1SPAA

Role of asp222 in the catalytic mechanism of escherichia coli aspartate aminotransferase: the amino acid residue which enhances the function of the enzyme-bound coenzyme pyridoxal 5'-phosphate
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
396
structure length
396
Chain Sequence
MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFAFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Role of Asp222 in the catalytic mechanism of Escherichia coli aspartate aminotransferase: the amino acid residue which enhances the function of the enzyme-bound coenzyme pyridoxal 5'-phosphate.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase(aminotransferase)
molecule keywords ASPARTATE AMINOTRANSFERASE
total genus 140
structure length 396
sequence length 396
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 1993-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1spaA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1spaA01
1H1CA 2OGEA 3A9XA 3NTJA 5J8QA 1C7NA 1QJ3A 2Z1YA 3BWNA 4RJYA 2CH2A 2VMWA 3M5UA 1YIZA 3A9YA 3E2YA 4M2MA 2BWNA 5G4JA 4E3QA 3E2FA 1JF9A 3MADA 1TATA 5E5IA 3AEPA 4J8LA 1AAMA 2ZSMA 3TCMA 2CANA 4WB0B 2YHKA 3LY1A 1FG7A 1ARIA 1XEYA 3FFHA 4A0RA 4R5ZA 4WLJA 1WYTA 3MBBA 3BCBA 1AHFA 1ASCA 3BN1A 4OYTA 1ORDA 4KYOA 2D64A 4E1OA 3MAUA 1TOEA 4F4EA 1OHYA 2AY3A 2W8TA 4H51A 4WYEA 1AICA 3ZRRA 1TOGA 4RITA 3RI6A 1WYTB 4OC9A 3HT4A 1TOKA 5M4DA 1LC5A 4F5JA 4PVFA 2V1PA 3I5TA 2HOXA 2WKAA 4XK1A 1O61A 2BWOA 1M6SA 2HUIA 2FM1A 2W8UA 1G7XA 1YOOA 1M4NA 3NX3A 4UHMA 4ZSWA 3ELEA 4ZM3A 1CL2A 3GZCA 2BI2A 3B1CA 1IX6A 1AJSA 3T32A 3QHXA 4A0GA 1AMAA 2D65A 4RKCA 4ISYA 1KKPA 4MSOA 1MAPA 1B9HA 1KL1A 4RM1A 3QBOA 3PD6A 4WYGA 2ZY4A 1M32A 2Z9XA 5G2PA 1OHWA 4F5FA 2OQXA 3JW9A 8AATA 3FQAA 1S07A 4PFFA 1G7WA 2ZP7A 2WK7A 2JISA 3N75A 4XQ2A 3WGBA 4AO4A 2HOZA 5EQCA 1IAXA 5AX8A 1AHEA 2EO5A 3AENA 3WGCA 2GSAA 1U08A 1GEXA 3R9AA 3NYTA 1DKAA 4B98A 4WXFA 4A6RA 2DGMA 5HHYA 2FNUA 4K2IA 2YOBA 2W7JA 3FKDA 2FN6A 4R2NA 2AY8A 2BYJA 4W1XA 5DJ1A 5BJ3A 3AEOA 2CY8A 1D7VA 4JEZA 4ZLVA 1AIBA 3EI5A 1WYUB 1M0PA 2CH1A 4OTLA 4RKDA 4ZDPA 4WYDA 3FZ8A 3KGWA 3TATA 2BIAA 3IHJA 4BHDA 3BCAA 1MAQA 1O62A 4MKJA 4A6TA 2HUFA 1BJNA 1YJSA 3CQ5A 3FDBA 3WCOA 3FDDA 3PA9A 2ZYJA 3ZZKA 3DODA 3KE3A 1OHVA 2JJFA 4AH3A 1Z3ZA 1LC8A 2VMYA 2VYCA 3H14A 3LV2A 2AY5A 2JJEA 1V2FA 2YCPA 2YRIA 2QLRA 2VLFA 4F5IA 1PG8A 4P7YA 2YKVA 2OGAA 3E2ZA 4WD2A 5EIGA 3VP6A 7AATA 2RFVA 1VEFA 3A2BA 4CVQA 2ZY5A 1GD9A 2CJGA 2E7UA 3NU8A 1M0QA 4N0WA 5DB5A 2X3LA 4JF0A 5FT4A 4UOYA 1S08A 1H0CA 1EQBA 4ZWVA 2HUUA 1ZC9A 3TQXA 2VMZA 5M46A 1X28A 2AY7A 4RLGA 1PFFA 3GBXA 4ZASA 3PDBA 1TARA 1ARGA 1ZODA 3FCRA 2O1BA 3FRKA 1CQ8A 2BIGA 1S0AA 1CZEA 3LVMA 4GE9A 3JWAA 4AOAA 1DGEA 4OCAA 4EB5A 5BJ4A 2JGTA 5G2QA 4GEBA 4WYAA 3DXVA 2BI5A 2BKWA 3PPLA 3AOVA 4UQVA 3QPGA 3OP7A 1AMRA 1IAYA 4W5KA 2AY4A 1W7MA 1I29A 1JS3A 2W8JA 4IYOA 1IBJA 1MGVA 1X0MA 2VMVA 5E4ZA 4GRXA 3ASBA 3AEJA 1BQAA 4EU1A 5E3KA 4OMAA 4WXBA 4Y0HA 4ZM4A 2ORDA 3I4JA 4MGRA 4JEWA 1E5FA 2VIAA 5EUDA 1IX8A 4XJLA 2YCNA 3BC8A 4A00A 2VI8A 1KKJA 2CJDA 3MEBA 2CTZA 4Q75A 3K7YA 3A9ZA 3CAIA 2PB2A 2QB3A 1AHYA 3AEMA 5LHAA 1GC0A 2PB0A 1G4VA 5JAYA 3GZDA 1D2FA 1GC2A 4A72A 2X8UA 3GETA 2OATA 1YNUA 3UAKA 2V0YA 2XBNA 2VMNA 4ZDOA 4K2MA 2R5EA 3L44A 2D61A 3FD0A 5HXXA 3FZ7A 1BW0A 3F6TA 1QGNA 1CZCA 2QBTA 3FVUA 1E5EA 1AHGA 2W7KA 1GBNA 2VGVA 2Z67A 4KAMA 1PMOA 3MAFA 1ELUA 1FG3A 2Z9UA 1AHXA 2FQ6A 3ASAA 5D95A 4F5GA 1GCKA 1S09A 1SVVA 1GC3A 2BYLA 3MC6C 4E77A 2X5DA 2HORA 2BIEA 4IYOB 5C6UA 1LC7A 3ECDA 3F9TA 5IWQA 2AEUA 2EGYA 2DGKA 3ATHA 1B5OA 1W7LA 1JS6A 2GB3A 3ELPA 4R5FA 3TFTA 1YJYA 2WK8A 3KGXA 1WSTA 2EZ1A 3EI7A 2O0RA 1IJIA 2W7EA 4M2KA 3I16A 4ITXA 3MC6A 1QISA 3G0TA 3F0HA 4MQRA 2E7JA 1D7UA 4FFCA 1WYVA 1GEWA 4JEXA 4XJMA 2W7LA 1X2AA 3NNKA 5TF5A 2X5FA 2ZJGA 1YAAA 4JEVA 1CJ0A 1KMKA 2R5CB 1BKGA 2YKXA 2Q7WA 1ASFA 2ZSLA 4OT8A 3A8UX 3DRDA 3PD6B 3EIBA 3PGYA 3ACZA 1PMMA 2JJHA 4IXZA 1LK9A 4LNJA 1MDOA 4ZWMA 3E2ZB 1MLZA 2R2NA 1OXPA 1DJUA 1FC4A 2F8JA 2D7ZA 3MAFB 3AEMC 4AZJA 4EMYA 1V72A 4PFNA 3DYDA 2VMSA 2W8VA 3VOMA 3RCHA 3WLXA 1N2TA 2VMTA 4O6ZA 3R4TA 1TOJA 3GR9A 3PJ0A 1SZKA 2D7YA 1B4XA 4IX8A 3RBFA 3B1EA 3IF2A 1AIAA 1ARSA 4WBTA 3HL2A 4RAEA 2C0RA 3BV0A 4GSAA 2QMAA 1ARTA 4XJPA 4ZDLA 3HLMA 2AEVA 1J32A 1VP4A 3QGUA 1UU1A 3CQ6A 2VGUA 3L8AA 3HQTA 3Q8NA 4WYFA 1I48A 1LW5A 1IX7A 2DGLA 1EG5A 2VMUA 9AATA 1SPAA 1O69A 4IY7A 3EZSA 1IVRA 1MLYA 4XEWA 2ZUKA 3LG0A 3WZFA 2VGSA 5I92A 3UWCA 1M0OA 2R0TA 3EI6A 2VMXA 1I43A 3NUBA 1ASNA 3B8XA 1AJRA 1WYVB 3FZ6A 3FQ8A 5EUEA 4AZKA 1WKHA 1J04A 1DFOA 2DR1A 2W8WA 2Z20A 3FVSA 3DZZA 1CS1A 1OXOA 4F5KA 2W7MA 4I8AA 2R5CA 5M4BA 2EH6A 1M7YA 1AMQA 3PAAA 4EB7A 4BA4A 4XAUA 3RBLA 3FVXA 1AY8A 2VMPA 1ASBA 4A6UA 4WLHA 1ELQA 1TASA 3CQ4A 3DR4A 4NOGA 2HP2A 3E6GA 3E9KA 3P1TA 2E54A 2JJGA 1VJOA 5G09A 3WCNA 1ARHA 2VGWA 1ASAA 2OKJA 3LVJA 4ATPA 3BS8A 4J5UA 4L0OA 3HDOA 4GDYA 4MY5A 4CBRA 1JG8A 4Q6RA 2YRRA 3WKSA 3USFA 4UHOA 1ZOBA 3JTXA 3AV7A 5EAVA 4AO9A 1BJ4A 3W1HA 1SFFA 4ADBA 1DJ9A 3HVYA 4LW2A 3ZRQA 2ZY2A 1SF2A 3D6KA 1BS0A 1EJIA 1AMSA 1ASLA 4JE5A 4WXGA 1XI9A 2YKUA 2HOYA 4OBVA 3OKSA 1B5PA 2QA3A 2XH1A 1DTYA 4UHNA 1C9CA 1KMJA 1C7GA 3EUCA 4BMKA 4Y0IA 2VGZA 4OBUA 1MDXA 2QB2A 1AY4A 1B9IA 1CQ7A 1RVYA 1Z7DA 3AATA 4CXRA 2VMOA 2D63A 4ATQA 2VIBA 2DKJA 5DJ9A 4MQPA 2BI1A 2D66A 1SZSA 1N8PA 3FQ7A 3VK3A 4DQ6A 4W91A 4F5LA 3NYSA 4CXQA 1T3IA 5FT8A 4U1TA 2WK9A 1QIRA 2CINA 1D7SA 2VMRA 3LVKA 4IXSA 3CBFA 3DC1A 4PIWA 2E7IA 1AKBA 1I41A 2BWPA 3G8MA 4Q31A 4ZSYA 2DOUA 1QZ9A 1M0NA 4WB0A 5HDMA 3WY7A 1ASEA 2GMUA 3QN6A 4Q76A 5LH9A 1QJ5A 2ZY3A 2VMQA 5EFSA 2Z1ZA 3G7QA 2BI9A 1V2DA 3NU7A 1GEYA 4A0HA 4F5MA 5M49A 3COGA 3PIUA 2VI9A 4A0FA 3B1DA 2C81A 5G0AA 1W3UA 2VLHA 3LWSA 2JG2A 1B8GA 3B46A 4RIZA 4HVKA 1BJOB 3RQ1A 3DR7A 4LW4A 2Z61A 1TPLA 5F9SA 3QM2A 2AY9A 4WP0A 2W7GA 4BQ0A 1CQ6A 1TOIA 3GWPA 3RUYA 1ASMA 4QGRA 1GDEA 2AY1A 2HP1A 1GC4A 2Z9WA 1BT4A 2D5YA 2HZPA 4ADCA 4W1VA 1MDZA 3BWNC 5K8BA 3EZ1A 4KXKA 4Y0DA 2W7HA 4F5HA 1BQDA 3DXWA 1P3WA 3LVLB 3ZRPA 4DBCA 1WYUA 3BCXA 1C0NA 4P3MA 1AY5A 1V2EA 1ASGA 3GJUA 5F8VA 4N0BA 3EIAA 3JWBA 1N31A 2BHXA 3VK2A 1AJSB 3TFUA 3RCHB 3VAXA 4TV7A 3FTBA 1S06A 1UKJA 4ZAHA 1AAWA 3JZLA 2EZ2A 5G4IA 1YIYA 3GZDC 2VGTA 4JEYA 2NMPA 2W7FA 1SZUA 3BB8A 5EUNA 3N0LA 2AY2A 4RJ0A 3EI8A 2YKYA 1X29A 3AENB 4IW7A 2AATA 3MKJA 3W1IA 5FT6A 3WX9A 4IXOA 4GE4A 4TMRA 5EIGB 4MQQA 1AX4A 3QI6A 4XJOA 2C7TA 2FNIA 4LNMA 2TPLA 1O4SA 3GSBA 2CFBA 3AEJC 3NYUA 2CB1A 4LC3A 1KL2A 4WYCA 2AY6A 5EAAA 3DU4A 1RV4A 1W23A 3PDXA 1YJZA 4R8DA 2W7IA 4ADEA 1D7RA 4LNLA 3KKIA 1LW4A 1ASDA 1LKCA 1OATA 3II0A 1C4KA 3JU7A 5D5SA 1Y4IA 3WKRA 1BJOA 4E3RA 1AKAA 2W7DA 2O7CA 3K40A 4JE5D 2Z9VA 3EI9A 1LS3A 2OKKA 3NDNA 2BI3A 3HBXA 5FT5A 4HF8A 3AOWA 2YCTA 4W1WA 2FYFA 4B9BA 1ECXA 1WKGA 3NUIA 4CBSA 4GE7A 1AKCA 1DJEA 4W8IA 4JF1A 1RVUA 2C44A 2GMSA 4FL0A 3W1JA 4TN4A 3NRAA 5DX5A 1W7NA 3E77A 1DGDA 3VK4A 3BWOA 4K2BA 3ZZJA 4EFFA 4U2HA 4DGTA 1UU2A 3H7FA 3ISLA 3FSLA 4BA5A 2CSTA 2PO3A 4M2JA 2CJHA 1BJWA 1IUGA 1C7OA 1G4XA 3K28A 3HMUA 2GQNA 3N5MA 3P6KA 3PDBB 1QITA 1RV3A 2EPJA 2G6WA 3FFRA 3AELA 2DKBA 4MKKA 4ADDA 1CL1A 1UU0A 3UE8A 4ITGA 2ZC0A
chains in the Genus database with same CATH superfamily
1H1CA 2OGEA 3A9XA 3NTJA 5J8QA 1C7NA 1QJ3A 2Z1YA 3BWNA 4RJYA 2CH2A 2VMWA 3M5UA 1YIZA 3A9YA 3E2YA 4M2MA 2BWNA 5G4JA 4E3QA 3E2FA 1JF9A 3MADA 1TATA 5E5IA 3AEPA 4J8LA 1AAMA 2ZSMA 3TCMA 2CANA 4WB0B 2YHKA 3LY1A 1FG7A 1ARIA 1XEYA 3FFHA 4A0RA 4R5ZA 4WLJA 1WYTA 3MBBA 3BCBA 1AHFA 1ASCA 3BN1A 4OYTA 1ORDA 4KYOA 2D64A 4E1OA 3MAUA 1TOEA 4F4EA 1OHYA 2AY3A 2W8TA 4H51A 4WYEA 1AICA 3ZRRA 1TOGA 4RITA 3RI6A 1WYTB 4OC9A 3HT4A 1TOKA 5M4DA 1LC5A 4F5JA 4PVFA 2V1PA 3I5TA 2HOXA 2WKAA 4XK1A 1O61A 2BWOA 1M6SA 2HUIA 2FM1A 2W8UA 1G7XA 1YOOA 1M4NA 3NX3A 4UHMA 4ZSWA 3ELEA 4ZM3A 1CL2A 3GZCA 2BI2A 3B1CA 1IX6A 1AJSA 3T32A 3QHXA 4A0GA 1AMAA 2D65A 4RKCA 4ISYA 1KKPA 4MSOA 1MAPA 1B9HA 1KL1A 4RM1A 3QBOA 3PD6A 4WYGA 2ZY4A 1M32A 2Z9XA 5G2PA 1OHWA 4F5FA 2OQXA 3JW9A 8AATA 3FQAA 1S07A 4PFFA 1G7WA 2ZP7A 2WK7A 2JISA 3N75A 4XQ2A 3WGBA 4AO4A 2HOZA 5EQCA 1IAXA 5AX8A 1AHEA 2EO5A 3AENA 3WGCA 2GSAA 1U08A 1GEXA 3R9AA 3NYTA 1DKAA 4B98A 4WXFA 4A6RA 2DGMA 5HHYA 2FNUA 4K2IA 2YOBA 2W7JA 3FKDA 2FN6A 4R2NA 2AY8A 2BYJA 4W1XA 5DJ1A 5BJ3A 3AEOA 2CY8A 1D7VA 4JEZA 4ZLVA 3N7NA 1AIBA 3EI5A 1WYUB 1M0PA 2CH1A 4OTLA 4RKDA 4ZDPA 4WYDA 3FZ8A 3KGWA 3TATA 2BIAA 3IHJA 4BHDA 3BCAA 1MAQA 1O62A 4MKJA 4A6TA 2HUFA 1BJNA 1YJSA 3CQ5A 3FDBA 3WCOA 3FDDA 3PA9A 2ZYJA 3ZZKA 3DODA 3KE3A 1OHVA 2JJFA 4AH3A 1Z3ZA 1LC8A 2VMYA 2VYCA 3H14A 3LV2A 2AY5A 2JJEA 1V2FA 2YCPA 2YRIA 2QLRA 2VLFA 4F5IA 1PG8A 2WB6A 4P7YA 2YKVA 2OGAA 3E2ZA 4WD2A 5EIGA 3VP6A 7AATA 2RFVA 1VEFA 3A2BA 4CVQA 2ZY5A 1GD9A 2CJGA 2E7UA 3NU8A 1M0QA 4N0WA 5DB5A 2X3LA 4JF0A 5FT4A 4UOYA 1S08A 1H0CA 1EQBA 4ZWVA 2HUUA 1ZC9A 3TQXA 2VMZA 5M46A 1X28A 2AY7A 4RLGA 1PFFA 3GBXA 4ZASA 3PDBA 1TARA 1ARGA 1ZODA 3FCRA 2O1BA 3FRKA 1CQ8A 2BIGA 1S0AA 1CZEA 3LVMA 4GE9A 3JWAA 4AOAA 1DGEA 4OCAA 4EB5A 5BJ4A 2JGTA 5G2QA 4GEBA 4WYAA 3DXVA 2BI5A 2BKWA 3PPLA 3AOVA 4UQVA 3N4RA 3QPGA 3OP7A 1AMRA 1IAYA 4W5KA 2AY4A 1W7MA 1I29A 1JS3A 2W8JA 4IYOA 1IBJA 1MGVA 1X0MA 2VMVA 5E4ZA 4GRXA 3ASBA 3AEJA 1BQAA 4EU1A 5E3KA 4OMAA 4WXBA 4Y0HA 4ZM4A 2ORDA 3I4JA 4MGRA 4JEWA 1E5FA 2QSRA 2VIAA 5EUDA 1IX8A 4XJLA 2YCNA 3BC8A 4A00A 2VI8A 1KKJA 2CJDA 3MEBA 2CTZA 4Q75A 3K7YA 3A9ZA 3CAIA 2PB2A 2QB3A 1AHYA 3AEMA 5LHAA 1GC0A 2PB0A 1G4VA 5JAYA 3GZDA 1D2FA 1GC2A 4A72A 2X8UA 3GETA 2OATA 1YNUA 3UAKA 2V0YA 2XBNA 2VMNA 4ZDOA 4K2MA 4H63Q 2R5EA 3L44A 2D61A 3FD0A 5HXXA 3FZ7A 1BW0A 3F6TA 1QGNA 1CZCA 2FKIA 2QBTA 3FVUA 1E5EA 1AHGA 2W7KA 1GBNA 2VGVA 2Z67A 4KAMA 1PMOA 3MAFA 1ELUA 1FG3A 2Z9UA 1AHXA 2FQ6A 3ASAA 5D95A 4F5GA 2G7JA 1GCKA 1S09A 1SVVA 1GC3A 2BYLA 3MC6C 4E77A 2X5DA 2HORA 2BIEA 4IYOB 5C6UA 1LC7A 3ECDA 3F9TA 5IWQA 2AEUA 2EGYA 2DGKA 3ATHA 1B5OA 1W7LA 1JS6A 2GB3A 3ELPA 4R5FA 3TFTA 1YJYA 2WK8A 3KGXA 1WSTA 2EZ1A 3EI7A 2O0RA 1IJIA 2W7EA 4M2KA 3I16A 4ITXA 3MC6A 1QISA 3G0TA 3F0HA 4MQRA 2E7JA 1D7UA 4FFCA 1WYVA 1GEWA 4JEXA 4XJMA 2W7LA 1X2AA 3NNKA 5TF5A 2X5FA 2ZJGA 1YAAA 4JEVA 1CJ0A 1KMKA 2R5CB 1BKGA 2YKXA 2Q7WA 1ASFA 2ZSLA 4OT8A 3A8UX 3DRDA 3PD6B 3EIBA 3PGYA 3ACZA 1PMMA 2JJHA 4IXZA 1LK9A 4LNJA 1MDOA 4ZWMA 3E2ZB 1MLZA 2R2NA 1OXPA 1DJUA 1FC4A 2F8JA 2D7ZA 3MAFB 3AEMC 4AZJA 4EMYA 1V72A 4PFNA 3DYDA 2VMSA 2W8VA 3VOMA 3RCHA 3WLXA 1N2TA 2VMTA 4O6ZA 3R4TA 1TOJA 3GR9A 3PJ0A 1SZKA 2D7YA 1B4XA 4IX8A 3RBFA 3B1EA 3IF2A 1AIAA 1ARSA 4WBTA 3HL2A 4RAEA 2C0RA 3BV0A 4GSAA 2QMAA 1ARTA 4XJPA 4ZDLA 3HLMA 2AEVA 1J32A 1VP4A 3QGUA 1UU1A 3CQ6A 2VGUA 3L8AA 3HQTA 3Q8NA 4WYFA 1I48A 1LW5A 1IX7A 2DGLA 3H9XA 1EG5A 2VMUA 9AATA 1SPAA 1O69A 4IY7A 3EZSA 1IVRA 1MLYA 4XEWA 2ZUKA 3LG0A 3WZFA 2VGSA 5I92A 3UWCA 1M0OA 2R0TA 3EI6A 2VMXA 1I43A 3NUBA 1ASNA 3B8XA 1AJRA 1WYVB 3FZ6A 3FQ8A 5EUEA 4AZKA 1WKHA 1J04A 1DFOA 2DR1A 2W8WA 2Z20A 3FVSA 3DZZA 1CS1A 1OXOA 4F5KA 2W7MA 4I8AA 2R5CA 5M4BA 2EH6A 1M7YA 1AMQA 3PAAA 4EB7A 4BA4A 4XAUA 3RBLA 3FVXA 1AY8A 2VMPA 1ASBA 4A6UA 4WLHA 1ELQA 1TASA 3CQ4A 3DR4A 4NOGA 2HP2A 3E6GA 3E9KA 3P1TA 2E54A 2JJGA 1VJOA 5G09A 3WCNA 1ARHA 2VGWA 1ASAA 2OKJA 3LVJA 4ATPA 3BS8A 4J5UA 4L0OA 3HDOA 4GDYA 4MY5A 4CBRA 1JG8A 4Q6RA 2YRRA 3WKSA 3USFA 4UHOA 1ZOBA 3JTXA 3AV7A 5EAVA 4AO9A 1BJ4A 3W1HA 1SFFA 4ADBA 1DJ9A 3HVYA 4LW2A 3ZRQA 2ZY2A 1SF2A 3D6KA 1BS0A 1EJIA 1AMSA 1ASLA 4JE5A 4WXGA 1XI9A 2YKUA 2HOYA 4OBVA 3OKSA 1B5PA 2QA3A 2XH1A 1DTYA 4UHNA 1C9CA 1KMJA 1C7GA 3EUCA 4BMKA 4Y0IA 2VGZA 4OBUA 1MDXA 2QB2A 1AY4A 1B9IA 1CQ7A 1RVYA 1Z7DA 3AATA 4CXRA 2VMOA 2D63A 4ATQA 2VIBA 2DKJA 5DJ9A 4MQPA 5KTBA 2BI1A 2D66A 1SZSA 1N8PA 3FQ7A 3VK3A 4DQ6A 4W91A 4F5LA 3NYSA 4CXQA 1T3IA 5FT8A 4U1TA 2EYQA 2WK9A 1QIRA 2CINA 1D7SA 2VMRA 3LVKA 4IXSA 3CBFA 3DC1A 4PIWA 2E7IA 1AKBA 1I41A 2BWPA 3G8MA 4Q31A 4ZSYA 2DOUA 1QZ9A 1M0NA 4WB0A 5HDMA 3WY7A 1ASEA 3N4XA 2GMUA 3QN6A 4Q76A 5LH9A 1QJ5A 2ZY3A 2VMQA 5EFSA 2Z1ZA 3G7QA 2BI9A 1V2DA 3NU7A 1GEYA 4A0HA 4F5MA 5M49A 3COGA 3PIUA 2VI9A 4A0FA 3B1DA 2C81A 5G0AA 1W3UA 2VLHA 3LWSA 2JG2A 1B8GA 3B46A 4RIZA 4HVKA 1BJOB 3RQ1A 3DR7A 4LW4A 2Z61A 1TPLA 5F9SA 3QM2A 2AY9A 4WP0A 2W7GA 4BQ0A 1CQ6A 1TOIA 3GWPA 3RUYA 1ASMA 4QGRA 1GDEA 2AY1A 2HP1A 1GC4A 2Z9WA 1BT4A 2D5YA 2HZPA 4ADCA 4W1VA 1MDZA 3BWNC 5K8BA 3EZ1A 4KXKA 4Y0DA 2W7HA 4F5HA 1BQDA 3DXWA 1P3WA 3LVLB 3ZRPA 4DBCA 1WYUA 3BCXA 1C0NA 4P3MA 2A1VA 1AY5A 1V2EA 1ASGA 3GJUA 5F8VA 4N0BA 3EIAA 3JWBA 1N31A 1KAFA 2KFPA 2BHXA 3VK2A 1AJSB 3TFUA 3RCHB 3VAXA 4TV7A 3FTBA 1S06A 1UKJA 4ZAHA 3N4SA 1AAWA 3JZLA 2EZ2A 5G4IA 1YIYA 3GZDC 2VGTA 4JEYA 2NMPA 2W7FA 1SZUA 3BB8A 5EUNA 3N0LA 2AY2A 4RJ0A 3EI8A 2YKYA 1X29A 3AENB 4IW7A 2AATA 3MKJA 3W1IA 5FT6A 3WX9A 4IXOA 4GE4A 4TMRA 5EIGB 4MQQA 1AX4A 3QI6A 4XJOA 2C7TA 2FNIA 4LNMA 2TPLA 1O4SA 3GSBA 2CFBA 3AEJC 4K05A 3NYUA 2CB1A 4LC3A 1KL2A 4WYCA 2AY6A 5EAAA 3DU4A 1RV4A 1W23A 3PDXA 1YJZA 4R8DA 2W7IA 4ADEA 1D7RA 4LNLA 3KKIA 1LW4A 1ASDA 1LKCA 1OATA 3II0A 1C4KA 3JU7A 5D5SA 1Y4IA 3WKRA 1BJOA 4E3RA 1AKAA 2W7DA 2O7CA 3K40A 4JE5D 2Z9VA 3EI9A 1LS3A 2OKKA 3NDNA 2BI3A 3HBXA 5FT5A 4HF8A 3AOWA 2YCTA 4W1WA 2FYFA 4B9BA 1ECXA 1WKGA 3NUIA 4CBSA 4GE7A 1AKCA 1DJEA 4W8IA 4JF1A 1RVUA 2C44A 2GMSA 4FL0A 3W1JA 4TN4A 3NRAA 5DX5A 1W7NA 3E77A 1DGDA 3VK4A 3BWOA 4K2BA 3ZZJA 4EFFA 4U2HA 4DGTA 1UU2A 3H7FA 3ISLA 3FSLA 4BA5A 2CSTA 2PO3A 4M2JA 2CJHA 1BJWA 1IUGA 1C7OA 1G4XA 3K28A 3HMUA 2GQNA 3N5MA 3P6KA 3PDBB 1QITA 1RV3A 2EPJA 2G6WA 3FFRA 3AELA 2DKBA 4MKKA 4ADDA 1CL1A 1UU0A 3UE8A 4ITGA 2ZC0A
chains in the Genus database with same CATH topology
1H1CA 2OGEA 3A9XA 3NTJA 5J8QA 1C7NA 1QJ3A 2Z1YA 3BWNA 4RJYA 2CH2A 2VMWA 3M5UA 1YIZA 3A9YA 3E2YA 4M2MA 2BWNA 5G4JA 4E3QA 3E2FA 1JF9A 3MADA 1TATA 5E5IA 3AEPA 4J8LA 1AAMA 2ZSMA 3TCMA 2CANA 4WB0B 2YHKA 3LY1A 1FG7A 1ARIA 1XEYA 3FFHA 4A0RA 4R5ZA 4WLJA 1WYTA 3MBBA 3BCBA 1AHFA 1ASCA 3BN1A 4OYTA 1ORDA 4KYOA 2D64A 4E1OA 3MAUA 1TOEA 4F4EA 1OHYA 2AY3A 2W8TA 4H51A 4WYEA 1AICA 3ZRRA 1TOGA 4RITA 3RI6A 1WYTB 4OC9A 3HT4A 1TOKA 5M4DA 1LC5A 4F5JA 4PVFA 2V1PA 3I5TA 2HOXA 2WKAA 4XK1A 1O61A 2BWOA 1M6SA 2HUIA 2FM1A 2W8UA 1G7XA 1YOOA 1M4NA 3NX3A 4UHMA 4ZSWA 3ELEA 4ZM3A 1CL2A 3GZCA 2BI2A 3B1CA 1IX6A 1AJSA 3T32A 3QHXA 4A0GA 1AMAA 2D65A 4RKCA 4ISYA 1KKPA 4MSOA 1MAPA 1B9HA 1KL1A 4RM1A 3QBOA 3PD6A 4WYGA 2ZY4A 1M32A 2Z9XA 5G2PA 1OHWA 4F5FA 2OQXA 3JW9A 8AATA 3FQAA 1S07A 4PFFA 1G7WA 2ZP7A 2WK7A 2JISA 3N75A 4XQ2A 3WGBA 4AO4A 2HOZA 5EQCA 1IAXA 5AX8A 1AHEA 2EO5A 3AENA 3WGCA 2GSAA 1U08A 1GEXA 3R9AA 3NYTA 1DKAA 4B98A 4WXFA 4A6RA 2DGMA 5HHYA 2FNUA 4K2IA 2YOBA 2W7JA 3FKDA 2FN6A 4R2NA 2AY8A 2BYJA 4W1XA 5DJ1A 5BJ3A 3AEOA 2CY8A 1D7VA 4JEZA 4ZLVA 3N7NA 1AIBA 3EI5A 1WYUB 1M0PA 2CH1A 4OTLA 4RKDA 4ZDPA 4WYDA 3FZ8A 3KGWA 3TATA 2BIAA 3IHJA 4BHDA 3BCAA 1MAQA 1O62A 4MKJA 4A6TA 2HUFA 1BJNA 1YJSA 3CQ5A 3FDBA 3WCOA 3FDDA 3PA9A 2ZYJA 3ZZKA 3DODA 3KE3A 1OHVA 2JJFA 4AH3A 1Z3ZA 1LC8A 2VMYA 2VYCA 3H14A 3LV2A 2AY5A 2JJEA 1V2FA 2YCPA 2YRIA 2QLRA 2VLFA 4F5IA 1PG8A 2WB6A 4P7YA 2YKVA 2OGAA 3E2ZA 4WD2A 5EIGA 3VP6A 7AATA 2RFVA 1VEFA 3A2BA 4CVQA 2ZY5A 1GD9A 2CJGA 2E7UA 3NU8A 1M0QA 4N0WA 5DB5A 2X3LA 4JF0A 5FT4A 4UOYA 1S08A 1H0CA 1EQBA 4ZWVA 2HUUA 1ZC9A 3TQXA 2VMZA 5M46A 1X28A 2AY7A 4RLGA 1PFFA 3GBXA 4ZASA 3PDBA 1TARA 1ARGA 1ZODA 3FCRA 2O1BA 3FRKA 1CQ8A 2BIGA 1S0AA 1CZEA 3LVMA 4GE9A 3JWAA 4AOAA 1DGEA 4OCAA 4EB5A 5BJ4A 2JGTA 5G2QA 4GEBA 4WYAA 3DXVA 2BI5A 2BKWA 3PPLA 3AOVA 4UQVA 3N4RA 3QPGA 3OP7A 1AMRA 1IAYA 4W5KA 2AY4A 1W7MA 1I29A 1JS3A 2W8JA 4IYOA 1IBJA 1MGVA 1X0MA 2VMVA 5E4ZA 4GRXA 3ASBA 3AEJA 1BQAA 4EU1A 5E3KA 4OMAA 4WXBA 4Y0HA 4ZM4A 2ORDA 3I4JA 4MGRA 4JEWA 1E5FA 2QSRA 2VIAA 5EUDA 1IX8A 4XJLA 2YCNA 3BC8A 4A00A 2VI8A 1KKJA 2CJDA 3MEBA 2CTZA 4Q75A 3K7YA 3A9ZA 3CAIA 2PB2A 2QB3A 1AHYA 3AEMA 5LHAA 1GC0A 2PB0A 1G4VA 5JAYA 3GZDA 1D2FA 1GC2A 4A72A 2X8UA 3GETA 2OATA 1YNUA 3UAKA 2V0YA 2XBNA 2VMNA 4ZDOA 4K2MA 4H63Q 2R5EA 3L44A 2D61A 3FD0A 5HXXA 3FZ7A 1BW0A 3F6TA 1QGNA 1CZCA 2FKIA 2QBTA 3FVUA 1E5EA 1AHGA 2W7KA 1GBNA 2VGVA 2Z67A 4KAMA 1PMOA 3MAFA 1ELUA 1FG3A 2Z9UA 1AHXA 2FQ6A 3ASAA 5D95A 4F5GA 2G7JA 1GCKA 1S09A 1SVVA 1GC3A 2BYLA 3MC6C 4E77A 2X5DA 2HORA 2BIEA 4IYOB 5C6UA 1LC7A 3ECDA 3F9TA 5IWQA 2AEUA 2EGYA 2DGKA 3ATHA 1B5OA 1W7LA 1JS6A 2GB3A 3ELPA 4R5FA 3TFTA 1YJYA 2WK8A 3KGXA 1WSTA 2EZ1A 3EI7A 2O0RA 1IJIA 2W7EA 4M2KA 3I16A 4ITXA 3MC6A 1QISA 3G0TA 3F0HA 4MQRA 2E7JA 1D7UA 4FFCA 1WYVA 1GEWA 4JEXA 4XJMA 2W7LA 1X2AA 3NNKA 5TF5A 2X5FA 2ZJGA 1YAAA 4JEVA 1CJ0A 1KMKA 2R5CB 1BKGA 2YKXA 2Q7WA 1ASFA 2ZSLA 4OT8A 3A8UX 3DRDA 3PD6B 3EIBA 3PGYA 3ACZA 1PMMA 2JJHA 4IXZA 1LK9A 4LNJA 1MDOA 4ZWMA 3E2ZB 1MLZA 2R2NA 1OXPA 1DJUA 1FC4A 2F8JA 2D7ZA 3MAFB 3AEMC 4AZJA 4EMYA 1V72A 4PFNA 3DYDA 2VMSA 2W8VA 3VOMA 3RCHA 3WLXA 1N2TA 2VMTA 4O6ZA 3R4TA 1TOJA 3GR9A 3PJ0A 1SZKA 2D7YA 1B4XA 4IX8A 3RBFA 3B1EA 3IF2A 1AIAA 1ARSA 4WBTA 3HL2A 4RAEA 2C0RA 3BV0A 4GSAA 2QMAA 1ARTA 4XJPA 4ZDLA 3HLMA 2AEVA 1J32A 1VP4A 3QGUA 1UU1A 3CQ6A 2VGUA 3L8AA 3HQTA 3Q8NA 4WYFA 1I48A 1LW5A 1IX7A 2DGLA 3H9XA 1EG5A 2VMUA 9AATA 1SPAA 1O69A 4IY7A 3EZSA 1IVRA 1MLYA 4XEWA 2ZUKA 3LG0A 3WZFA 2VGSA 5I92A 3UWCA 1M0OA 2R0TA 3EI6A 2VMXA 1I43A 3NUBA 1ASNA 3B8XA 1AJRA 1WYVB 3FZ6A 3FQ8A 5EUEA 4AZKA 1WKHA 1J04A 1DFOA 2DR1A 2W8WA 2Z20A 3FVSA 3DZZA 1CS1A 1OXOA 4F5KA 2W7MA 4I8AA 2R5CA 5M4BA 2EH6A 1M7YA 1AMQA 3PAAA 4EB7A 4BA4A 4XAUA 3RBLA 3FVXA 1AY8A 2VMPA 1ASBA 4A6UA 4WLHA 1ELQA 1TASA 3CQ4A 3DR4A 4NOGA 2HP2A 3E6GA 3E9KA 3P1TA 2E54A 2JJGA 1VJOA 5G09A 3WCNA 1ARHA 2VGWA 1ASAA 2OKJA 3LVJA 4ATPA 3BS8A 4J5UA 4L0OA 3HDOA 4GDYA 4MY5A 4CBRA 1JG8A 4Q6RA 2YRRA 3WKSA 3USFA 4UHOA 1ZOBA 3JTXA 3AV7A 5EAVA 4AO9A 1BJ4A 3W1HA 1SFFA 4ADBA 1DJ9A 3HVYA 4LW2A 3ZRQA 2ZY2A 1SF2A 3D6KA 1BS0A 1EJIA 1AMSA 1ASLA 4JE5A 4WXGA 1XI9A 2YKUA 2HOYA 4OBVA 3OKSA 1B5PA 2QA3A 2XH1A 1DTYA 4UHNA 1C9CA 1KMJA 1C7GA 3EUCA 4BMKA 4Y0IA 2VGZA 4OBUA 1MDXA 2QB2A 1AY4A 1B9IA 1CQ7A 1RVYA 1Z7DA 3AATA 4CXRA 2VMOA 2D63A 4ATQA 2VIBA 2DKJA 5DJ9A 4MQPA 5KTBA 2BI1A 2D66A 1SZSA 1N8PA 3FQ7A 3VK3A 4DQ6A 4W91A 4F5LA 3NYSA 4CXQA 1T3IA 5FT8A 4U1TA 2EYQA 2WK9A 1QIRA 2CINA 1D7SA 2VMRA 3LVKA 4IXSA 3CBFA 3DC1A 4PIWA 2E7IA 1AKBA 1I41A 2BWPA 3G8MA 4Q31A 4ZSYA 2DOUA 1QZ9A 1M0NA 4WB0A 5HDMA 3WY7A 1ASEA 3N4XA 2GMUA 3QN6A 4Q76A 5LH9A 1QJ5A 2ZY3A 2VMQA 5EFSA 2Z1ZA 3G7QA 2BI9A 1V2DA 3NU7A 1GEYA 4A0HA 4F5MA 5M49A 3COGA 3PIUA 2VI9A 4A0FA 3B1DA 2C81A 5G0AA 1W3UA 2VLHA 3LWSA 2JG2A 1B8GA 3B46A 4RIZA 4HVKA 1BJOB 3RQ1A 3DR7A 4LW4A 2Z61A 1TPLA 5F9SA 3QM2A 2AY9A 4WP0A 2W7GA 4BQ0A 1CQ6A 1TOIA 3GWPA 3RUYA 1ASMA 4QGRA 1GDEA 2AY1A 2HP1A 1GC4A 2Z9WA 1BT4A 2D5YA 2HZPA 4ADCA 4W1VA 1MDZA 3BWNC 5K8BA 3EZ1A 4KXKA 4Y0DA 2W7HA 4F5HA 1BQDA 3DXWA 1P3WA 3LVLB 3ZRPA 4DBCA 1WYUA 3BCXA 1C0NA 4P3MA 2A1VA 1AY5A 1V2EA 1ASGA 3GJUA 5F8VA 4N0BA 3EIAA 3JWBA 1N31A 2KFPA 2BHXA 3VK2A 1AJSB 3TFUA 3RCHB 3VAXA 4TV7A 3FTBA 1S06A 1UKJA 4ZAHA 3N4SA 1AAWA 3JZLA 2EZ2A 5G4IA 1YIYA 3GZDC 2VGTA 4JEYA 2NMPA 2W7FA 1SZUA 3BB8A 5EUNA 3N0LA 2AY2A 4RJ0A 3EI8A 2YKYA 1X29A 3AENB 4IW7A 2AATA 3MKJA 3W1IA 5FT6A 3WX9A 4IXOA 4GE4A 4TMRA 5EIGB 4MQQA 1AX4A 3QI6A 4XJOA 2C7TA 2FNIA 4LNMA 2TPLA 1O4SA 3GSBA 2CFBA 3AEJC 4K05A 3NYUA 2CB1A 4LC3A 1KL2A 4WYCA 2AY6A 5EAAA 3DU4A 1RV4A 1W23A 3PDXA 1YJZA 4R8DA 2W7IA 4ADEA 1D7RA 4LNLA 3KKIA 1LW4A 1ASDA 1LKCA 1OATA 3II0A 1C4KA 3JU7A 5D5SA 1Y4IA 3WKRA 1BJOA 4E3RA 1AKAA 2W7DA 2O7CA 3K40A 4JE5D 2Z9VA 3EI9A 1LS3A 2OKKA 3NDNA 2BI3A 3HBXA 5FT5A 4HF8A 3AOWA 2YCTA 4W1WA 2FYFA 4B9BA 1ECXA 1WKGA 3NUIA 4CBSA 4GE7A 1AKCA 1DJEA 4W8IA 4JF1A 1RVUA 2C44A 2GMSA 4FL0A 3W1JA 4TN4A 3NRAA 5DX5A 1W7NA 3E77A 1DGDA 3VK4A 3BWOA 4K2BA 3ZZJA 4EFFA 4U2HA 4DGTA 1UU2A 3H7FA 3ISLA 3FSLA 4BA5A 2CSTA 2PO3A 4M2JA 2CJHA 1BJWA 1IUGA 1C7OA 1G4XA 3K28A 3HMUA 2GQNA 3N5MA 3P6KA 3PDBB 1QITA 1RV3A 2EPJA 2G6WA 3FFRA 3AELA 2DKBA 4MKKA 4ADDA 1CL1A 1UU0A 3UE8A 4ITGA 2ZC0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H1C A;  2OGE A;  3A9X A;  3NTJ A;  5J8Q A;  1C7N A;  1QJ3 A;  2Z1Y A;  3BWN A;  4RJY A;  2CH2 A;  2VMW A;  3M5U A;  1YIZ A;  3A9Y A;  3E2Y A;  4M2M A;  2BWN A;  5G4J A;  4E3Q A;  3E2F A;  1JF9 A;  3MAD A;  1TAT A;  5E5I A;  3AEP A;  4J8L A;  1AAM A;  2ZSM A;  3TCM A;  2CAN A;  4WB0 B;  2YHK A;  3LY1 A;  1FG7 A;  1ARI A;  1XEY A;  3FFH A;  4A0R A;  4R5Z A;  4WLJ A;  1WYT A;  3MBB A;  3BCB A;  1AHF A;  1ASC A;  3BN1 A;  4OYT A;  1ORD A;  4KYO A;  2D64 A;  4E1O A;  3MAU A;  1TOE A;  4F4E A;  1OHY A;  2AY3 A;  2W8T A;  4H51 A;  4WYE A;  1AIC A;  3ZRR A;  1TOG A;  4RIT A;  3RI6 A;  1WYT B;  4OC9 A;  3HT4 A;  1TOK A;  5M4D A;  1LC5 A;  4F5J A;  4PVF A;  2V1P A;  3I5T A;  2HOX A;  2WKA A;  4XK1 A;  1O61 A;  2BWO A;  1M6S A;  2HUI A;  2FM1 A;  2W8U A;  1G7X A;  1YOO A;  1M4N A;  3NX3 A;  4UHM A;  4ZSW A;  3ELE A;  4ZM3 A;  1CL2 A;  3GZC A;  2BI2 A;  3B1C A;  1IX6 A;  1AJS A;  3T32 A;  3QHX A;  4A0G A;  1AMA A;  2D65 A;  4RKC A;  4ISY A;  1KKP A;  4MSO A;  1MAP A;  1B9H A;  1KL1 A;  4RM1 A;  3QBO A;  3PD6 A;  4WYG A;  2ZY4 A;  1M32 A;  2Z9X A;  5G2P A;  1OHW A;  4F5F A;  2OQX A;  3JW9 A;  8AAT A;  3FQA A;  1S07 A;  4PFF A;  1G7W A;  2ZP7 A;  2WK7 A;  2JIS A;  3N75 A;  4XQ2 A;  3WGB A;  4AO4 A;  2HOZ A;  5EQC A;  1IAX A;  5AX8 A;  1AHE A;  2EO5 A;  3AEN A;  3WGC A;  2GSA A;  1U08 A;  1GEX A;  3R9A A;  3NYT A;  1DKA A;  4B98 A;  4WXF A;  4A6R A;  2DGM A;  5HHY A;  2FNU A;  4K2I A;  2YOB A;  2W7J A;  3FKD A;  2FN6 A;  4R2N A;  2AY8 A;  2BYJ A;  4W1X A;  5DJ1 A;  5BJ3 A;  3AEO A;  2CY8 A;  1D7V A;  4JEZ A;  4ZLV A;  1AIB A;  3EI5 A;  1WYU B;  1M0P A;  2CH1 A;  4OTL A;  4RKD A;  4ZDP A;  4WYD A;  3FZ8 A;  3KGW A;  3TAT A;  2BIA A;  3IHJ A;  4BHD A;  3BCA A;  1MAQ A;  1O62 A;  4MKJ A;  4A6T A;  2HUF A;  1BJN A;  1YJS A;  3CQ5 A;  3FDB A;  3WCO A;  3FDD A;  3PA9 A;  2ZYJ A;  3ZZK A;  3DOD A;  3KE3 A;  1OHV A;  2JJF A;  4AH3 A;  1Z3Z A;  1LC8 A;  2VMY A;  2VYC A;  3H14 A;  3LV2 A;  2AY5 A;  2JJE A;  1V2F A;  2YCP A;  2YRI A;  2QLR A;  2VLF A;  4F5I A;  1PG8 A;  4P7Y A;  2YKV A;  2OGA A;  3E2Z A;  4WD2 A;  5EIG A;  3VP6 A;  7AAT A;  2RFV A;  1VEF A;  3A2B A;  4CVQ A;  2ZY5 A;  1GD9 A;  2CJG A;  2E7U A;  3NU8 A;  1M0Q A;  4N0W A;  5DB5 A;  2X3L A;  4JF0 A;  5FT4 A;  4UOY A;  1S08 A;  1H0C A;  1EQB A;  4ZWV A;  2HUU A;  1ZC9 A;  3TQX A;  2VMZ A;  5M46 A;  1X28 A;  2AY7 A;  4RLG A;  1PFF A;  3GBX A;  4ZAS A;  3PDB A;  1TAR A;  1ARG A;  1ZOD A;  3FCR A;  2O1B A;  3FRK A;  1CQ8 A;  2BIG A;  1S0A A;  1CZE A;  3LVM A;  4GE9 A;  3JWA A;  4AOA A;  1DGE A;  4OCA A;  4EB5 A;  5BJ4 A;  2JGT A;  5G2Q A;  4GEB A;  4WYA A;  3DXV A;  2BI5 A;  2BKW A;  3PPL A;  3AOV A;  4UQV A;  3QPG A;  3OP7 A;  1AMR A;  1IAY A;  4W5K A;  2AY4 A;  1W7M A;  1I29 A;  1JS3 A;  2W8J A;  4IYO A;  1IBJ A;  1MGV A;  1X0M A;  2VMV A;  5E4Z A;  4GRX A;  3ASB A;  3AEJ A;  1BQA A;  4EU1 A;  5E3K A;  4OMA A;  4WXB A;  4Y0H A;  4ZM4 A;  2ORD A;  3I4J A;  4MGR A;  4JEW A;  1E5F A;  2VIA A;  5EUD A;  1IX8 A;  4XJL A;  2YCN A;  3BC8 A;  4A00 A;  2VI8 A;  1KKJ A;  2CJD A;  3MEB A;  2CTZ A;  4Q75 A;  3K7Y A;  3A9Z A;  3CAI A;  2PB2 A;  2QB3 A;  1AHY A;  3AEM A;  5LHA A;  1GC0 A;  2PB0 A;  1G4V A;  5JAY A;  3GZD A;  1D2F A;  1GC2 A;  4A72 A;  2X8U A;  3GET A;  2OAT A;  1YNU A;  3UAK A;  2V0Y A;  2XBN A;  2VMN A;  4ZDO A;  4K2M A;  2R5E A;  3L44 A;  2D61 A;  3FD0 A;  5HXX A;  3FZ7 A;  1BW0 A;  3F6T A;  1QGN A;  1CZC A;  2QBT A;  3FVU A;  1E5E A;  1AHG A;  2W7K A;  1GBN A;  2VGV A;  2Z67 A;  4KAM A;  1PMO A;  3MAF A;  1ELU A;  1FG3 A;  2Z9U A;  1AHX A;  2FQ6 A;  3ASA A;  5D95 A;  4F5G A;  1GCK A;  1S09 A;  1SVV A;  1GC3 A;  2BYL A;  3MC6 C;  4E77 A;  2X5D A;  2HOR A;  2BIE A;  4IYO B;  5C6U A;  1LC7 A;  3ECD A;  3F9T A;  5IWQ A;  2AEU A;  2EGY A;  2DGK A;  3ATH A;  1B5O A;  1W7L A;  1JS6 A;  2GB3 A;  3ELP A;  4R5F A;  3TFT A;  1YJY A;  2WK8 A;  3KGX A;  1WST A;  2EZ1 A;  3EI7 A;  2O0R A;  1IJI A;  2W7E A;  4M2K A;  3I16 A;  4ITX A;  3MC6 A;  1QIS A;  3G0T A;  3F0H A;  4MQR A;  2E7J A;  1D7U A;  4FFC A;  1WYV A;  1GEW A;  4JEX A;  4XJM A;  2W7L A;  1X2A A;  3NNK A;  5TF5 A;  2X5F A;  2ZJG A;  1YAA A;  4JEV A;  1CJ0 A;  1KMK A;  2R5C B;  1BKG A;  2YKX A;  2Q7W A;  1ASF A;  2ZSL A;  4OT8 A;  3A8U X;  3DRD A;  3PD6 B;  3EIB A;  3PGY A;  3ACZ A;  1PMM A;  2JJH A;  4IXZ A;  1LK9 A;  4LNJ A;  1MDO A;  4ZWM A;  3E2Z B;  1MLZ A;  2R2N A;  1OXP A;  1DJU A;  1FC4 A;  2F8J A;  2D7Z A;  3MAF B;  3AEM C;  4AZJ A;  4EMY A;  1V72 A;  4PFN A;  3DYD A;  2VMS A;  2W8V A;  3VOM A;  3RCH A;  3WLX A;  1N2T A;  2VMT A;  4O6Z A;  3R4T A;  1TOJ A;  3GR9 A;  3PJ0 A;  1SZK A;  2D7Y A;  1B4X A;  4IX8 A;  3RBF A;  3B1E A;  3IF2 A;  1AIA A;  1ARS A;  4WBT A;  3HL2 A;  4RAE A;  2C0R A;  3BV0 A;  4GSA A;  2QMA A;  1ART A;  4XJP A;  4ZDL A;  3HLM A;  2AEV A;  1J32 A;  1VP4 A;  3QGU A;  1UU1 A;  3CQ6 A;  2VGU A;  3L8A A;  3HQT A;  3Q8N A;  4WYF A;  1I48 A;  1LW5 A;  1IX7 A;  2DGL A;  1EG5 A;  2VMU A;  9AAT A;  1SPA A;  1O69 A;  4IY7 A;  3EZS A;  1IVR A;  1MLY A;  4XEW A;  2ZUK A;  3LG0 A;  3WZF A;  2VGS A;  5I92 A;  3UWC A;  1M0O A;  2R0T A;  3EI6 A;  2VMX A;  1I43 A;  3NUB A;  1ASN A;  3B8X A;  1AJR A;  1WYV B;  3FZ6 A;  3FQ8 A;  5EUE A;  4AZK A;  1WKH A;  1J04 A;  1DFO A;  2DR1 A;  2W8W A;  2Z20 A;  3FVS A;  3DZZ A;  1CS1 A;  1OXO A;  4F5K A;  2W7M A;  4I8A A;  2R5C A;  5M4B A;  2EH6 A;  1M7Y A;  1AMQ A;  3PAA A;  4EB7 A;  4BA4 A;  4XAU A;  3RBL A;  3FVX A;  1AY8 A;  2VMP A;  1ASB A;  4A6U A;  4WLH A;  1ELQ A;  1TAS A;  3CQ4 A;  3DR4 A;  4NOG A;  2HP2 A;  3E6G A;  3E9K A;  3P1T A;  2E54 A;  2JJG A;  1VJO A;  5G09 A;  3WCN A;  1ARH A;  2VGW A;  1ASA A;  2OKJ A;  3LVJ A;  4ATP A;  3BS8 A;  4J5U A;  4L0O A;  3HDO A;  4GDY A;  4MY5 A;  4CBR A;  1JG8 A;  4Q6R A;  2YRR A;  3WKS A;  3USF A;  4UHO A;  1ZOB A;  3JTX A;  3AV7 A;  5EAV A;  4AO9 A;  1BJ4 A;  3W1H A;  1SFF A;  4ADB A;  1DJ9 A;  3HVY A;  4LW2 A;  3ZRQ A;  2ZY2 A;  1SF2 A;  3D6K A;  1BS0 A;  1EJI A;  1AMS A;  1ASL A;  4JE5 A;  4WXG A;  1XI9 A;  2YKU A;  2HOY A;  4OBV A;  3OKS A;  1B5P A;  2QA3 A;  2XH1 A;  1DTY A;  4UHN A;  1C9C A;  1KMJ A;  1C7G A;  3EUC A;  4BMK A;  4Y0I A;  2VGZ A;  4OBU A;  1MDX A;  2QB2 A;  1AY4 A;  1B9I A;  1CQ7 A;  1RVY A;  1Z7D A;  3AAT A;  4CXR A;  2VMO A;  2D63 A;  4ATQ A;  2VIB A;  2DKJ A;  5DJ9 A;  4MQP A;  2BI1 A;  2D66 A;  1SZS A;  1N8P A;  3FQ7 A;  3VK3 A;  4DQ6 A;  4W91 A;  4F5L A;  3NYS A;  4CXQ A;  1T3I A;  5FT8 A;  4U1T A;  2WK9 A;  1QIR A;  2CIN A;  1D7S A;  2VMR A;  3LVK A;  4IXS A;  3CBF A;  3DC1 A;  4PIW A;  2E7I A;  1AKB A;  1I41 A;  2BWP A;  3G8M A;  4Q31 A;  4ZSY A;  2DOU A;  1QZ9 A;  1M0N A;  4WB0 A;  5HDM A;  3WY7 A;  1ASE A;  2GMU A;  3QN6 A;  4Q76 A;  5LH9 A;  1QJ5 A;  2ZY3 A;  2VMQ A;  5EFS A;  2Z1Z A;  3G7Q A;  2BI9 A;  1V2D A;  3NU7 A;  1GEY A;  4A0H A;  4F5M A;  5M49 A;  3COG A;  3PIU A;  2VI9 A;  4A0F A;  3B1D A;  2C81 A;  5G0A A;  1W3U A;  2VLH A;  3LWS A;  2JG2 A;  1B8G A;  3B46 A;  4RIZ A;  4HVK A;  1BJO B;  3RQ1 A;  3DR7 A;  4LW4 A;  2Z61 A;  1TPL A;  5F9S A;  3QM2 A;  2AY9 A;  4WP0 A;  2W7G A;  4BQ0 A;  1CQ6 A;  1TOI A;  3GWP A;  3RUY A;  1ASM A;  4QGR A;  1GDE A;  2AY1 A;  2HP1 A;  1GC4 A;  2Z9W A;  1BT4 A;  2D5Y A;  2HZP A;  4ADC A;  4W1V A;  1MDZ A;  3BWN C;  5K8B A;  3EZ1 A;  4KXK A;  4Y0D A;  2W7H A;  4F5H A;  1BQD A;  3DXW A;  1P3W A;  3LVL B;  3ZRP A;  4DBC A;  1WYU A;  3BCX A;  1C0N A;  4P3M A;  1AY5 A;  1V2E A;  1ASG A;  3GJU A;  5F8V A;  4N0B A;  3EIA A;  3JWB A;  1N31 A;  2BHX A;  3VK2 A;  1AJS B;  3TFU A;  3RCH B;  3VAX A;  4TV7 A;  3FTB A;  1S06 A;  1UKJ A;  4ZAH A;  1AAW A;  3JZL A;  2EZ2 A;  5G4I A;  1YIY A;  3GZD C;  2VGT A;  4JEY A;  2NMP A;  2W7F A;  1SZU A;  3BB8 A;  5EUN A;  3N0L A;  2AY2 A;  4RJ0 A;  3EI8 A;  2YKY A;  1X29 A;  3AEN B;  4IW7 A;  2AAT A;  3MKJ A;  3W1I A;  5FT6 A;  3WX9 A;  4IXO A;  4GE4 A;  4TMR A;  5EIG B;  4MQQ A;  1AX4 A;  3QI6 A;  4XJO A;  2C7T A;  2FNI A;  4LNM A;  2TPL A;  1O4S A;  3GSB A;  2CFB A;  3AEJ C;  3NYU A;  2CB1 A;  4LC3 A;  1KL2 A;  4WYC A;  2AY6 A;  5EAA A;  3DU4 A;  1RV4 A;  1W23 A;  3PDX A;  1YJZ A;  4R8D A;  2W7I A;  4ADE A;  1D7R A;  4LNL A;  3KKI A;  1LW4 A;  1ASD A;  1LKC A;  1OAT A;  3II0 A;  1C4K A;  3JU7 A;  5D5S A;  1Y4I A;  3WKR A;  1BJO A;  4E3R A;  1AKA A;  2W7D A;  2O7C A;  3K40 A;  4JE5 D;  2Z9V A;  3EI9 A;  1LS3 A;  2OKK A;  3NDN A;  2BI3 A;  3HBX A;  5FT5 A;  4HF8 A;  3AOW A;  2YCT A;  4W1W A;  2FYF A;  4B9B A;  1ECX A;  1WKG A;  3NUI A;  4CBS A;  4GE7 A;  1AKC A;  1DJE A;  4W8I A;  4JF1 A;  1RVU A;  2C44 A;  2GMS A;  4FL0 A;  3W1J A;  4TN4 A;  3NRA A;  5DX5 A;  1W7N A;  3E77 A;  1DGD A;  3VK4 A;  3BWO A;  4K2B A;  3ZZJ A;  4EFF A;  4U2H A;  4DGT A;  1UU2 A;  3H7F A;  3ISL A;  3FSL A;  4BA5 A;  2CST A;  2PO3 A;  4M2J A;  2CJH A;  1BJW A;  1IUG A;  1C7O A;  1G4X A;  3K28 A;  3HMU A;  2GQN A;  3N5M A;  3P6K A;  3PDB B;  1QIT A;  1RV3 A;  2EPJ A;  2G6W A;  3FFR A;  3AEL A;  2DKB A;  4MKK A;  4ADD A;  1CL1 A;  1UU0 A;  3UE8 A;  4ITG A;  2ZC0 A; 
#chains in the Genus database with same CATH topology
 1H1C A;  2OGE A;  3A9X A;  3NTJ A;  5J8Q A;  1C7N A;  1QJ3 A;  2Z1Y A;  3BWN A;  4RJY A;  2CH2 A;  2VMW A;  3M5U A;  1YIZ A;  3A9Y A;  3E2Y A;  4M2M A;  2BWN A;  5G4J A;  4E3Q A;  3E2F A;  1JF9 A;  3MAD A;  1TAT A;  5E5I A;  3AEP A;  4J8L A;  1AAM A;  2ZSM A;  3TCM A;  2CAN A;  4WB0 B;  2YHK A;  3LY1 A;  1FG7 A;  1ARI A;  1XEY A;  3FFH A;  4A0R A;  4R5Z A;  4WLJ A;  1WYT A;  3MBB A;  3BCB A;  1AHF A;  1ASC A;  3BN1 A;  4OYT A;  1ORD A;  4KYO A;  2D64 A;  4E1O A;  3MAU A;  1TOE A;  4F4E A;  1OHY A;  2AY3 A;  2W8T A;  4H51 A;  4WYE A;  1AIC A;  3ZRR A;  1TOG A;  4RIT A;  3RI6 A;  1WYT B;  4OC9 A;  3HT4 A;  1TOK A;  5M4D A;  1LC5 A;  4F5J A;  4PVF A;  2V1P A;  3I5T A;  2HOX A;  2WKA A;  4XK1 A;  1O61 A;  2BWO A;  1M6S A;  2HUI A;  2FM1 A;  2W8U A;  1G7X A;  1YOO A;  1M4N A;  3NX3 A;  4UHM A;  4ZSW A;  3ELE A;  4ZM3 A;  1CL2 A;  3GZC A;  2BI2 A;  3B1C A;  1IX6 A;  1AJS A;  3T32 A;  3QHX A;  4A0G A;  1AMA A;  2D65 A;  4RKC A;  4ISY A;  1KKP A;  4MSO A;  1MAP A;  1B9H A;  1KL1 A;  4RM1 A;  3QBO A;  3PD6 A;  4WYG A;  2ZY4 A;  1M32 A;  2Z9X A;  5G2P A;  1OHW A;  4F5F A;  2OQX A;  3JW9 A;  8AAT A;  3FQA A;  1S07 A;  4PFF A;  1G7W A;  2ZP7 A;  2WK7 A;  2JIS A;  3N75 A;  4XQ2 A;  3WGB A;  4AO4 A;  2HOZ A;  5EQC A;  1IAX A;  5AX8 A;  1AHE A;  2EO5 A;  3AEN A;  3WGC A;  2GSA A;  1U08 A;  1GEX A;  3R9A A;  3NYT A;  1DKA A;  4B98 A;  4WXF A;  4A6R A;  2DGM A;  5HHY A;  2FNU A;  4K2I A;  2YOB A;  2W7J A;  3FKD A;  2FN6 A;  4R2N A;  2AY8 A;  2BYJ A;  4W1X A;  5DJ1 A;  5BJ3 A;  3AEO A;  2CY8 A;  1D7V A;  4JEZ A;  4ZLV A;  3N7N A;  1AIB A;  3EI5 A;  1WYU B;  1M0P A;  2CH1 A;  4OTL A;  4RKD A;  4ZDP A;  4WYD A;  3FZ8 A;  3KGW A;  3TAT A;  2BIA A;  3IHJ A;  4BHD A;  3BCA A;  1MAQ A;  1O62 A;  4MKJ A;  4A6T A;  2HUF A;  1BJN A;  1YJS A;  3CQ5 A;  3FDB A;  3WCO A;  3FDD A;  3PA9 A;  2ZYJ A;  3ZZK A;  3DOD A;  3KE3 A;  1OHV A;  2JJF A;  4AH3 A;  1Z3Z A;  1LC8 A;  2VMY A;  2VYC A;  3H14 A;  3LV2 A;  2AY5 A;  2JJE A;  1V2F A;  2YCP A;  2YRI A;  2QLR A;  2VLF A;  4F5I A;  1PG8 A;  2WB6 A;  4P7Y A;  2YKV A;  2OGA A;  3E2Z A;  4WD2 A;  5EIG A;  3VP6 A;  7AAT A;  2RFV A;  1VEF A;  3A2B A;  4CVQ A;  2ZY5 A;  1GD9 A;  2CJG A;  2E7U A;  3NU8 A;  1M0Q A;  4N0W A;  5DB5 A;  2X3L A;  4JF0 A;  5FT4 A;  4UOY A;  1S08 A;  1H0C A;  1EQB A;  4ZWV A;  2HUU A;  1ZC9 A;  3TQX A;  2VMZ A;  5M46 A;  1X28 A;  2AY7 A;  4RLG A;  1PFF A;  3GBX A;  4ZAS A;  3PDB A;  1TAR A;  1ARG A;  1ZOD A;  3FCR A;  2O1B A;  3FRK A;  1CQ8 A;  2BIG A;  1S0A A;  1CZE A;  3LVM A;  4GE9 A;  3JWA A;  4AOA A;  1DGE A;  4OCA A;  4EB5 A;  5BJ4 A;  2JGT A;  5G2Q A;  4GEB A;  4WYA A;  3DXV A;  2BI5 A;  2BKW A;  3PPL A;  3AOV A;  4UQV A;  3N4R A;  3QPG A;  3OP7 A;  1AMR A;  1IAY A;  4W5K A;  2AY4 A;  1W7M A;  1I29 A;  1JS3 A;  2W8J A;  4IYO A;  1IBJ A;  1MGV A;  1X0M A;  2VMV A;  5E4Z A;  4GRX A;  3ASB A;  3AEJ A;  1BQA A;  4EU1 A;  5E3K A;  4OMA A;  4WXB A;  4Y0H A;  4ZM4 A;  2ORD A;  3I4J A;  4MGR A;  4JEW A;  1E5F A;  2QSR A;  2VIA A;  5EUD A;  1IX8 A;  4XJL A;  2YCN A;  3BC8 A;  4A00 A;  2VI8 A;  1KKJ A;  2CJD A;  3MEB A;  2CTZ A;  4Q75 A;  3K7Y A;  3A9Z A;  3CAI A;  2PB2 A;  2QB3 A;  1AHY A;  3AEM A;  5LHA A;  1GC0 A;  2PB0 A;  1G4V A;  5JAY A;  3GZD A;  1D2F A;  1GC2 A;  4A72 A;  2X8U A;  3GET A;  2OAT A;  1YNU A;  3UAK A;  2V0Y A;  2XBN A;  2VMN A;  4ZDO A;  4K2M A;  4H63 Q;  2R5E A;  3L44 A;  2D61 A;  3FD0 A;  5HXX A;  3FZ7 A;  1BW0 A;  3F6T A;  1QGN A;  1CZC A;  2FKI A;  2QBT A;  3FVU A;  1E5E A;  1AHG A;  2W7K A;  1GBN A;  2VGV A;  2Z67 A;  4KAM A;  1PMO A;  3MAF A;  1ELU A;  1FG3 A;  2Z9U A;  1AHX A;  2FQ6 A;  3ASA A;  5D95 A;  4F5G A;  2G7J A;  1GCK A;  1S09 A;  1SVV A;  1GC3 A;  2BYL A;  3MC6 C;  4E77 A;  2X5D A;  2HOR A;  2BIE A;  4IYO B;  5C6U A;  1LC7 A;  3ECD A;  3F9T A;  5IWQ A;  2AEU A;  2EGY A;  2DGK A;  3ATH A;  1B5O A;  1W7L A;  1JS6 A;  2GB3 A;  3ELP A;  4R5F A;  3TFT A;  1YJY A;  2WK8 A;  3KGX A;  1WST A;  2EZ1 A;  3EI7 A;  2O0R A;  1IJI A;  2W7E A;  4M2K A;  3I16 A;  4ITX A;  3MC6 A;  1QIS A;  3G0T A;  3F0H A;  4MQR A;  2E7J A;  1D7U A;  4FFC A;  1WYV A;  1GEW A;  4JEX A;  4XJM A;  2W7L A;  1X2A A;  3NNK A;  5TF5 A;  2X5F A;  2ZJG A;  1YAA A;  4JEV A;  1CJ0 A;  1KMK A;  2R5C B;  1BKG A;  2YKX A;  2Q7W A;  1ASF A;  2ZSL A;  4OT8 A;  3A8U X;  3DRD A;  3PD6 B;  3EIB A;  3PGY A;  3ACZ A;  1PMM A;  2JJH A;  4IXZ A;  1LK9 A;  4LNJ A;  1MDO A;  4ZWM A;  3E2Z B;  1MLZ A;  2R2N A;  1OXP A;  1DJU A;  1FC4 A;  2F8J A;  2D7Z A;  3MAF B;  3AEM C;  4AZJ A;  4EMY A;  1V72 A;  4PFN A;  3DYD A;  2VMS A;  2W8V A;  3VOM A;  3RCH A;  3WLX A;  1N2T A;  2VMT A;  4O6Z A;  3R4T A;  1TOJ A;  3GR9 A;  3PJ0 A;  1SZK A;  2D7Y A;  1B4X A;  4IX8 A;  3RBF A;  3B1E A;  3IF2 A;  1AIA A;  1ARS A;  4WBT A;  3HL2 A;  4RAE A;  2C0R A;  3BV0 A;  4GSA A;  2QMA A;  1ART A;  4XJP A;  4ZDL A;  3HLM A;  2AEV A;  1J32 A;  1VP4 A;  3QGU A;  1UU1 A;  3CQ6 A;  2VGU A;  3L8A A;  3HQT A;  3Q8N A;  4WYF A;  1I48 A;  1LW5 A;  1IX7 A;  2DGL A;  3H9X A;  1EG5 A;  2VMU A;  9AAT A;  1SPA A;  1O69 A;  4IY7 A;  3EZS A;  1IVR A;  1MLY A;  4XEW A;  2ZUK A;  3LG0 A;  3WZF A;  2VGS A;  5I92 A;  3UWC A;  1M0O A;  2R0T A;  3EI6 A;  2VMX A;  1I43 A;  3NUB A;  1ASN A;  3B8X A;  1AJR A;  1WYV B;  3FZ6 A;  3FQ8 A;  5EUE A;  4AZK A;  1WKH A;  1J04 A;  1DFO A;  2DR1 A;  2W8W A;  2Z20 A;  3FVS A;  3DZZ A;  1CS1 A;  1OXO A;  4F5K A;  2W7M A;  4I8A A;  2R5C A;  5M4B A;  2EH6 A;  1M7Y A;  1AMQ A;  3PAA A;  4EB7 A;  4BA4 A;  4XAU A;  3RBL A;  3FVX A;  1AY8 A;  2VMP A;  1ASB A;  4A6U A;  4WLH A;  1ELQ A;  1TAS A;  3CQ4 A;  3DR4 A;  4NOG A;  2HP2 A;  3E6G A;  3E9K A;  3P1T A;  2E54 A;  2JJG A;  1VJO A;  5G09 A;  3WCN A;  1ARH A;  2VGW A;  1ASA A;  2OKJ A;  3LVJ A;  4ATP A;  3BS8 A;  4J5U A;  4L0O A;  3HDO A;  4GDY A;  4MY5 A;  4CBR A;  1JG8 A;  4Q6R A;  2YRR A;  3WKS A;  3USF A;  4UHO A;  1ZOB A;  3JTX A;  3AV7 A;  5EAV A;  4AO9 A;  1BJ4 A;  3W1H A;  1SFF A;  4ADB A;  1DJ9 A;  3HVY A;  4LW2 A;  3ZRQ A;  2ZY2 A;  1SF2 A;  3D6K A;  1BS0 A;  1EJI A;  1AMS A;  1ASL A;  4JE5 A;  4WXG A;  1XI9 A;  2YKU A;  2HOY A;  4OBV A;  3OKS A;  1B5P A;  2QA3 A;  2XH1 A;  1DTY A;  4UHN A;  1C9C A;  1KMJ A;  1C7G A;  3EUC A;  4BMK A;  4Y0I A;  2VGZ A;  4OBU A;  1MDX A;  2QB2 A;  1AY4 A;  1B9I A;  1CQ7 A;  1RVY A;  1Z7D A;  3AAT A;  4CXR A;  2VMO A;  2D63 A;  4ATQ A;  2VIB A;  2DKJ A;  5DJ9 A;  4MQP A;  5KTB A;  2BI1 A;  2D66 A;  1SZS A;  1N8P A;  3FQ7 A;  3VK3 A;  4DQ6 A;  4W91 A;  4F5L A;  3NYS A;  4CXQ A;  1T3I A;  5FT8 A;  4U1T A;  2EYQ A;  2WK9 A;  1QIR A;  2CIN A;  1D7S A;  2VMR A;  3LVK A;  4IXS A;  3CBF A;  3DC1 A;  4PIW A;  2E7I A;  1AKB A;  1I41 A;  2BWP A;  3G8M A;  4Q31 A;  4ZSY A;  2DOU A;  1QZ9 A;  1M0N A;  4WB0 A;  5HDM A;  3WY7 A;  1ASE A;  3N4X A;  2GMU A;  3QN6 A;  4Q76 A;  5LH9 A;  1QJ5 A;  2ZY3 A;  2VMQ A;  5EFS A;  2Z1Z A;  3G7Q A;  2BI9 A;  1V2D A;  3NU7 A;  1GEY A;  4A0H A;  4F5M A;  5M49 A;  3COG A;  3PIU A;  2VI9 A;  4A0F A;  3B1D A;  2C81 A;  5G0A A;  1W3U A;  2VLH A;  3LWS A;  2JG2 A;  1B8G A;  3B46 A;  4RIZ A;  4HVK A;  1BJO B;  3RQ1 A;  3DR7 A;  4LW4 A;  2Z61 A;  1TPL A;  5F9S A;  3QM2 A;  2AY9 A;  4WP0 A;  2W7G A;  4BQ0 A;  1CQ6 A;  1TOI A;  3GWP A;  3RUY A;  1ASM A;  4QGR A;  1GDE A;  2AY1 A;  2HP1 A;  1GC4 A;  2Z9W A;  1BT4 A;  2D5Y A;  2HZP A;  4ADC A;  4W1V A;  1MDZ A;  3BWN C;  5K8B A;  3EZ1 A;  4KXK A;  4Y0D A;  2W7H A;  4F5H A;  1BQD A;  3DXW A;  1P3W A;  3LVL B;  3ZRP A;  4DBC A;  1WYU A;  3BCX A;  1C0N A;  4P3M A;  2A1V A;  1AY5 A;  1V2E A;  1ASG A;  3GJU A;  5F8V A;  4N0B A;  3EIA A;  3JWB A;  1N31 A;  1KAF A;  2KFP A;  2BHX A;  3VK2 A;  1AJS B;  3TFU A;  3RCH B;  3VAX A;  4TV7 A;  3FTB A;  1S06 A;  1UKJ A;  4ZAH A;  3N4S A;  1AAW A;  3JZL A;  2EZ2 A;  5G4I A;  1YIY A;  3GZD C;  2VGT A;  4JEY A;  2NMP A;  2W7F A;  1SZU A;  3BB8 A;  5EUN A;  3N0L A;  2AY2 A;  4RJ0 A;  3EI8 A;  2YKY A;  1X29 A;  3AEN B;  4IW7 A;  2AAT A;  3MKJ A;  3W1I A;  5FT6 A;  3WX9 A;  4IXO A;  4GE4 A;  4TMR A;  5EIG B;  4MQQ A;  1AX4 A;  3QI6 A;  4XJO A;  2C7T A;  2FNI A;  4LNM A;  2TPL A;  1O4S A;  3GSB A;  2CFB A;  3AEJ C;  4K05 A;  3NYU A;  2CB1 A;  4LC3 A;  1KL2 A;  4WYC A;  2AY6 A;  5EAA A;  3DU4 A;  1RV4 A;  1W23 A;  3PDX A;  1YJZ A;  4R8D A;  2W7I A;  4ADE A;  1D7R A;  4LNL A;  3KKI A;  1LW4 A;  1ASD A;  1LKC A;  1OAT A;  3II0 A;  1C4K A;  3JU7 A;  5D5S A;  1Y4I A;  3WKR A;  1BJO A;  4E3R A;  1AKA A;  2W7D A;  2O7C A;  3K40 A;  4JE5 D;  2Z9V A;  3EI9 A;  1LS3 A;  2OKK A;  3NDN A;  2BI3 A;  3HBX A;  5FT5 A;  4HF8 A;  3AOW A;  2YCT A;  4W1W A;  2FYF A;  4B9B A;  1ECX A;  1WKG A;  3NUI A;  4CBS A;  4GE7 A;  1AKC A;  1DJE A;  4W8I A;  4JF1 A;  1RVU A;  2C44 A;  2GMS A;  4FL0 A;  3W1J A;  4TN4 A;  3NRA A;  5DX5 A;  1W7N A;  3E77 A;  1DGD A;  3VK4 A;  3BWO A;  4K2B A;  3ZZJ A;  4EFF A;  4U2H A;  4DGT A;  1UU2 A;  3H7F A;  3ISL A;  3FSL A;  4BA5 A;  2CST A;  2PO3 A;  4M2J A;  2CJH A;  1BJW A;  1IUG A;  1C7O A;  1G4X A;  3K28 A;  3HMU A;  2GQN A;  3N5M A;  3P6K A;  3PDB B;  1QIT A;  1RV3 A;  2EPJ A;  2G6W A;  3FFR A;  3AEL A;  2DKB A;  4MKK A;  4ADD A;  1CL1 A;  1UU0 A;  3UE8 A;  4ITG A;  2ZC0 A; 
#chains in the Genus database with same CATH homology
 1H1C A;  2OGE A;  3A9X A;  3NTJ A;  5J8Q A;  1C7N A;  1QJ3 A;  2Z1Y A;  3BWN A;  4RJY A;  2CH2 A;  2VMW A;  3M5U A;  1YIZ A;  3A9Y A;  3E2Y A;  4M2M A;  2BWN A;  5G4J A;  4E3Q A;  3E2F A;  1JF9 A;  3MAD A;  1TAT A;  5E5I A;  3AEP A;  4J8L A;  1AAM A;  2ZSM A;  3TCM A;  2CAN A;  4WB0 B;  2YHK A;  3LY1 A;  1FG7 A;  1ARI A;  1XEY A;  3FFH A;  4A0R A;  4R5Z A;  4WLJ A;  1WYT A;  3MBB A;  3BCB A;  1AHF A;  1ASC A;  3BN1 A;  4OYT A;  1ORD A;  4KYO A;  2D64 A;  4E1O A;  3MAU A;  1TOE A;  4F4E A;  1OHY A;  2AY3 A;  2W8T A;  4H51 A;  4WYE A;  1AIC A;  3ZRR A;  1TOG A;  4RIT A;  3RI6 A;  1WYT B;  4OC9 A;  3HT4 A;  1TOK A;  5M4D A;  1LC5 A;  4F5J A;  4PVF A;  2V1P A;  3I5T A;  2HOX A;  2WKA A;  4XK1 A;  1O61 A;  2BWO A;  1M6S A;  2HUI A;  2FM1 A;  2W8U A;  1G7X A;  1YOO A;  1M4N A;  3NX3 A;  4UHM A;  4ZSW A;  3ELE A;  4ZM3 A;  1CL2 A;  3GZC A;  2BI2 A;  3B1C A;  1IX6 A;  1AJS A;  3T32 A;  3QHX A;  4A0G A;  1AMA A;  2D65 A;  4RKC A;  4ISY A;  1KKP A;  4MSO A;  1MAP A;  1B9H A;  1KL1 A;  4RM1 A;  3QBO A;  3PD6 A;  4WYG A;  2ZY4 A;  1M32 A;  2Z9X A;  5G2P A;  1OHW A;  4F5F A;  2OQX A;  3JW9 A;  8AAT A;  3FQA A;  1S07 A;  4PFF A;  1G7W A;  2ZP7 A;  2WK7 A;  2JIS A;  3N75 A;  4XQ2 A;  3WGB A;  4AO4 A;  2HOZ A;  5EQC A;  1IAX A;  5AX8 A;  1AHE A;  2EO5 A;  3AEN A;  3WGC A;  2GSA A;  1U08 A;  1GEX A;  3R9A A;  3NYT A;  1DKA A;  4B98 A;  4WXF A;  4A6R A;  2DGM A;  5HHY A;  2FNU A;  4K2I A;  2YOB A;  2W7J A;  3FKD A;  2FN6 A;  4R2N A;  2AY8 A;  2BYJ A;  4W1X A;  5DJ1 A;  5BJ3 A;  3AEO A;  2CY8 A;  1D7V A;  4JEZ A;  4ZLV A;  3N7N A;  1AIB A;  3EI5 A;  1WYU B;  1M0P A;  2CH1 A;  4OTL A;  4RKD A;  4ZDP A;  4WYD A;  3FZ8 A;  3KGW A;  3TAT A;  2BIA A;  3IHJ A;  4BHD A;  3BCA A;  1MAQ A;  1O62 A;  4MKJ A;  4A6T A;  2HUF A;  1BJN A;  1YJS A;  3CQ5 A;  3FDB A;  3WCO A;  3FDD A;  3PA9 A;  2ZYJ A;  3ZZK A;  3DOD A;  3KE3 A;  1OHV A;  2JJF A;  4AH3 A;  1Z3Z A;  1LC8 A;  2VMY A;  2VYC A;  3H14 A;  3LV2 A;  2AY5 A;  2JJE A;  1V2F A;  2YCP A;  2YRI A;  2QLR A;  2VLF A;  4F5I A;  1PG8 A;  2WB6 A;  4P7Y A;  2YKV A;  2OGA A;  3E2Z A;  4WD2 A;  5EIG A;  3VP6 A;  7AAT A;  2RFV A;  1VEF A;  3A2B A;  4CVQ A;  2ZY5 A;  1GD9 A;  2CJG A;  2E7U A;  3NU8 A;  1M0Q A;  4N0W A;  5DB5 A;  2X3L A;  4JF0 A;  5FT4 A;  4UOY A;  1S08 A;  1H0C A;  1EQB A;  4ZWV A;  2HUU A;  1ZC9 A;  3TQX A;  2VMZ A;  5M46 A;  1X28 A;  2AY7 A;  4RLG A;  1PFF A;  3GBX A;  4ZAS A;  3PDB A;  1TAR A;  1ARG A;  1ZOD A;  3FCR A;  2O1B A;  3FRK A;  1CQ8 A;  2BIG A;  1S0A A;  1CZE A;  3LVM A;  4GE9 A;  3JWA A;  4AOA A;  1DGE A;  4OCA A;  4EB5 A;  5BJ4 A;  2JGT A;  5G2Q A;  4GEB A;  4WYA A;  3DXV A;  2BI5 A;  2BKW A;  3PPL A;  3AOV A;  4UQV A;  3N4R A;  3QPG A;  3OP7 A;  1AMR A;  1IAY A;  4W5K A;  2AY4 A;  1W7M A;  1I29 A;  1JS3 A;  2W8J A;  4IYO A;  1IBJ A;  1MGV A;  1X0M A;  2VMV A;  5E4Z A;  4GRX A;  3ASB A;  3AEJ A;  1BQA A;  4EU1 A;  5E3K A;  4OMA A;  4WXB A;  4Y0H A;  4ZM4 A;  2ORD A;  3I4J A;  4MGR A;  4JEW A;  1E5F A;  2QSR A;  2VIA A;  5EUD A;  1IX8 A;  4XJL A;  2YCN A;  3BC8 A;  4A00 A;  2VI8 A;  1KKJ A;  2CJD A;  3MEB A;  2CTZ A;  4Q75 A;  3K7Y A;  3A9Z A;  3CAI A;  2PB2 A;  2QB3 A;  1AHY A;  3AEM A;  5LHA A;  1GC0 A;  2PB0 A;  1G4V A;  5JAY A;  3GZD A;  1D2F A;  1GC2 A;  4A72 A;  2X8U A;  3GET A;  2OAT A;  1YNU A;  3UAK A;  2V0Y A;  2XBN A;  2VMN A;  4ZDO A;  4K2M A;  4H63 Q;  2R5E A;  3L44 A;  2D61 A;  3FD0 A;  5HXX A;  3FZ7 A;  1BW0 A;  3F6T A;  1QGN A;  1CZC A;  2FKI A;  2QBT A;  3FVU A;  1E5E A;  1AHG A;  2W7K A;  1GBN A;  2VGV A;  2Z67 A;  4KAM A;  1PMO A;  3MAF A;  1ELU A;  1FG3 A;  2Z9U A;  1AHX A;  2FQ6 A;  3ASA A;  5D95 A;  4F5G A;  2G7J A;  1GCK A;  1S09 A;  1SVV A;  1GC3 A;  2BYL A;  3MC6 C;  4E77 A;  2X5D A;  2HOR A;  2BIE A;  4IYO B;  5C6U A;  1LC7 A;  3ECD A;  3F9T A;  5IWQ A;  2AEU A;  2EGY A;  2DGK A;  3ATH A;  1B5O A;  1W7L A;  1JS6 A;  2GB3 A;  3ELP A;  4R5F A;  3TFT A;  1YJY A;  2WK8 A;  3KGX A;  1WST A;  2EZ1 A;  3EI7 A;  2O0R A;  1IJI A;  2W7E A;  4M2K A;  3I16 A;  4ITX A;  3MC6 A;  1QIS A;  3G0T A;  3F0H A;  4MQR A;  2E7J A;  1D7U A;  4FFC A;  1WYV A;  1GEW A;  4JEX A;  4XJM A;  2W7L A;  1X2A A;  3NNK A;  5TF5 A;  2X5F A;  2ZJG A;  1YAA A;  4JEV A;  1CJ0 A;  1KMK A;  2R5C B;  1BKG A;  2YKX A;  2Q7W A;  1ASF A;  2ZSL A;  4OT8 A;  3A8U X;  3DRD A;  3PD6 B;  3EIB A;  3PGY A;  3ACZ A;  1PMM A;  2JJH A;  4IXZ A;  1LK9 A;  4LNJ A;  1MDO A;  4ZWM A;  3E2Z B;  1MLZ A;  2R2N A;  1OXP A;  1DJU A;  1FC4 A;  2F8J A;  2D7Z A;  3MAF B;  3AEM C;  4AZJ A;  4EMY A;  1V72 A;  4PFN A;  3DYD A;  2VMS A;  2W8V A;  3VOM A;  3RCH A;  3WLX A;  1N2T A;  2VMT A;  4O6Z A;  3R4T A;  1TOJ A;  3GR9 A;  3PJ0 A;  1SZK A;  2D7Y A;  1B4X A;  4IX8 A;  3RBF A;  3B1E A;  3IF2 A;  1AIA A;  1ARS A;  4WBT A;  3HL2 A;  4RAE A;  2C0R A;  3BV0 A;  4GSA A;  2QMA A;  1ART A;  4XJP A;  4ZDL A;  3HLM A;  2AEV A;  1J32 A;  1VP4 A;  3QGU A;  1UU1 A;  3CQ6 A;  2VGU A;  3L8A A;  3HQT A;  3Q8N A;  4WYF A;  1I48 A;  1LW5 A;  1IX7 A;  2DGL A;  3H9X A;  1EG5 A;  2VMU A;  9AAT A;  1SPA A;  1O69 A;  4IY7 A;  3EZS A;  1IVR A;  1MLY A;  4XEW A;  2ZUK A;  3LG0 A;  3WZF A;  2VGS A;  5I92 A;  3UWC A;  1M0O A;  2R0T A;  3EI6 A;  2VMX A;  1I43 A;  3NUB A;  1ASN A;  3B8X A;  1AJR A;  1WYV B;  3FZ6 A;  3FQ8 A;  5EUE A;  4AZK A;  1WKH A;  1J04 A;  1DFO A;  2DR1 A;  2W8W A;  2Z20 A;  3FVS A;  3DZZ A;  1CS1 A;  1OXO A;  4F5K A;  2W7M A;  4I8A A;  2R5C A;  5M4B A;  2EH6 A;  1M7Y A;  1AMQ A;  3PAA A;  4EB7 A;  4BA4 A;  4XAU A;  3RBL A;  3FVX A;  1AY8 A;  2VMP A;  1ASB A;  4A6U A;  4WLH A;  1ELQ A;  1TAS A;  3CQ4 A;  3DR4 A;  4NOG A;  2HP2 A;  3E6G A;  3E9K A;  3P1T A;  2E54 A;  2JJG A;  1VJO A;  5G09 A;  3WCN A;  1ARH A;  2VGW A;  1ASA A;  2OKJ A;  3LVJ A;  4ATP A;  3BS8 A;  4J5U A;  4L0O A;  3HDO A;  4GDY A;  4MY5 A;  4CBR A;  1JG8 A;  4Q6R A;  2YRR A;  3WKS A;  3USF A;  4UHO A;  1ZOB A;  3JTX A;  3AV7 A;  5EAV A;  4AO9 A;  1BJ4 A;  3W1H A;  1SFF A;  4ADB A;  1DJ9 A;  3HVY A;  4LW2 A;  3ZRQ A;  2ZY2 A;  1SF2 A;  3D6K A;  1BS0 A;  1EJI A;  1AMS A;  1ASL A;  4JE5 A;  4WXG A;  1XI9 A;  2YKU A;  2HOY A;  4OBV A;  3OKS A;  1B5P A;  2QA3 A;  2XH1 A;  1DTY A;  4UHN A;  1C9C A;  1KMJ A;  1C7G A;  3EUC A;  4BMK A;  4Y0I A;  2VGZ A;  4OBU A;  1MDX A;  2QB2 A;  1AY4 A;  1B9I A;  1CQ7 A;  1RVY A;  1Z7D A;  3AAT A;  4CXR A;  2VMO A;  2D63 A;  4ATQ A;  2VIB A;  2DKJ A;  5DJ9 A;  4MQP A;  5KTB A;  2BI1 A;  2D66 A;  1SZS A;  1N8P A;  3FQ7 A;  3VK3 A;  4DQ6 A;  4W91 A;  4F5L A;  3NYS A;  4CXQ A;  1T3I A;  5FT8 A;  4U1T A;  2EYQ A;  2WK9 A;  1QIR A;  2CIN A;  1D7S A;  2VMR A;  3LVK A;  4IXS A;  3CBF A;  3DC1 A;  4PIW A;  2E7I A;  1AKB A;  1I41 A;  2BWP A;  3G8M A;  4Q31 A;  4ZSY A;  2DOU A;  1QZ9 A;  1M0N A;  4WB0 A;  5HDM A;  3WY7 A;  1ASE A;  3N4X A;  2GMU A;  3QN6 A;  4Q76 A;  5LH9 A;  1QJ5 A;  2ZY3 A;  2VMQ A;  5EFS A;  2Z1Z A;  3G7Q A;  2BI9 A;  1V2D A;  3NU7 A;  1GEY A;  4A0H A;  4F5M A;  5M49 A;  3COG A;  3PIU A;  2VI9 A;  4A0F A;  3B1D A;  2C81 A;  5G0A A;  1W3U A;  2VLH A;  3LWS A;  2JG2 A;  1B8G A;  3B46 A;  4RIZ A;  4HVK A;  1BJO B;  3RQ1 A;  3DR7 A;  4LW4 A;  2Z61 A;  1TPL A;  5F9S A;  3QM2 A;  2AY9 A;  4WP0 A;  2W7G A;  4BQ0 A;  1CQ6 A;  1TOI A;  3GWP A;  3RUY A;  1ASM A;  4QGR A;  1GDE A;  2AY1 A;  2HP1 A;  1GC4 A;  2Z9W A;  1BT4 A;  2D5Y A;  2HZP A;  4ADC A;  4W1V A;  1MDZ A;  3BWN C;  5K8B A;  3EZ1 A;  4KXK A;  4Y0D A;  2W7H A;  4F5H A;  1BQD A;  3DXW A;  1P3W A;  3LVL B;  3ZRP A;  4DBC A;  1WYU A;  3BCX A;  1C0N A;  4P3M A;  2A1V A;  1AY5 A;  1V2E A;  1ASG A;  3GJU A;  5F8V A;  4N0B A;  3EIA A;  3JWB A;  1N31 A;  2KFP A;  2BHX A;  3VK2 A;  1AJS B;  3TFU A;  3RCH B;  3VAX A;  4TV7 A;  3FTB A;  1S06 A;  1UKJ A;  4ZAH A;  3N4S A;  1AAW A;  3JZL A;  2EZ2 A;  5G4I A;  1YIY A;  3GZD C;  2VGT A;  4JEY A;  2NMP A;  2W7F A;  1SZU A;  3BB8 A;  5EUN A;  3N0L A;  2AY2 A;  4RJ0 A;  3EI8 A;  2YKY A;  1X29 A;  3AEN B;  4IW7 A;  2AAT A;  3MKJ A;  3W1I A;  5FT6 A;  3WX9 A;  4IXO A;  4GE4 A;  4TMR A;  5EIG B;  4MQQ A;  1AX4 A;  3QI6 A;  4XJO A;  2C7T A;  2FNI A;  4LNM A;  2TPL A;  1O4S A;  3GSB A;  2CFB A;  3AEJ C;  4K05 A;  3NYU A;  2CB1 A;  4LC3 A;  1KL2 A;  4WYC A;  2AY6 A;  5EAA A;  3DU4 A;  1RV4 A;  1W23 A;  3PDX A;  1YJZ A;  4R8D A;  2W7I A;  4ADE A;  1D7R A;  4LNL A;  3KKI A;  1LW4 A;  1ASD A;  1LKC A;  1OAT A;  3II0 A;  1C4K A;  3JU7 A;  5D5S A;  1Y4I A;  3WKR A;  1BJO A;  4E3R A;  1AKA A;  2W7D A;  2O7C A;  3K40 A;  4JE5 D;  2Z9V A;  3EI9 A;  1LS3 A;  2OKK A;  3NDN A;  2BI3 A;  3HBX A;  5FT5 A;  4HF8 A;  3AOW A;  2YCT A;  4W1W A;  2FYF A;  4B9B A;  1ECX A;  1WKG A;  3NUI A;  4CBS A;  4GE7 A;  1AKC A;  1DJE A;  4W8I A;  4JF1 A;  1RVU A;  2C44 A;  2GMS A;  4FL0 A;  3W1J A;  4TN4 A;  3NRA A;  5DX5 A;  1W7N A;  3E77 A;  1DGD A;  3VK4 A;  3BWO A;  4K2B A;  3ZZJ A;  4EFF A;  4U2H A;  4DGT A;  1UU2 A;  3H7F A;  3ISL A;  3FSL A;  4BA5 A;  2CST A;  2PO3 A;  4M2J A;  2CJH A;  1BJW A;  1IUG A;  1C7O A;  1G4X A;  3K28 A;  3HMU A;  2GQN A;  3N5M A;  3P6K A;  3PDB B;  1QIT A;  1RV3 A;  2EPJ A;  2G6W A;  3FFR A;  3AEL A;  2DKB A;  4MKK A;  4ADD A;  1CL1 A;  1UU0 A;  3UE8 A;  4ITG A;  2ZC0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...