A;  2IBZ G;  3CI9 A;  1ZR2 A;  2PAJ A;  1NU1 D;  2NPS B;  1W5C E;  3H1K G;  1SQV K;  4L74 A;  3SFD C;  3VOP A;  2I1K A;  2IPP A;  2QJK B;  2R44 A;  2QJY C;  4WY4 A;  2FFD C;  1L0L J;  2IBZ D;  1HVV A;  1KIL A;  2D2C B;  3H1K D;  1AJY A;  5GTH H;  1VF5 B;  2UWJ E;  2PGD A;  2C9L Y;  2VRS A;  1FAV A;  4ZKP A;  2KI7 B;  1IFJ A;  3H1L D;  4XA4 A;  4PV1 C;  2YKO A;  2CK3 H;  3L72 J;  3SSU A;  1NTZ K;  1CSB A;  2W6J H;  3CXH H;  2W6B A;  3P8C D;  1H8A A;  1AFO A;  1NWQ A;  5BVZ A;  2WT7 A;  3A2A A;  4XE5 B;  1GL2 D;  3L75 G;  2WMM A;  5GTH E;  3WU2 H;  1ZRT D;  1LT1 A;  1YHQ P;  1URQ B;  1N73 A;  3LW5 J;  1QL1 A;  1SQB G;  1YIT P;  5AW0 B;  1PL5 A;  2KYV A;  4PJ0 H;  3Q5R A;  3CXH E;  2QE7 H;  4PV1 D;  1DD3 A;  2H7H A;  1FOS F;  1WMK A;  3G9R A;  1LTB C;  2O1J A;  3M0A A;  3CCS P;  1SQQ E;  1ZOY C;  2QEX P;  3VN0 A;  3FWL A;  3CX5 D;  3KQG A;  1IFM A;  4K3A A;  1BE3 G;  5CHX A;  1SQB D;  1Q90 D;  4OGQ B;  3CCM P;  1WRG A;  3MTU E;  3WU2 E;  1EZV G;  3HUS C;  3CC7 P;  1KZU B;  1FU1 A;  1J1E C;  2A06 G;  1JMM A;  1DH3 A;  3RBZ A;  2J58 A;  3AE4 C;  3WUU A;  2OYI A;  1IFI A;  4PJ0 E;  1NAY A;  1FE6 A;  3Q3D A;  4GOD A;  4H0L B;  1NTM G;  2YXQ B;  2L5G B;  1VQN P;  3BRT B;  1M90 Q;  1U57 A;  1VQ4 P;  1M57 D;  1R5L A;  3L71 E;  2A06 D;  2XZR A;  3G71 P;  4M3L A;  2B88 A;  1JY2 N;  3N7N A;  5CCH D;  4I6M C;  4YPC A;  3ZDM A;  1T2K C;  1YJ9 P;  3AE9 C;  4IFM A;  3KHU A;  2WWW A;  1S5L X;  4GIF A;  1KYO I;  1N86 A;  1SQP G;  1Q81 Q;  2G3A A;  3MD0 A;  4XFJ A;  5KLV G;  1DEB A;  2KNC A;  3GG2 A;  3II6 A;  1JTH B;  3PP5 A;  2C0X A;  3L74 E;  3MUD A;  1L0L K;  4KHX A;  3M06 A;  1SQX G;  1JY3 P;  2K9J A;  2R32 A;  4K35 A;  1SQP D;  1HJ0 A;  2NZ2 A;  1L0N E;  2HPC A;  1KMI Z;  4EDF A;  3K5B A;  1SQQ D;  3Q5P A;  3TF5 A;  1LGH B;  5APY A;  1IFN A;  1WT6 A;  3PJS K;  1RHZ B;  4JQ0 D;  4BXL A;  3BCC E;  2HLO A;  2N1T C;  3UIA A;  1OVV A;  3R2P A;  4EOT A;  1FC2 C;  3Q1M A;  4WY4 B;  4GKG A;  1N8R Q;  1OVU A;  1YTZ I;  2B9B A;  1HJB A;  1KQF B;  3H1J E;  1VL2 A;  5B66 H;  3HD7 B;  1T8Z A;  1NAF A;  4GOF A;  2MJZ A;  2E76 B;  5AVX B;  2W6A A;  3B5N C;  5KJ7 C;  2IZ1 A;  4OVN F;  2XKM A;  1YIJ P;  3RK3 E;  3AEC C;  4ASV A;  5EFW B;  1A02 F;  2D2C D;  1NTK E;  1IJD B;  1LT9 A;  3H1L J;  3D6Y A;  1FBM A;  3H32 B;  2CPS A;  1FZE A;  1SQV J;  1DEE G;  1SFC C;  2JDI H;  2YO3 A;  1LTJ C;  1LWU A;  3TYY A;  1S5L H;  3TDK A;  2PFX A;  2N1T A;  3CC2 P;  3CPW O;  5B66 E;  2LKM A;  1HF9 A;  1N73 B;  2FKW B;  3MZW B;  3QWO C;  2YO2 A;  3TNU B;  1RF0 A;  4RO0 A;  1YYC A;  2M0B A;  4LC1 A;  3O6Q A;  1H0T A;  1RF1 A;  3QH9 A;  3SWY A;  3TGU G;  4H44 C;  1OX3 A;  4R4L A;  3CCV P;  4JBZ A;  1BDD A;  2WSC H;  2RKL A;  4DCK A;  3B5N A;  3F89 A;  5TIS H;  5KJ7 A;  3CCJ P;  3CCE P;  3BCC D;  1S5L E;  2V7Q H;  1GTW A;  4NPE A;  1SFC D;  2FYN C;  2E74 B;  2ZXE B;  1NU1 E;  3H1I E;  1DX7 A;  2P2U A;  2KOG A;  3L73 E;  5APS A;  2OYI B;  1HH0 A;  1N7S C;  3RL0 B;  3I5C A;  2RN0 A;  2ZFC A;  4R4M A;  5L8R J;  2WVR A;  2E75 C;  3CMA P;  2JEE A;  4O9B A;  5TIS E;  2IBZ E;  3CC4 P;  3U1A A;  3C8V A;  1RE4 C;  3ITK A;  2W90 A;  1W2E A;  1LTA C;  3L35 A;  1PV3 A;  3KZI H;  3H1K E;  4LLH A;  4D6T G;  3WUT A;  3B8E B;  4NPD A;  2PRR A;  2JWD A;  1JY3 N;  2O3J A;  1YJW P;  2ZYG A;  2LXC B;  1SS1 A;  2BEZ F;  4BWN A;  3JCU E;  5KKZ B;  1BSH A;  3PHL A;  4YTP C;  1M1J C;  3RBX A;  2ZVO B;  3AEG C;  1PGQ A;  1E79 H;  2G8Y A;  2KNC B;  1JY2 O;  2M3E A;  3A0B H;  1EZV I;  4IFF A;  1IFD A;  5K5G B;  1OW6 A;  3E7K A;  1KOR A;  2RMZ A;  2E75 D;  1NJI Q;  5AW7 B;  5AVW B;  1N7S A;  1L2P A;  3CWB G;  1KC8 Q;  3KZI E;  1XTG B;  4HB1 A;  3AEF C;  3CCR P;  1ZRT E;  3L70 E;  2HPC B;  4JYB A;  4HJG H;  5C39 A;  5AW9 B;  3JC2 2;  1BGY E;  1FJK A;  3AEB C;  2WSE H;  1FZC A;  1FZB A;  3Q5S A;  4N6J A;  5AW8 B;  1Q86 Q;  1SQQ J;  3C9I A;  2V4H A;  3L75 E;  2LR2 A;  3A0B E;  1LTI C;  3VTP C;  3H1I D;  1Y47 A;  2IYO A;  3L73 D;  1L4A C;  1JCD A;  3CX5 E;  3M0D A;  3PRJ A;  4I7Z B;  2K1A A;  1SQB E;  3GHG A;  1PPJ G;  2JO1 A;  3S4R A;  1SP4 A;  1GL2 C;  3GF3 A;  2M5A A;  3S1K A;  1UII A;  2FYZ A;  3BRV B;  2QRX A;  3IN6 A;  4H13 C;  1KQS O;  1LT9 B;  2R5D A;  2XND H;  1BE3 E;  4JYC A;  3L71 J;  2ZVN B;  3MIW A;  4OWF A;  1KFM A;  3HRN A;  1NHL A;  1EZV E;  3OA7 A;  2YKP A;  1LWU B;  1NH4 A;  2A06 E;  4U3F G;  3L70 G;  2HOD A;  2WSS H;  1RE3 C;  1L4A D;  1BGY G;  2FYU J;  2AXT H;  1PP9 E;  1NTM E;  3AE2 C;  1RQU A;  1YI2 P;  2BEQ D;  2QJP C;  2WSF J;  4IOI H;  4L75 A;  1USE A;  3O6Q B;  1H0T B;  3AE5 C;  1RF1 B;  1QVF O;  4I1L A;  1VQ6 P;  3C1L A;  2ZXX A;  5CCG C;  4N3Y B;  3U59 A;  3L74 J;  3L70 D;  3USS A;  2MKV A;  5AW1 B;  3B5N B;  3V2Q A;  2QA4 P;  1USD A;  2OYH C;  1BCC G;  2R3C A;  1GL2 A;  4H13 D;  1BGY D;  1NTZ G;  2OAR A;  2FFD A;  1W2B O;  1L0N J;  2GM4 A;  1SQP E;  3L75 D;  2ZT9 B;  4AYC A;  5KLV E;  2AXT E;  2KSJ A;  3BCC J;  1X0T A;  5CCH C;  5APX A;  3VP8 A;  3G4S P;  1BCC D;  2B87 A;  4U7J A;  3MHV A;  3IF4 A;  1BSN A;  1RE3 A;  1SQX E;  2IDB A;  2WTY A;  3RK2 C;  1UIX A;  3H1J J;  1Q7Y Q;  1VQ8 P;  2E74 D;  1JCC A;  5CCG D;  2YIU C;  3AE6 C;  5KLI B;  4C7R A;  3CCL P;  1NKZ B;  2Q7C A;  1PP9 G;  1HGV A;  1BE3 D;  1KFN A;  2XU6 A;  3RK3 B;  3V6I A;  1OMI A;  1J1D C;  1EXI A;  4Y99 C;  1T3J A;  1RY3 A;  1R5S A;  2OYH A;  1EZV D;  2ZAE B;  1M1K Q;  1KQL A;  3M9H A;  1IFP A;  4UB8 H;  1L0L E;  1NTK J;  2J59 M;  2H43 A;  1SQQ K;  1PP9 D;  4B86 A;  1NTM D;  3EFF K;  3GF7 A;  5CCH A;  1VQK P;  4WWI A;  2O01 N;  3RK2 D;  1EQ7 A;  4NPF X;  1OW7 A;  5AVV B;  3EFG A;  2AEF A;  3A3Y B;  2NPS C;  1X22 A;  3HUS A;  1YBK A;  1H89 A;  1VQL P;  2OQQ A;  4WVZ A;  5KAI H;  3FXE A;  1FZC B;  1BDC A;  2LXB A;  4UB8 E;  2BCC J;  5AVQ B;  3H1H G;  5AVT B;  3CLQ A;  2QJK C;  2Y0E A;  1MFT A;  4AUW A;  3BAT A;  2FXO A;  5KLV D;  1EDL A;  4EIJ A;  2D2C C;  3SWK A;  1IK7 A;  3O8Z A;  3GHG B;  1VF5 C;  1OZH A;  4AQR D;  1KYO H;  1FDO A;  1NU1 J;  3H1I J;  3V2R A;  3TGU E;  3L73 J;  1CI6 A;  1SQX D;  5KAF H;  2A45 G;  1L0L G;  2FYU K;  1KIL B;  3VMY A;  1FZF A;  1HUC A;  5KAI E;  5AW5 B;  4ASW A;  2NPS D;  2N9Y B;  4A7P A;  2GUS A;  2YMK A;  3JSV C;  5BU8 B;  2WSC J;  1JNM A;  1VQ7 P;  1G2C A;  5APU A;  1QLE D;  2PP6 A;  2NPS A;  1ZR4 A;  1Q2N A;  5TJH A;  3H1K J;  3L72 G;  3PLN A;  1L0L D;  2E42 A;  1QGK B;  3WMM 0;  2HOD B;  2SPZ A;  1KYO E;  1U7M A;  1X9V A;  4OH8 B;  1KQG B;  1NVO A;  1L0N K;  1URQ C;  1VQM P;  1S9K E;  1ZV8 A;  3BAS A;  1RH5 B;  5KAF E;  1VF5 D;  5AVY B;  2WT7 B;  1ZN5 A;  1SVF A;  3V2N A;  2FXM A;  3KDP B;  4RJT A;  3W68 A;  1S72 P;  2KZJ A;  2ZJS E;  3L72 D;  2L91 A;  2Z4E A;  2QVA A;  4C46 A;  4D6T E;  1GL2 B;  3KYQ A;  4HYT B;  2QJY B;  3D71 A;  2AEJ A;  2FFD B;  3AEA C;  2M8R A;  3NMD A;  1HBW A;  4IFD K;  4OGQ C;  1T6A A;  1AV1 A;  3CME P;  3CCU P;  1YQ4 C;  2JR8 A;  5AVU B;  5APQ A;  1N2D C;  2B87 B;  1GK6 A;  1URQ D;  5AVS B;  4PV1 B;  4WBA A;  2QG4 A;  2KSE A;  2YMY A;  3L75 J;  3G3Z A;  1NTK K;  4H0L C;  1CZQ A;  2H88 C;  3CWB E;  1LTS C;  1HWT C;  2WPR A;  5AW2 B;  2O1K A;  3ABV C;  3TGU D;  1URQ A;  2KP8 A;  3HTK A;  1SQB J;  1IO4 A;  3H25 A;  2P10 A;  2M3B A;  1SFC A;  1OIP A;  1YQ3 C;  1LTJ A;  4RES B;  2KLV A;  5APT A;  3L36 A;  5AW4 B;  1PGP A;  3VP9 A;  2WSE J;  4OGQ D;  1FZG A;  4CPG A;  5DJU B;  1X8Y A;  1BE3 J;  2YKQ A;  3IR9 A;  1KYO D;  3T97 A;  1VQ9 P;  1NGM B;  1S9K D;  3OJA B;  1PPJ E;  4EYY Q;  4H0L D;  4KT0 J;  2K3R A;  1IZN B;  3SFE C;  5AVR B;  1VQ5 P;  2K88 A;  1NTM J;  1PZQ A;  3FXD A;  3HUS B;  1RQV A;  1NU1 K;  2IFM A;  4D6T D;  2QM7 A;  3AE7 C;  1J1E B;  1A02 J;  3HE4 A;  1SQV E;  1G1J A;  2BCC G;  1MUU A;  1VDF A;  2JP3 A;  2K9J B;  5H2F H;  1S4X A;  2KXP B;  4WY4 C;  4U3F E;  4L76 A;  3LID A;  3AE3 C;  1SLQ A;  2WQY C;  1GK4 A;  2R5B A;  3OW2 O;  1EDK A;  1OFC X;  2P58 A;  4KJM A;  1EC5 A;  1LP1 A;  3FGA D;  3H6P A;  1SQP J;  3B4S A;  1RE4 A;  3HD7 C;  1VQO P;  1NOH A;  2E76 C;  5CMZ A;  4BRY A;  3CWB D;  3FWN A;  1KTM A;  1HGZ A;  1JTH A;  3L37 A;  3IAO A;  1AVO A;  4HH2 A;  1KD1 Q;  2K37 A;  1BCC E;  1JY2 P;  1M1J A;  5GTI H;  1NTZ E;  1SQX J;  2OTL P;  5H2F E;  1PGJ A;  1G2C B;  1EDJ A;  1M56 D;  1LTG C;  2XDJ A;  4DJG A;  4JF7 A;  2FXP A;  2FY8 A;  2IFN A;  2GUV A;  3CXH I;  1QL2 A;  4WY4 D;  1K73 Q;  3PTZ A;  1KIL D;  1N73 C;  3H1L G;  2KLU A;  2KUB A;  3A7O A;  1PPJ D;  3HD7 D;  1SQV G;  2E76 D;  3NXS A;  1K8A Q;  1JM0 A;  1QEX A;  2O01 H;  2KS1 A;  2N1T B;  5GTI E;  1JUN A;  4I2L C;  2KIK A;  3HD7 A;  2WIT A;  1JMB A;  1JEK A;  4UB6 H;  3V2P A;  2Y9Y A;  4YXD C;  2RH0 A;  1AQ5 A;  2A45 I;  1QX8 A;  1SQV D;  3AEE C;  1SQB K;  1L4A A;  3VMA A;  3LIE A;  4IL6 X;  1R8E A;  5AVZ B;  1NO4 A;  2E74 C;  3IFM A;  4U3F D;  1FS0 E;  3H32 A;  2OTK E;  2OYI C;  3RL0 C;  2FBW C;  4RKU J;  3R4Y A;  4TLF A;  2Q6Q A;  1AVY A;  3D6Z A;  1Y9B A;  2ZYD A;  3HE5 A;  3HTK B;  4LGD E;  4UB6 E;  1KV4 A;  2P7J A;  3NTN A;  2YNY A;  2HR3 A;  3TSI A;  3MGN A;  3TNU A;  1SFC B;  2OYO A;  2A45 H;  1LTJ B;  3KPE A;  3U1C A;  2W27 A;  3TGU J;  1NTZ D;  2I1J A;  5BU5 A;  4PD4 I;  2GA1 A;  2K9Y A;  1J2J B;  3H1H E;  1NTM K;  2H89 C;  5KKZ C;  1H88 A;  4WB4 A;  1AQT A;  3I55 P;  1EDI A;  5APV A;  2Q3E A;  4GT1 A;  2YXR B;  1MV8 A;  3M91 A;  2JWA A;  3RGU A;  2POH A;  1FZA A;  2H8P D;  4H44 B;  3T97 B;  3RL0 D;  1GDT A;  2I8D A;  3M9B A;  1E5W A;  1ZME C;  5CCG A;  2OTJ P;  3MUD C;  2ZYA A;  4TT3 H;  2CPB A;  3MP7 B;  1VQP P;  1FDI A;  1Y8A A;  3GMA A;  1T3U A;  3L4F A;  2WSF H;  1P84 I;  4ZMD A;  1SQP K;  1KN7 A;  1KB9 I;  1Z56 A;  5KLV K;  2FYN B;  1M7L A;  3GW6 A;  1JY3 O;  4W80 A;  1XTC C;  4PD4 H;  3S9O A;  1OWA A;  1DD4 A;  1YJN P;  1GU5 A;  3HE4 B;  3LW5 H;  4EI2 A;  1N7S B;  3A0H H;  3B71 A;  4MN4 C;  4D6T J;  3L72 E;  5AW3 B;  2HYN A;  4Z1M H;  1SQX K;  2Y9Z A;  4IL6 H;  1S1C X;  2E75 B;  3G6E P;  1OW8 A;  2C9N Y;  2FYU E;  2Z5H A;  3OAK A;  1LP1 B;  4I7Z C;  3I56 P;  5CJ0 A;  5AW6 B;  2B89 A;  5M1B A;  4BRY B;  1SQQ G;  4C7N A;  1P84 H;  1KB9 H;  4PD4 E;  4DT0 A;  5DJT B;  2N9B A;  3AE8 C;  1M1J B;  3CWB J;  3P32 A;  3A0H E;  1GMJ A;  3W67 A;  1LT9 C;  3CXH D;  1DIP A;  1QVG O;  2R3S A;  3P7K A;  3KXD A;  4IL6 E;  1IC2 A;  3H1H D;  3NFQ A;  2M5A B;  1LWU C;  2QSI A;  1HTL C;  1T2K D;  3CD6 P;  1PIX A;  1GZL A;  2C0W A;  4L73 A;  2Y0D A;  2KK7 A;  3L71 G;  1P84 E;  1N7L A;  1PFI A;  1KB9 E;  1RF0 C;  1MKM A;  1G1I A;  2OGU A;  4ZNC A;  2KS1 B;  4YXW H;  1RF1 C;  2V7Q J;  2AEM A;  3WUV A;  3VMX A;  2P1J A;  1GW3 A;  5B5E H;  2Y0C A;  2FYU G;  2IYP A;  4Y28 J;  3L71 D;  3GLM A;  1NTK G;  1L4A B;  1ZP0 C;  1Q82 Q;  1CW5 A;  3L74 G;  2ZT9 C;  2IBZ I;  2N1T D;  1S2E A;  4W7Y A;  2Q1K A;  2P67 A;  2FYU D;  1K9M Q;  3AED C;  1NKN A;  1GU4 A;  1JO5 A;  5CBO A;  2NRG A;  1L0N G;  4U3F J;  3L70 J;  2KB7 P;  3BVH A;  3HE5 B;  3RL0 g;  4H13 B;  1JB0 J;  5B5E E;  1BGY J;  3BCC G;  4PD4 D;  3VMZ A;  2JJL A;  3L74 D;  1MZ9 A;  2HG5 D;  5CBN A;  1IK9 A;  1LNQ A;  3B5N D;  1YTZ T;  5KLI C;  1VPC A;  2W83 C;  3EQ2 A;  5KJ7 D;  1PGO A;  4GOE A;  2ITA A;  3CL3 D;  2BCC E;  2W8Z A;  4N78 E;  3RK3 C;  1L0N D;  3A5T A;  2WPQ A;  4JPZ B;  1BCC J;  3H1J G;  2QJP B;  3V5B A;  1JOC A;  4QMA A;  1NTZ J;  2XV5 A;  2ZT9 D;  1K05 A;  1X79 B;  3F5H A;  3V4W A;  3D70 A;  2WZ7 A;  4W7Z A;  1LJ2 A;  3Q2Y A;  1P84 D;  3JCU H;  3V4Q A;  2OYH B;  1KB9 D;  2AXC A;  2E5T A;  3AE1 C;  2XNX A;  1D7M A;  2J5U A;  3H1J D; 
#chains in the Genus database with same CATH homology
 1LTT C;  2Q9I A;  1ZLL A;  4C7R A;  1KIL D;  1FOS E;  1NKZ B;  2Q7C A;  3HD7 B;  1T8Z A;  5KTB A;  1NAF A;  2MJZ A;  1HGV A;  1N73 C;  5AVX B;  1KFN A;  2W6A A;  2XU6 A;  3B5N C;  3RK3 B;  1J1D C;  3A7O A;  4Y99 C;  1MFZ A;  3SWF A;  5KJ7 C;  1T3J A;  1RY3 A;  3HD7 D;  2OYH A;  2XKM A;  3NXS A;  1KQL A;  1FZC C;  3M9H A;  3RK3 D;  2O01 H;  2N1T B;  5CJ4 A;  1JUN A;  1A02 F;  4I2L C;  3HD7 A;  1IJD B;  4DZO A;  2WIT A;  1LT9 A;  3TK1 A;  2J59 M;  1FBM A;  2H43 A;  3V2P A;  1SQQ K;  3H32 B;  2CPS A;  4B86 A;  1FZE A;  1AQ5 A;  3M0D C;  2A45 I;  3RK2 B;  1SFC C;  2YO3 A;  5CCH A;  1LTJ C;  1LWU A;  3TYY A;  1SQB K;  3GHG C;  1L4A A;  1FJP A;  3RK2 D;  1EQ7 A;  2N1T A;  2Q5U A;  2HFE D;  4C7N B;  3LIE A;  2QM8 A;  1N7S D;  5AVZ B;  2LKM A;  5AVV B;  1NO4 A;  3EFG A;  3A3Y B;  3P8C E;  3IFM A;  1N73 B;  2FKW B;  2NPS C;  3HUS A;  3H32 A;  1J1D B;  1KIL C;  4Y99 B;  1H89 A;  2IX7 C;  2OYI C;  2YO2 A;  3RL0 C;  3TNU B;  3N4X A;  1RF0 A;  2E43 A;  1YYC A;  3VYI A;  3E1I A;  2Z5I A;  1FZC B;  4LC1 A;  3P8M C;  1RF1 A;  3SWY A;  5AVQ B;  4ZKU A;  1FDM A;  5AVT B;  3HE5 A;  3CLQ A;  4N78 D;  1CI6 B;  4AUW A;  3BAT A;  2WSC H;  3HTK B;  4LGD E;  3B5N A;  2P7J A;  3NTN A;  1OXZ A;  5APW A;  2YNY A;  3TSI A;  3M9Q A;  5KJ7 A;  2BAS A;  3MGN A;  4EIJ A;  2Q3I A;  4DOJ A;  3TNU A;  1GD2 E;  1SFC B;  2A45 H;  1LTJ B;  2WPS A;  3O8Z A;  3GHG B;  3KPE A;  3U1C A;  2W27 A;  4AQR D;  2I1J A;  5BU5 A;  1GTW A;  1SFC D;  3V2R A;  1GW4 A;  1J2J B;  3CI9 A;  1ZR2 A;  1CI6 A;  2PAJ A;  1NTM K;  2ZXE B;  2NPS B;  1DX7 A;  2P2U A;  2A45 G;  1H88 A;  2FYU K;  4WB4 A;  1KIL B;  2KOG A;  5APS A;  3VMY A;  1HH0 A;  1SQV K;  5APV A;  1HUC A;  1N7S C;  1FZF A;  2OYI B;  3RL0 B;  5AW5 B;  4GT1 A;  2NPS D;  3I5C A;  2ZFC A;  1MV8 A;  2GUS A;  3M91 A;  3VOP A;  2POH A;  1FZA A;  5BU8 B;  2H8P D;  1JNM A;  3RL0 D;  1GDT A;  2I1K A;  2IPP A;  1G2C A;  2JEE A;  5APU A;  3M9B A;  1E5W A;  4O9B A;  2PP6 A;  5CCG A;  4WY4 A;  2NPS A;  2CPB A;  2FFD C;  1ZR4 A;  1HVV A;  1KIL A;  3U1A A;  1T3U A;  1RE4 C;  1W2E A;  1LTA C;  2WSF H;  3L35 A;  3L4F A;  2E42 A;  3WMM 0;  2HOD B;  4LLH A;  1SQP K;  1X9V A;  3B8E B;  4OH8 B;  2C9L Y;  2VRS A;  1L0N K;  1URQ C;  1Z56 A;  1JY3 N;  5KLV K;  1FAV A;  1M7L A;  1ZV8 A;  3BAS A;  4ZKP A;  4W80 A;  1JY3 O;  1S9K E;  1XTC C;  1OWA A;  1IFJ A;  5AVY B;  2WT7 B;  4XA4 A;  3HE4 B;  1GU5 A;  2YKO A;  1ZN5 A;  1SVF A;  3V2N A;  3LW5 H;  1M1J C;  2FXM A;  3KDP B;  1N7S B;  1NTZ K;  1CSB A;  2Z4E A;  5AW3 B;  1JY2 O;  2HYN A;  2W6B A;  1SQX K;  4C46 A;  3P8C D;  1H8A A;  1AFO A;  1GL2 B;  3KYQ A;  4IFF A;  5BVZ A;  1IFD A;  1NWQ A;  4HYT B;  2C9N Y;  2Z5H A;  2FFD B;  2WT7 A;  2M8R A;  3A2A A;  3NMD A;  1HBW A;  3OAK A;  5AVW B;  5AW7 B;  4IFD K;  4XE5 B;  1GL2 D;  1N7S A;  5CJ0 A;  5AW6 B;  1XTG B;  4C7N A;  2HPC B;  1URQ B;  4JYB A;  1N73 A;  5AW9 B;  5AVU B;  1QL1 A;  5APQ A;  1N2D C;  1FJK A;  5AW0 B;  1GK6 A;  1URQ D;  2N9B A;  2WSE H;  5AVS B;  4WBA A;  2KYV A;  1FZC A;  1M1J B;  1FZB A;  2YMY A;  4N6J A;  3P32 A;  5AW8 B;  3G3Z A;  1LT9 C;  1NTK K;  1CZQ A;  3C9I A;  2H7H A;  1LTS C;  1HWT C;  2WPR A;  5AW2 B;  3P7K A;  1FOS F;  1LTB C;  2O1J A;  2O1K A;  1IC2 A;  3M0A A;  1LTI C;  1URQ A;  3NFQ A;  2KP8 A;  3HTK A;  3VTP C;  3VN0 A;  1LWU C;  1HTL C;  1IO4 A;  3KQG A;  1T2K D;  1L4A C;  1JCD A;  1IFM A;  3M0D A;  1GZL A;  2C0W A;  2M3B A;  1SFC A;  5CHX A;  1LTJ A;  4RES B;  2KLV A;  3GHG A;  1WRG A;  3MTU E;  5APT A;  3L36 A;  3HUS C;  1SP4 A;  1KZU B;  1GL2 C;  5AW4 B;  1FU1 A;  1J1E C;  1N7L A;  1PFI A;  3VP9 A;  1JMM A;  1RF0 C;  1DH3 A;  1FZG A;  2J58 A;  1G1I A;  1X8Y A;  2FYZ A;  2OYI A;  1RF1 C;  1IFI A;  3BRV B;  3VMX A;  2YKQ A;  2P1J A;  3IR9 A;  1LT9 B;  2R5D A;  2L5G B;  1GW3 A;  3T97 A;  3BRT B;  4JYC A;  3MIW A;  1S9K D;  3OJA B;  1KFM A;  3HRN A;  1NHL A;  3OA7 A;  2YKP A;  1LWU B;  5AVR B;  1NH4 A;  1L4A B;  2XZR A;  4M3L A;  1JY2 N;  2HOD A;  3N7N A;  5CCH D;  1CW5 A;  1RE3 C;  4I6M C;  1L4A D;  1T2K C;  2N1T D;  3HUS B;  1NU1 K;  2IFM A;  4IFM A;  2QM7 A;  1J1E B;  4W7Y A;  2P67 A;  1A02 J;  2WWW A;  4GIF A;  3HE4 A;  1NKN A;  1GU4 A;  1G1J A;  1N86 A;  1JO5 A;  1RF1 B;  1MUU A;  3MD0 A;  1VDF A;  2KB7 P;  3BVH A;  3HE5 B;  4I1L A;  1DEB A;  5CCG C;  4N3Y B;  3U59 A;  4WY4 C;  5AW1 B;  3B5N B;  3V2Q A;  3LID A;  2OYH C;  3II6 A;  1JTH B;  1SLQ A;  3PP5 A;  2R3C A;  1GL2 A;  3VMZ A;  2JJL A;  1GK4 A;  1MZ9 A;  2C0X A;  2R5B A;  2HG5 D;  1IK9 A;  2OAR A;  3MUD A;  2FFD A;  3B5N D;  1YTZ T;  1L0L K;  1VPC A;  4KHX A;  3EQ2 A;  3H6P A;  5KJ7 D;  1RE4 A;  3M06 A;  3HD7 C;  2GM4 A;  1JY3 P;  1NOH A;  3CL3 D;  2R32 A;  5CMZ A;  4N78 E;  3RK3 C;  3A5T A;  2HPC A;  2WPQ A;  4AYC A;  1HGZ A;  2KSJ A;  1JTH A;  3L37 A;  4HH2 A;  5CCH C;  3V5B A;  1LGH B;  1JOC A;  5APY A;  5APX A;  2XV5 A;  1IFN A;  1WT6 A;  3VP8 A;  1JY2 P;  2HLO A;  2N1T C;  1X79 B;  3UIA A;  3V4W A;  1M1J A;  3R2P A;  4EOT A;  2WZ7 A;  4W7Z A;  1G2C B;  1RE3 A;  4WY4 B;  1LTG C;  2XDJ A;  4JF7 A;  2WTY A;  3RK2 C;  4GKG A;  3V4Q A;  2OYH B;  1YTZ I;  2IFN A;  2XNX A;  1JCC A;  5CCG D;  1HJB A;  2GUV A;  1QL2 A;  4WY4 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...