1SPBP

Subtilisin bpn' prosegment (77 residues) complexed with a mutant subtilisin bpn' (266 residues). crystal ph 4.6. crystallization temperature 20 c diffraction temperature-160 c
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
71
structure length
71
Chain Sequence
EKKYIVGFKQTMSTMSAAKKKDVISEKGGKVQKQFKYVDAASATLNEKAVKELKKDPSVAYVEEDHVAHAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The prosegment-subtilisin BPN' complex: crystal structure of a specific 'foldase'.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Complex (serine proteinase/prosegment)
molecule keywords SUBTILISIN BPN' PROSEGMENT
total genus 17
structure length 71
sequence length 71
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 1995-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF05922 Inhibitor_I9 Peptidase inhibitor I9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 1spbP00
2Z57B 3A3OB 3WIUA 2Z56B 2PMWA 2Z30B 3WIVA 1R6VA 4JP8A 2W2OP 2ZWOA 2W2PP 2W2QP 3P5BP 4NMXA 3BGOP 2ZWPA 2W2NP 3A3NB 3WHIA 1ITPA 1V5IB 4NE9C 3CO0P 3H42A 2Z2YB 3QFHA 4YN3B 3VV2B 4OV6A 2E1PA 3CNQP 3GCWP 2Z2ZA 2XTJP 3AFGA 2W2MP 3GCXP 2Z58B 2QTWA 3BPSP 3T41A 3A3PB 3VHQA 1SCJB 4K8RA 3SQOP 1SPBP
chains in the Genus database with same CATH superfamily
5ETKA 1D09B 1FRJA 1HWUA 3DNCA 3EICA 4NRUA 2JFKA 2OMLA 1LWEA 4BWMA 2QL9B 3C15A 3WIVA 4DCOB 5DJBA 2BVZA 5K8PA 4Y2MA 1U24A 3L7UA 1EP4B 2Q6CA 4NA3A 4RKUC 5K14B 4C48A 4IUFA 5D8HB 3D9BA 3NEKA 3DU6A 2VPWB 3FCWA 1L5UA 1RABB 1RWUA 4DCJB 2DIUA 4NLSA 4RUAA 3CJTA 1YZ6A 1RT1A 3KDNA 4WK3A 4KO0B 5CYMA 2I6WA 2XLIA 1T3OA 4MTPA 1F3VA 4ZS6A 4O3NA 2ZH8A 4LF7J 3MUVP 4DL6A 1FFGB 1MNEA 2GMLA 3QSYB 5E33A 4CLUA 2L08A 3G71S 5A2QU 1UA0A 1HWIA 1HNZJ 2Q79A 3EGZA 4RNNA 3R2CJ 2AEJA 4EO8A 4EBDA 1FNXH 1S4FA 4O0IA 2CVIA 2OJ3A 2VICA 2GFFA 2RRBA 4CH1A 4I7FA 1KQSR 1G3OA 2IY5B 2BOAA 2DHGA 3N6NA 2Z56B 4LRBA 5ETRA 3OSNA 2IMOA 4DV7J 4FS2A 3BSAA 3V2UC 4KTQA 3C6TA 1T95A 1WEYA 1AYEA 2YNFA 4K5RA 2CQIA 1C0TB 4Z37A 3KLHA 3IWXA 1WACA 3L7PA 1HWKA 3PYFA 4HACA 4XAKA 5LMUF 2B56A 4ZDNA 1FTRA 1X9SA 1QVGR 1PAEX 4X62J 2M52A 2C3UA 4NLPA 3M9OB 1E6VA 2UP1A 2I8EA 1RLDA 4MH8A 4MJKA 4GVLA 4C0OC 3MCNA 3UD4P 4FYWB 3TAMB 4ZCIA 3NGTA 3CB4A 1NPPA 3R5JB 1UP1A 2ZBIA 2CJXB 5EX3A 8ATCB 2KG1A 4KH1B 2BQRA 1FFSB 3SDEA 3GZ7A 2DR7A 4NXMJ 1V5VA 3K2YA 3LWMA 1QDUB 3VCDA 2Y0SD 1RT7B 2IA0A 2R2RA 2LQJA 2YXLA 1OSCA 4X4PA 2D3OR 4G6VB 1Y0HA 2V6AA 1W2IA 3DDIA 4FPRA 3ELHA 4OX7A 2VPYB 4RBTA 1S9EA 2QA1A 3CSKA 4X62F 4QU6A 4XK8C 4ECWA 3EGNA 1YJUA 2Z2YB 3IFEA 3S6EA 1Z2LA 2WVBA 1RZMA 2MLYA 2HQCA 5FLXU 1KP6A 1UFLA 2XSJA 1WC5A 5CYQA 4HHJA 3DRSA 4NYZA 2EFQA 3M9NB 3HHLA 1Q8LA 5IV4A 4BC7A 4XPCA 1U8WA 3OL9A 2CDQA 4TY9A 3PO5A 2NSBA 2HS3A 3M2RA 4X65F 2XY5A 2A6OA 3GYXB 2DR5A 4DQSA 1RB0A 2DXFA 4LFAF 2Z8QA 3FCHA 1ZA1B 4TLRA 5KT7A 1FXLA 3IAS9 2BE7D 3PV8A 2GIRA 3DGVA 2HHHF 3D6FB 2FC9A 3GWCA 3H90A 3HMJG 6FD1A 2B9EA 1SQFA 3MM7A 4B3RJ 3DRRA 3AD8C 1RTDB 2GQCA 2LDYA 2WONB 1OWXA 5F3ZA 2HWHA 2HPUA 2F4FA 3D4JA 3AT1B 4IH7A 5I4MA 2DO4A 3IM8A 3LP0A 4ED5A 1S9GB 1Q7LB 5B0AA 4X4NA 1TUVA 4FKXA 2DGXA 3D28A 4J9MA 2UVRA 3S7RA 2MKYA 3SSQA 4EGLA 5DG9A 2YNHB 1WOOA 4X65J 2AWZA 5KFLA 2J9EA 1GQEA 5F8HA 3S8SA 4ECSA 2DJWA 4ZP9A 1R0AA 1HI8A 1HR0J 2DHSA 3DRSB 3I5BA 5M2PA 1X4AA 2HHPA 2AD9A 5DDRC 3UE2A 1B7YB 2HQGA 2LXIA 1VIXA 1X7VA 2NYHA 1L3VA 1MROA 4H4MB 4ZPCA 3TO8A 1MMNA 3IBFB 1I3OB 2VDHA 1GEHA 2VPXB 3Q8RB 3PX6A 2DGWA 4DDFA 4PG4A 4X4UA 2WCXA 3UDLA 3UCZP 1EQ0A 4I67A 3IS9B 4H4OA 2QX0A 1ZYQA 3K58A 2PEBA 4LVNP 1NKBA 3TEGA 4HR2A 5D6GA 3DXBA 1LXNA 4AL5A 3MM5A 2DGTA 2ZKTA 1HNWF 2V69A 1TKZA 2LU1A 2YKMA 1S6QB 3HJVA 4OMFG 5KFUA 4ZLNA 1LK7A 5J2MB 3PKYA 3TJAA 1NDLA 2V5HG 2W9BA 1PJ6A 5J1NA 5HROB 2VDIA 1HNIB 2DGSA 1LXJA 1LQ9A 5B0DA 2GJFA 4J5OA 3H5UA 3CF5Q 2EK1A 3LQVA 4KT0C 5ETQA 4JI8F 1T03B 2ZZTA 3PY8A 1S9FA 2XGPA 3TQEA 1C1BA 3ZO7A 3HK2A 2GNKA 2HZCA 4NLVA 4U67Q 2AMCB 5KG2A 2XYGB 2MYFA 1JXVA 4NYOA 4B9SA 3B8HA 3IR6B 2J8SA 1RI7A 1VR6A 2CPEA 1IKWA 2HBYB 2X3DA 4DPYA 3KTQA 2RF2B 2B5JB 4M5HA 1U8SA 2CPXA 3BKFA 3FRZA 4H4OB 4HLBA 3UI3A 4YB1P 4V19J 2DY1A 2M3DA 1RBOB 1JLGB 3RB6A 1JKHA 4LRCA 2HHSA 4M1KA 1TL7A 2AZ1A 4BBYA 5HP1B 2M2BA 5B0EA 4JV5J 3QT5A 3CCUS 5IQ6A 1WI8A 1N8RT 4OJ1A 1SBRA 4ZVRB 4J9SA 2UXDF 2UUBJ 2HNYA 2OSRA 3QLHA 3PJXA 2XNQA 3NLCA 2QIFA 2DXEA 2AEFA 3KNGA 3NKYA 4C6AA 4UOFA 8RUCA 2DPJA 2E5IA 2QE5A 2CPDA 2BR0A 1KFDA 4M5DB 2EC0A 2QL7B 3DOKA 3KXDA 5AXMA 3DLLQ 1N5VA 2HVEA 3PX4A 4NLUA 4JV2A 2BE2B 2M88A 3HVAA 1RCXB 4ILLA 2RS8A 1FD2A 4DUYJ 3VQSA 4KPYA 3BJYA 3A3PB 1RK8A 1IBLJ 2L41A 3T3FA 4JI0F 1TKZB 2C2OB 2YKMB 3E01B 4OV1A 4RJVA 4DOZA 4GVBA 4QYZJ 2RKIA 5DRKA 4ZOSA 2WB1D 4RUHA 4IFYB 3TJ9A 2RS2A 1N56A 2RNEA 5LSRA 4LF6F 1YRXA 2YWEA 4RWXA 2BJ1A 1LFPA 1RT3B 2KT3A 2B51A 3HZGA 2M7SA 1SQEA 2Z2MA 1HPZA 2G1HA 1WHVA 2KXFA 3LPEA 3UW1A 2DR9A 4PWDB 4W4MA 4C8YA 3LWLA 1VRUB 2YKOA 4JI4J 1UJ5A 2VBZA 2FJXA 2NXCA 2KHCA 2XSJB 4KV8A 4CWBA 5A6PA 2A18A 3CCMS 2OPRB 2MMYA 4DN0A 2DITA 4LF1A 1VQ5S 2HGLA 3I5AA 1S9EB 1XMBA 1GK8A 3W5XA 1CC8A 2XMAA 2WW8A 3GILA 2G9OA 3MPYA 3ILOA 2RSQA 2C3OA 4X4RA 2DGVA 3C8YA 3WDOA 1T02A 1VQ8S 4DSKA 4LF4F 2MQNA 3SV3A 1F1BB 4PRFA 4B3OA 1ZA2B 2C3PA 3WC0A 1N32F 3GSDA 1FHTA 1HQUA 3FJ2A 2OO4A 4QIWD 1CSJA 5KG3A 4K0KJ 1WC3A 5E2QA 3MR3A 1SL2A 2DPIA 4Q44A 4FXDA 2ZWOA 2R7TA 3M32A 2AEMA 3DLEA 1HR0F 2NPIA 1AXQA 1ZM3A 2RB7A 4PQAA 2JEIA 1P27B 3S01A 1IUJA 2P8IA 4X64J 4C4WA 1OJ4A 2JSXA 5GMEA 5HI7A 1NHUA 3M2RB 3EZ5A 4DPTA 2E1PA 5A8KB 2J76E 2PIIA 4DUZF 2ZDOA 3CD0A 3IMQJ 3UCGA 2KJVA 2QTWA 1XR7A 1RDRA 2HS4A 5J1EA 4HHHA 3MAHA 3R1LA 4ECXA 1Q7YT 3ZTRA 4Q5VA 1RISA 1PJ5A 1C0UA 3LAKA 5DS7A 1XK8A 1JXEA 1XBWA 3HHKA 2AX0A 3PYGA 3JTNA 3Q83A 3G96A 4F67A 1U1PA 3CC4S 4K4SA 1G2EA 4X64F 2NSCA 4I6WA 3O44A 2R7QA 1FXDA 4WFAQ 4DR6F 4TY8A 3BGLA 3UVJB 3BQ0A 1NZ8A 4NA1A 3WHIA 3KHHA 3CO0P 4BHQA 3DLBA 3M7VA 4NPOA 4UOHA 3I4PA 1SQGA 4YB5A 4JI0J 3E3XA 5KFBA 1XTZA 3K5NA 1VQSA 1TKXB 4PUOA 2HVDA 2DH7A 1J2VA 1F2HA 1C1CA 3LP1B 4IYQA 3NNCA 2A2DA 2ZH6A 2XMMA 3MECB 2XMJA 3KLGA 5EHHA 1QAJA 3LGHA 3NNAA 4B3OB 4UT4A 4DV5F 2V9KA 3SQGA 3A12A 2G13A 1KLMB 5DDQC 3MEGB 3KUHA 5A0YB 5EWGA 2BE9B 4B08A 1GMWA 1MN7A 3EPGA 1SUQA 4J9KA 2YH1A 3MOZA 4IFVA 5GVQA 3KHRA 2IMWP 2GS8A 2DH9A 3HVWA 2R8GA 2Y8WA 1FT8A 2V4JB 2JC1A 3D7SB 3QT7A 3EGWB 3R5BA 4HH1A 3IRXA 4R8UA 2FB0A 3W2WA 3MPWA 2IDLA 2QGFB 4IOCQ 3D3BJ 1YJRA 4ZN3A 5MLCV 4EWTA 4EZ9A 1EAYC 2DHXA 3OL6A 1TUGB 3MM6B 4QZVB 1X5SA 2GMJA 1ZZNA 4DX7A 1UVLA 2IRUA 2MKJA 2VASA 2A10A 4XO0A 2ILYA 1AW0A 2CPHA 3KK3A 3R1HA 2FY8A 5AJ3J 5CXTA 4GRSA 5L8RC 4JI8J 2G2ZA 1TAQA 2NXUA 5KFIA 3VGTA 1XNQF 1RHUB 2LQ8A 2MKSA 2V63A 4ZJQA 2UXBF 1UPPA 2DKOB 4IG0A 5SUHA 4KB7A 1ZBTA 1N0UA 4ZCKA 1IBMF 3OTBA 3GLJA 4LR9A 1HNVB 3POTB 1F0XA 2EBEA 4ZVGA 3HXMA 3UWTA 3DKDA 3H0PA 1M1KT 1Q78A 5E3AA 2UVVA 2QRRA 3C15B 3N01A 4P72A 4NLRA 5FIIA 1CLFA 2FLNA 4TN2A 4Y00A 2E9ZA 1S6PB 3CMQA 3HSGA 2VFTA 4FZVA 4A8MP 3AA8A 1U2CA 1TR0A 4ZKAA 4DL2A 3UVJA 2MKCA 1IKYB 4L72B 3J81U 2NLWA 3I9ZA 2RU9A 3IS9A 1HI1A 3IBCB 4TKTA 2CNOB 1FDBA 1RT4A 5L46A 4NLGA 3GFXA 1FTCA 1FO1A 2CPIA 1TMJA 3TI0A 3DRXA 4RNMA 1KVKA 2R7UA 4RW9B 2DRAA 2AJ0A 4C9DA 3VQTA 1WI6A 4WFZA 3OR1A 4B9TA 1UVKA 2V34A 3DOLA 3HZEA 3BF4A 3ISNC 3SIPB 2Y1JA 2QLJB 1URNA 2H5IB 4C98A 4HL9A 2A3JA 3M6XA 4QIEA 1TQLA 2W2OP 3O3LA 4LBHA 3KLFB 1IJEB 4OZ0A 5GMDA 2XB2D 1N5TA 1JB0C 4KKOB 3J7A1 1FDDA 1GT8A 4HH0A 3Q8PB 3PX0A 4URSA 2WSCC 3OV7A 4N56A 2KT5A 3F73A 3SCIE 2ZHBA 1EETA 1U0HB 3RW6A 3MEEA 5IFMA 3HHLD 4P71A 4F4AA 3NS6A 4DPOA 4PR6A 3H4DA 3U27A 3A4TA 2HRYA 4ZIVA 3IRWP 2ROPA 1VFJA 3I9V9 2FJDB 4WU2A 1QJHA 4ANEA 2LEBA 1RYSA 4QCLA 4ZVOB 1SCJB 4I2QB 1IKYA 2RMLA 1MU2A 3I0SA 4CLPA 3KK1A 4DS5A 3G6YA 4OZ5A 1U0SA 4YB6A 3AOCA 5LSOA 4ERDA 3KG0A 2IJNA 3NRBA 5I3UA 3ENWA 3MHYA 3GFHA 3MAQA 3HKWA 1WC6A 3TOQA 3OSPA 5D3GB 3AJDA 2GGPA 2E5LJ 1XR6A 4PAAA 2CQ0A 1SI9A 5HROA 1HD1A 1U2FA 3VZIA 2W9BB 2D7SA 4ZCLA 3EE3A 4P7VA 5LT5A 2KKHA 5B7WA 2EFNA 1AZSA 3MMBB 4Q2LA 1KTQA 2D9OA 3MCSA 1RTHA 4P2MA 4JBCA 4NMLA 4ZPTR 3GCXP 1Q82T 4KGKA 4KGZB 3T1AA 3OVAA 2CPJA 2X1BA 2ZC3A 3IGVA 4MK7A 2NXNA 3ZNJ1 4HDHA 4MKYA 1FJGF 3BREA 4OHWA 4CNYA 1UCNA 4O4RA 1UTAA 3BGFA 2BEFA 1MWQA 3VF0B 2RT3A 3PEJA 3KNAA 1L3UA 2BKPA 2PMHA 4L73A 4I4BA 4OL8A 5D78A 2H1YA 1BD6A 1OSDA 1TZ0A 3CW2C 1RAHB 4ANDA 4DS4A 4ECTA 1I94J 3G82B 3JQKA 3ZZUA 5HMXA 1QD1A 4ECZA 2FDNA 3HX9A 4L6V3 3IWLA 1HBMB 1OIAA 2ZWPA 3AJ1A 3QAEA 1RT6A 1DRZA 4F3OA 4F4KA 2J5AA 3ZTQA 2J0SD 1D9FA 3OXFA 4OZNA 3K8VA 3SQGB 4F3MA 2LCWA 2BJ8A 3FBFA 5BYRA 5JJBA 5LJ3Y 4DV2F 4CO2A 4IOBA 3G4SS 2VBYA 5B09A 1S1UA 1S79A 3OJUA 3GIIA 3JSMA 3G8QA 1Q1KA 5G4DA 2CQ2A 3GMGA 3RW7A 5LJ5Y 2H5JB 4O3OA 4NLTA 1UWAA 3L4BC 4TU9A 2ZUAA 5L9XA 1PC5A 5CQGA 1X5TA 1F6TA 4Q0BB 3Q23A 1RWVB 3D3CJ 4RW4B 1HBMA 4IO9Q 4X4OA 2MPUA 3H2UB 1VI7A 4FVMA 2B4OA 2CQCA 5KFOA 3MPUB 2QN6B 3X1LB 2C2RA 4FNIA 2CDRB 3HD1A 4OJHA 1IXKA 1P9YA 3PCOB 2MLZA 3PFEA 2CJQA 5G0RA 4ZN1A 2F3JA 2HWIA 2WBRA 2E9RX 4FYVB 1AROP 1H2UX 2WVDA 4OZ2A 2BQUA 1N4LA 1FD8A 3TA2A 3JXOA 1VQ6S 1C1BB 1JNRB 3NXZA 1J5EF 1CJVB 1H3DA 4XDDA 3N4WA 3K0JA 3TUPA 2JWNA 4DQRA 3JSMB 3LALA 1Y10A 4DV6F 2ZEJA 5A8KA 1RHQB 3D0IE 1VOMA 4NZ6A 1NZAA 2HKEA 1N36F 2WBMA 3M2UA 4LSLA 4UZCA 4JI4F 1RBAA 2YKAA 2KL8A 4QR0A 3BQ1A 2XLKA 1KNZA 3W66A 1VQPS 4GKJF 1XQIA 4LVOP 2WOMB 4LRDA 3NGSA 1I1GA 2XCAA 1OMSA 4CLZA 1I6JA 5KG0A 1U02A 5BXIA 2KZZA 1HI0P 4YN3B 2QZ8A 2OUGA 2V67A 3SFUA 5C2GA 3NAIA 5AJ3F 1QTNB 2JH3A 3M2VB 3R7NB 3FBEA 1U1RA 1H2VZ 2U2FA 1BWVA 3VVUA 1NDKA 3AB4B 4QPTA 4DR7F 2AIRB 1VQNS 3UN5A 3US5A 1KOOA 1Z2ZA 4DV4F 5CCMA 2Y8YA 1V6HA 1WHWA 3OR1B 3PZPA 4Y2CA 2MTLA 4RW8A 3SFGA 4M5IA 4JI5J 2X1GA 5F3TA 4IH5A 2KZMA 2CJYB 3TZXA 3LOUA 1S1VB 2LA4A 1URRA 4OIXA 3ZZPA 4OLPA 2H9ZA 3G6XA 2F8MA 1NUEA 3ZZZA 1VK3A 2OGUA 3TVYA 5A6WA 5M2RA 3OTDA 1LWCB 1PIEA 3K17A 4IH6A 1KQFB 2JHEA 5AE3A 1VBKA 4ED1A 3AQPA 2ASLA 1R43A 3V6HA 3IWNC 1S9GA 5H9EK 2JX2A 1X4DA 3BBFA 1KDNA 3RRGA 3W9HA 3AOBA 5D4OA 1YJNS 2WONA 3DOKB 2VHGA 4DFJA 3R3TA 1DFDA 2PC6A 1WG5A 2IM0A 3HD2A 1KQGB 2RVJA 1OO0B 4OX9J 3UR3C 2O3DA 3MM8B 4USKA 2ILZA 1RWNB 4A8QA 4AFFA 3Q8SB 2G0CA 5D77A 4FVCA 3TYTA 1F9HA 2FVCA 2RQ4A 2QLWA 2YKQA 4HTJA 1RWMB 1XEZA 3NGKA 1J5EJ 4ED0A 1JJHA 1H2TZ 2EK6A 3L95X 3QAUA 4X4TA 5LMNF 3Q0AA 3V4MA 4JV5F 3CXCR 1S97A 3A1YG 1SC3B 4QYZK 3MEKA 2DBBA 3G9CA 2QT7A 4NXNF 3PVXA 1K1QA 1RACB 2E5HA 4OFZA 3QJLA 3RRHA 1NDPA 2GC8A 4HT5A 3G82A 5HJXA 3FKBA 5JVHQ 2R7XA 2HIYA 2XZDB 2F65A 4FKYA 1UVJA 1UVNA 5HAOA 4YS2A 3GQCA 5IOLA 4W90B 7AT1B 1TUWA 3IBWA 3DM2B 2R2SA 3JTOA 4ECUA 2XS5A 1N5YB 2IRXA 2CPFA 2WB4A 1Y11A 1NH7A 3AJ2A 4TVAB 2ASJA 4DWIA 4C8MA 1N5YA 1LV5A 4K0KF 2LQ5A 4G1PA 4P2SA 1EHWA 1FNOA 5KFTA 2RH3A 4GKKJ 3IRXB 2KT2A 2LU2A 3VZHA 3VTIA 2HQ3A 3QNWB 5C42B 1AZSB 3MMBA 3CJKA 2EPIA 4JI2J 2VD3A 1RLCL 1Q16B 4DR4J 1SJ1A 3BDPA 4KE5A 3T6JA 4RBVA 1CG2A 1TL1A 4LBPA 4K50A 2KB2A 2CJBA 1WWHA 2MSSA 4U7UK 1PYSB 4WE1A 3A8IA 1AUSL 1N33J 2UVUA 2BQ3A 4LFCF 3K5MA 1DQAA 2QO3A 4PWWA 1QTMA 4K59A 2CQGA 5E3CA 2M5YA 4IG0B 1VC0A 3MXHP 1ZS6A 3DOMB 2X3GA 2UV8G 4E2FB 1HYSB 3CD7A 2CJAA 3TUJC 3RTVA 2UXDJ 3HJFA 2KHDA 5J2MA 1FF2A 1REGX 5KFWA 3L3CA 5F0WA 2QLFB 2U1AA 5KFVA 3ADAC 2QA4S 4NX9A 4F4XA 3OLBA 1F3FA 4LBIA 2CQ4A 1HQEA 3BZQA 2G4BA 1H74A 2GVDB 2NUUG 1LOUA 3QGIA 5E5NA 3RGIA 3PW0A 1VS3A 4LUBA 1B64A 2OP5A 1Q95G 3HCXA 5DQGA 3CWJA 2PI4A 5D4PA 2RQCA 4TQSA 1TL3A 2OPPB 2K2PA 4IR1A 3DOLB 3P4UB 1GXUA 1YRUA 4DL4A 5EUHA 4GKJJ 4LRAA 4PG7A 3KJVA 2D9PA 2EFOA 2NQPA 3CCWA 2ZH4A 1BQMB 3KLEA 1Z1ZA 4J9QA 4ZVEA 3CT9A 3ZZTA 4MIAA 1UEUA 5LXYA 2ALZA 3CEDA 2RRAA 3PDNA 1LWFA 2PEHA 5J2PB 1MW7A 1Q79A 2HFVA 2VUGA 3FVYA 2QA4G 3H98A 3ISND 1X4GA 1BLUA 3Q8UA 2R2TA 4M5GA 1VGYA 2EVZA 5KFQA 3DLKA 3M6UA 3CC2S 1OYEA 3FSYA 1YITS 2NXEA 4N41A 1LWXA 1TL4A 1KS2A 2QEXS 4LSNB 2GQ2A 2HGNA 4R0EA 3H25A 4X4VA 1PBUA 2FHJA 7FDRA 1OPZA 5F41A 5FJ4A 2JOQA 2KXHA 4ZP8A 2YKNA 5BJRA 3V81A 4ZPWR 1ZTWA 2QLBB 2ZVSA 1H98A 2P9CA 2VBXA 4FDFA 2FZKB 2Y0BB 3CE8A 4OI6A 4QIFA 4LF8J 2RHQB 5HO4A 3I55S 1DQ8A 4P75A 3TRGA 4F4ZA 2CYYA 2LDIA 2BM1A 4A46A 1QE1A 3F56A 2LQBA 1BMQB 1VMBA 5LL6d 3M8PA 1NK4A 2F40A 2FUG9 2C3YA 3WBZA 1FXRA 4ZLJA 5KFKA 4KSEB 3OTOJ 4UY8T 2EC2A 2ZBCA 1S7IA 4LRFA 5D0GA 4OX8A 3THVA 2HNZB 4C11B 2MHEA 1FKOB 1G6BA 4ZPDA 4J9PA 3G6ES 3IG1A 1MU2B 3I0SB 3MD1A 2KRBA 3HT0A 4QOTA 4OI1A 1RP5A 2YVSA 4GMKA 2GIQA 3PW4A 2IA6A 3Q2TC 1NSAA 2GHWA 1FVSA 2H48B 4NZ0A 5I42A 2MKKA 1QY7A 1Y5LB 4NEYA 1CC7A 2B9YA 2EKYA 3R97A 4YDDB 1NSPA 1NNDA 3H8YA 1GAOA 3HVTA 2AJ2A 3OFHA 5DO2A 1U4BA 1RU2A 4MYTA 5T7LB 1FNMA 4KGVB 3DLJA 1D9AA 1BUXA 3A3OB 5EDWA 5HP1A 4LF9J 3HHEA 5KFAA 2R2UA 3BV8A 2VG5A 1JLGA 1JQGA 1RAOA 1F9FA 3R7SB 5KG7A 3J7Z5 4DMZA 1VYAA 1FEEA 1N0VC 1RA6A 2HBZB 4NZ7A 4B9LA 1GX6A 1FEHA 1XNRF 3LP2A 4DV5J 3VALA 3LW5C 3BR9A 1VC5A 1IVZA 3EDRB 1SV5A 2ZNYA 3DM2A 3FUYA 3KDOA 1ZPWX 2UXCJ 3Q8YA 4OHYA 1RQ0A 1DY3A 1OS5A 4WTOB 1N6QA 1K1SA 3P49B 4ETXA 3OVBA 3H20A 4PXEA 1B4SA 4FF2A 2N4CA 1HHTP 1YKWA 3PRBA 1UVMA 3FRYA 2CWXA 3N6MA 2VONA 1I5OB 2EKNA 3BPDA 2UV8A 2WHOA 3CMAS 2MHNA 3PEHA 2UUAJ 1FFWB 4ECRA 1MSWD 4ZVSB 3RB3A 4K8RA 4URQU 2BANB 2EEYA 3BGUA 3ILIA 1WORA 4TXSA 3B82A 1R6VA 2MJUA 1XIQA 2E9TA 4OHVA 3CCQS 3TAPA 2KO1A 3NGRA 5CCLA 4WXOA 4U8YA 1AUDA 5J2NB 1LNQA 1VQ7S 1FDAA 3OXLA 4AE5A 1N6QB 3B54A 3PKMA 1S0OA 3AXKA 3VV2B 3PACA 3DHWC 3FEZA 2OSQA 2XM3A 1ZM9A 1FDNA 4L74A 3UDEA 3MMAA 1BE4A 2W2MP 4PEOA 4UQTA 3BBBA 1HW9A 3GIRA 3LP2B 3TNVA 1XNQJ 3AQOA 2XZTB 2NS1B 4A8XA 5KT2A 4UTGA 3ZTOA 1JK9B 3F41A 2EWHA 3GYGA 5M2UA 3CD6S 3GR1A 2ADBA 1RSCA 2HYIB 4OYIA 1TVRB 3PRDA 1L3KA 2PMWA 4ES3A 3EZUA 5DG8A 4ED3A 2ATLA 2XWXA 3VVTA 4WYLA 3CCTA 2WVFA 5C2CA 1NJXA 2W7AA 4W92B 1NO8A 3ZZ0A 4JI3F 1NKEA 1W7WA 3BBCA 5B0GA 2POKA 3FK4A 1SIWB 3SCJE 3T9NA 1U6ZA 4ZIWA 3GE9A 5C24A 4BCAA 1JLQA 5KFMA 4MAKA 5ETTA 1ZPVA 1IWAA 3M1VB 4C97A 1DBDA 2W4PA 1ZOTA 2ZBQA 4DF4A 4WKRA 2EFGA 1F5CA 5B0BA 3RBDA 1BHNA 3DRPA 3ZXWA 4ECVA 1RAEB 1UWBA 3MR7A 1I94F 3W62A 1VQMS 2XMTA 3M8QA 3ZTSA 4TQRA 2XS2A 3RG6A 1PCAA 2RILA 3KFWX 2IYIA 3CD5A 4WP8A 1T9WA 1P9QC 1BQMA 2VFRA 3KLEB 3BDEA 3I31A 3LGMA 3POTA 3SCLE 3J7YI 2HFSA 1FWPA 1V3ZA 4HTIA 1GXLA 5CYQB 4CYUA 5GAEU 3K57A 2R8IA 1S77D 1F5AA 4DR2F 4IQMA 5J2QB 3OTOF 2K7KA 2YWHA 4NI2B 1NHKL 1JLAB 3OL8A 2GJIA 2VV5A 3OUYB 1IBLF 3M4XA 5FDLA 2HGMA 2QL5B 2FHMA 2HFNA 3DRYA 4B3MJ 4JYAF 1NK0A 2VKZG 2ZD1B 3FMBA 4LF9F 2HVIA 2B7BB 2MSTA 4PXBA 4RW4A 2UUCF 4KRWA 4F36A 5IC4B 1O5JA 2ZM6F 2R7WA 2BBEA 5DLGA 4A4JA 3IAM9 4CLLA 3IR7B 3T1HF 4QJVA 1N48A 3G8SA 4ED8A 2P9GA 4ZMMA 2C28A 2JJ4D 3B4MA 1XMOF 4IRCA 1F2GA 4IO1A 4U6PA 3DRRB 2AKWB 3MZIA 2HZAA 2C2EA 1IJFB 2EBGA 2JVRA 2IAJA 1GMVA 2DD8S 3BR8A 3I0RA 5FLXY 3PR4A 3OHAA 3JYTA 4KHPJ 3QRRA 2V50A 1RTIA 5KFHA 3PHEA 1D8ZA 3JYTB 4H54A 2DNKA 3QYYA 4AYBD 1CJUB 2MQOA 1E6VB 1TMMA 2EXUA 3T41A 4OLOA 4DR5F 2J6TA 2DNLA 3J80Y 4RNOA 4LJMA 1R8AA 4GC6A 1XMQJ 3LF0A 2AGOA 4USWA 2PA8D 4DPXA 4KV8B 2PO4A 3UNGC 1CS4B 5GAGI 4OYWA 4ICLB 2VG7B 2O66A 4UW2A 5E3QA 2ZD1A 2PD1A 5AE2A 5K9FA 1D0EA 4FF1A 2H51B 2DEJA 2IDEA 2D1CA 2E1MC 1ZM2A 1Y00A 1S1WB 5T41A 3DC2A 2OEMA 2FIUA 4UUWA 3D1OA 4N7TA 1KKHA 4K4TA 1IN0A 1SL0A 1GNKA 3JTPA 3RUBL 4EMDA 5B0CA 4IRDA 1NB7A 3MCOA 4LF6J 4DV2J 5A76A 1RWWB 1R89A 4JUZA 3M9MB 2Q3PA 1UW9A 3KJFB 3K7RA 4NLOA 1NJYA 1WDTA 3ET6B 2BJ7A 2RDIA 4AL6A 2IM3A 2IPOB 2IYGA 3PW2A 3KK2A 1AT1B 1IBKJ 2WVCA 2R8HA 4Y3CA 3LTOA 3QIPB 3ICLA 3FBCA 1EZZB 2XI2A 1E6YA 3ZZRA 3DLKB 2HHVA 3I56S 4HT7A 4USMA 2DGOA 4K4UA 1JJ4A 1RT6B 2EG2A 3ITHB 5IZHA 4C8LA 2W9AA 1UZDA 4CLWA 2MGZB 4RW7B 3QT6A 2QJ3A 4CM0A 3DLEB 4PWUA 5IV3A 2R7RA 4GO7X 3HT3A 2ZH5A 3B4DA 2YWGA 4B3TF 3IR5B 4WFYA 2HNYB 2WSEC 2YNIB 1RKIA 1WG1A 2V68A 3NCPA 3EXCX 3UO0A 1U1KA 2I9SA 3K5PA 1J5OA 1C0UB 1RADB 3W61A 4A8SA 3R7BB 4RU2A 4USVA 1L3SA 4YOEA 5L1KA 2R42A 3OBIA 4ZK7M 4RU9A 3P6YC 5GAHI 2V8PA 1FKAF 4BC9A 5DETA 2ROGA 3CJ5A 5KT5A 1UA1A 4CQ1A 5KTQA 3FFIA 4YR3A 4LIRA 2K3IA 4O44B 4RW6A 5D0HA 2R8JA 2P2CB 2BZ2A 1IBCB 2MZTA 4FF4A 2GAHC 4DUYF 2GCFA 4NCGB 1T0TV 2VF3A 2CNLB 2CKWA 4X66J 3M8RA 2VOOA 5DDOC 4QQBA 3CJ3A 3TARA 2FJVA 1R8HA 3EVOA 4ANCA 4ED7A 5DQHA 3PXGa 3W8PA 3CVKA 3IXQA 1RT7A 1WC4A 4ZLLA 1FE4A 5I3UB 2FHOB 5E7OB 4CT8A 3H42A 2ZUGA 2KG0A 3H2VE 4KAIA 3ONQA 4JI6F 4LFBJ 1RAGB 4WPAA 5KT6A 1TELA 4IDKB 3M8PB 4KR0B 2UUBF 1JLCB 5GMKa 2ZJPQ 3UQSA 3VAMA 3MM9A 4QWEA 2CADA 1GTHA 2GO8A 5L1LA 3OQ2A 4DR3F 1HMVB 4G1QB 3MEEB 3BEGB 2MZSA 4NOHA 4F50A 1U1QA 1SJFA 3CO9A 4DV1F 1SPBP 1H72C 1X4BA 4AD6A 2HFOA 4Y28C 1XN9A 1NK6A 2HHQA 1X0PA 2GAGC 5GADU 3NS5A 4KKOA 3FSXA 2XY7A 1K9MT 3FQLA 5AE1A 5DGAA 1F9EB 2H54B 3IM9A 2FGCA 1FVQA 1YX2A 1HLWA 2E5JA 2HIQA 2L9WA 2LYVA 2YQ3A 4MFBB 5KT4A 3M30B 1HD0A 3KK3B 1NRKA 3HSJA 2AGPA 2HHHJ 1ROFA 1XJWB 2HSEB 3GG1A 4CNZA 4YFUA 2XHCA 5L1JA 4FN5A 2B9XA 3F0NA 3P96A 2JC0A 1RT5A 3HLUA 1VK8A 3D1QA 3KG4A 4Y65A 2FVRA 2DTJA 3TR5A 2V2ZA 5BYQA 2Z58B 4LF2A 3N5FA 3V5RA 4CH0S 5KOXA 1K73T 1TFWA 2ZC4A 1B0VA 4X84A 1UFWA 1WC1A 4IFVB 4PCQA 5LMNJ 2J7KA 4Q7AA 5L39A 2CAJA 3PW7A 2ZH3A 2F5GA 3W3SA 2MJNA 2C22A 3MR5A 4FYYB 2D3UA 2HNDB 3ZC4A 1V9OA 4ZVTB 3AAWB 1R6YA 2ZH7A 5K20B 1KLNA 4CLKA 4RBUA 4LSZB 2KFYA 1M5KC 2FHKA 3OXGA 2WW4A 3HFKA 3EGVA 4O3PA 2ZM6J 1JMTA 1RAJA 1RWOB 1JLBB 3O6QA 4ZVPB 3SMZA 1KSPA 1VHIA 3KJVB 1V3RA 2MQ8A 4DV0F 1NKCA 2XS7A 1FKOA 4I64A 4QW8A 2IIHA 1UAWA 4OYZA 4ZVUB 1RXOB 5H1SV 4OZLA 1NSKL 4GO5X 2KYZA 1EIYB 2RUSA 1LW2A 2NUHA 1CJKA 2E29A 2PT0A 3RBZA 5EN1A 3DDKA 4XTTA 3ET6A 4Y2KA 1F5BA 1S0NA 1S76D 2XBPA 3D68A 3FNNA 5H9FK 1LEOA 1CS4A 2B9WA 3U1NA 2IVFB 4CT9A 2BRKA 2M8HA 2IM2A 1RUSA 1NAQA 1S57A 2L3MA 2QMWA 2YPZA 3NY0A 4I0WA 1QSYA 1RT2B 4LR8A 1N52B 2EFPA 2VZ9A 3EX7B 2IM1A 1QLNA 3CTRA 2FY1A 4ID5A 3JSYA 2ACYA 1CJUA 2K1RB 1U6FA 2PA3A 3MPDA 4OYBA 4J9UE 4WXWA 4RUCA 1RTHB 2MGZA 1RHMB 2K8GA 3DCAA 3PJWA 1IKXB 4ZPVR 3SXLA 2ACMA 3U02A 3MFIA 2JEJA 1YLXA 1YJWS 2M9KA 3ENVA 5T7LA 4OHXA 2VJVA 3VAKA 2I1RA 3R5CA 3HVTB 1U26A 5T14A 4DSEA 1RTJA 1TK5A 1NJIT 3FZBA 4O3RA 3QWUA 4YY3F 1TKTB 2D3ZA 3HSZA 3MD3A 4PUOB 4MK9A 2YWKA 2WRMA 3HFZB 3QFWA 4PXCA 3CJKB 4B17A 4FXWA 1WD6A 1YDLA 2IRYA 2PDAA 4DZDA 1JX4A 2HMIA 1RWKB 5H9FJ 1VBZA 2J7UA 1S1XA 4PYDA 1C2PA 1H0HB 2PMZD 4K4VA 1KHVA 1UEKA 1FERA 2BW7A 4I6AA 4PZVA 5B08A 1KTVA 1RU1A 5ITHA 4EYIB 1SJ4P 3N28A 4URGA 2G1DA 1FWKA 1SXLA 2MQLA 1KEKA 1T9TA 3WZ0A 4WFXA 2CJKA 1EKSA 4C3LA 1IBMJ 4Q8EA 1HNWJ 5KG6A 1A0OB 1JLAA 4C8OA 3QIDA 1S1TA 1B70B 1HBUA 6AT1B 4DFPA 2D41A 2OFHX 3NCRA 4USUA 4OV6A 4EUVA 3H5XA 2BA9A 2H4WB 1T3NA 3G86A 1SH3A 4A8OA 1YZ7A 2J9CA 2Y1LB 3N79A 3HHNB 2YX4A 2E44A 1ELOA 1CJKB 4RLEA 5KFPA 3T5KA 2JEFA 4F0MA 2OPSA 4CI0B 4ZHRB 2GGPB 2NPFA 4DL0C 3TZYA 1PGZA 4OYPA 2YWFA 3GFYA 2WTFA 3QQCD 2JL9A 1TTHB 3C46A 4ELUA 1WF1A 1FRKA 2AW0A 4USJC 3M8YA 1TU0B 4DI6A 3T5HA 2FVQA 1RT4B 1H7WA 2CIMA 2FD2A 4M8LA 4QIGA 2QSWA 3M32B 5KFZA 4DFMA 1M1GA 4DHVA 3CDBA 3AOAA 1BWEA 2XO6A 2CQ3A 2XMWA 1S1XB 5B0FA 4DR7J 5CZXA 5ETLA 1Y3KA 5C25B 1UKUA 2CG8A 4WJBA 5I3PA 4B9NA 3PRVA 1GMUA 3FC9A 5D0RA 3TA1A 1X5OA 1QSSA 4OI2A 1DTTB 4LREA 1TKTA 3M1VA 3MPVA 4ZHRA 1RCOB 2BUNA 1HHQA 3U1MA 4F4YA 2BJ9A 4LQ3A 2F7VA 1YRTA 1S12A 1REVA 2DB1A 2IBOA 4Y34A 3CCRS 1NK8A 2ZJRQ 4FF3A 1FX2A 4Y0FA 1W26A 4J90A 1LFWA 5K8NA 3UD3P 3EYZA 2AYGA 3ILJA 3UPFA 4EBCA 1SJRA 3PW5A 4O23A 2VG6A 2ZH9A 2FVPA 1FRIA 1FA0A 2DNPA 3D67A 2JEGA 1Q8BA 4NA2A 3DMJA 1HQEB 1MN9A 4I7FB 2B5JA 3JS9A 3R5DA 5HJYA 3I82A 1JLFB 2GO9A 1VQYA 4YY3J 4R0JA 3EMTA 2IHR1 4GVBB 1QUPA 4OJ3A 4F0KA 1UWBB 2DHHA 3DRPB 3FCVA 1WSRA 2XYHB 4OZ3A 3QATA 2AZ3A 4WE1B 4U8VA 1S48A 4CLFA 3CMES 1APSA 3NWRA 3D5MA 4F4WA 2E5LF 4NCBA 2FJWA 2BYCA 4KPCA 1HYSA 1PSDA 4YR0A 1OY9A 2MEWA 2YPYA 1WUUA 3DOMA 3TAQA 3QRQA 5KT3A 4RL1A 2YNGB 1Z4UA 1K0TA 4DX5A 3OT9A 4ITSA 2JRSA 2VFSA 2GZOA 3PNIA 4YQWA 1X31C 2GHPA 2YX1A 3AXMA 1N88A 1FRMA 3MM8A 1EP4A 5LSLA 3EZOA 3NP5A 2YQ0A 1U09A 2IC3B 5F0UA 5HN0A 3GV7B 2ZJQQ 3WC2A 4LF8F 1WF0A 3D1HA 4KIAA 4NCGA 4NE9C 2J6UA 4WKYA 1GX5A 1UFKA 1SV5B 3EVMA 2V4RA 3CGIA 3HHLC 1U0HA 3KMQA 1ZM4A 2HHTA 5BYSA 2AJ1A 1UPMB 3I5CA 4R25A 5CA5A 4B3SJ 3HHDA 1XWLA 2XEXA 2KFNA 3E2EA 2RQKA 1B99A 2CWKA 5A8WA 1AB8A 2HLUA 2K3KA 2ZNZA 3AODA 5CD4A 3Q8QB 3ETMA 1XMOJ 1N34J 1A7GE 2F4VF 2BJ3A 1IR2A 1OQ3A 3QPIA 2CPYA 4J7CA 1M0SA 5I3QA 3R5GA 1EJ7L 2Z4PA 3J7YU 1Y9OA 1DARA 1S49A 4FPIA 3MR2A 1KC8T 3RBEA 4CYUB 2I0XA 2IC3A 1FCAA 2E1AA 2QMXA 5DZ6A 2G0JA 2W8LA 1KHWA 1R8CA 2ZE2A 2MZJA 3KHGA 3C3LA 3QJPA 4Q45A 4Z2XA 1T11A 1SKSA 1QSLA 2NZCA 1DQ9A 3PYDA 3A3NB 3V6JA 4K2JA 2YNHA 4XDCA 2KVIA 2VL1A 4DLGA 1UJ4A 3IN5A 2ADCA 1E6YB 3T19A 4OI0A 2HQDA 2LA6A 1VISA 4ZCMA 1S6PA 2NZ4A 3W65A 4P9SA 2B8QA 4E98A 1KONA 3MDFA 4J9OA 3RB0A 2E7XA 1TK8A 2ASYA 1KN6A 2OEJA 4J9RA 4FP9A 4ELVA 4ZVHA 4QIVA 2ZOMA 8AT1B 5EWFA 2LECA 4U9RA 2RU3A 4LIWA 2KFZA 4RZRA 1FJ7A 4TNOA 3MM5B 2ZH2A 4PQUB 2CPZA 1HHSA 4F04B 3UNYA 2XY6A 2UU9J 2ZDPA 4F2SA 1ZAWA 1WKKA 2XO7A 2AU0A 2AGQA 2LMIA 2OELA 3C6UB 3GR0A 2G2OA 4M5KA 2YWWA 3W8GA 2CZ4A 4F0HA 5DLFA 5LOQA 2I38A 4DR4F 2HHWA 3QGHA 3GFZA 5G0RB 2UZAA 1FE0A 3W7BA 4ID8A 4O44A 3HF5A 1SKRA 2OD6A 1T05B 4LSNA 2FLLA 2BJDA 4CO3A 2BV3A 2MDAA 3UD5A 2N4DA 4HDGA 5HLFB 3IGNA 3VGSA 4UOCA 1NB2A 3DI6B 4FXVA 4KC5A 4QWCA 1M5HA 3BN4A 1RWXB 4CLTA 2FJAB 4R5PB 1X9WA 4ES2A 2Z0GA 3DDNA 1W2BR 3LP0B 4ED4A 4FNHA 2XMVA 2H5EA 1D8YA 2KH9A 2OTLS 1GFWB 4C11A 2VIHA 2MKIA 1RTZA 2NREA 2AJFE 3KLGB 3GU0A 1YBTA 2C2ZB 2BW2A 2AHOB 2WOMA 5AXNA 4RW7A 4WZQA 4NMXA 4QWDA 2V8GA 2BE2A 5FD1A 2HK3A 4A8WA 4NYPA 3I6PA 1WEXA 3NGUA 2L48A 2V8VA 2FPHX 1VQ9S 1KD1T 5HQMA 5LXRA 2KYXA 3QIPA 2DNQA 2FZGB 3PJ9A 1DAXA 4M63A 3K5LA 3BSOA 2BM0A 4QWAA 2C2KB 4WFBQ 4GKKF 2V8HA 4CTAA 3KLFA 5LMUJ 3EXYA 4CLSA 3ZNUA 4IKAA 1U45A 3DGPB 2V2VA 4BDPA 3O2IA 3I32A 3P45B 4KGMA 4Q43A 3KJNB 4LF7F 4JB8B 2OAUA 3CJ8A 4DSIA 4QR1A 5KG1A 1S59A 5KFRA 2O67A 1GMWD 1X9MA 4B9VA 4MKVA 4OI4A 4UOGA 1NDCA 3D0HE 4O3SA 4M5JA 4NCAA 3CUNA 3TVZA 3C19A 2W2NP 3I96A 2DRDA 5KFXA 3J80U 2VG5B 1HWJA 2ZVIA 1PAUB 2QMUB 3OR2A 3J7ZT 3RAXA 2KXNB 3AB2B 5KAKA 1QUVA 2YKPA 3NMRA 2DNNA 1TK0A 3HSDA 1HARA 3A8EA 5KFCA 3P8BB 3RYLA 1SJ3P 4FS1A 1FJCA 4ZPBA 5D3GA 1JXLA 4DQQA 2J0QD 5IQQA 4DEZA 2E1CA 2AF6A 2HAIA 5CHCB 1SB6A 2HURA 3QLHB 4DPWA 1CJTB 2EI5A 2R7OA 4HI1A 1TL3B 2OPPA 2IAJB 1KWMA 1HNIA 1R7IA 3AHPA 3I0RB 1R3NA 1S7HA 3UFCX 2VQFF 4K5SA 1NLKL 4D3GA 4ZVFA 1S1WA 1Q8IA 2AYBA 1MMDA 2J8AA 3VWSA 3GP9A 3UDVA 4A48A 7FD1A 4DQPA 4M95A 2RF2A 1CULB 3MMCA 4RNFA 4UQGA 4Q8FA 1H7XA 1RBLA 2VPZB 4B3RF 3NL0A 1N33F 4DV6J 1DZ5A 5LM7E 1YBAA 2HBQB 4TYBA 3NS7B 2QYGA 2B4VA 4DLEA 4C8ZA 4DV3J 2VA2A 4Y2AA 3FEXB 5SZTA 1Q8KA 5HL7Q 5IT9U 2F9JA 5DZ7A 1EQMA 2CQ1A 1VJWA 2F1FA 2H3EB 3FQKA 1VBXA 3SCKE 4K2XA 2HVHA 4IFYA 4DCPB 2KN4A 3ENAA 1IKVA 4ZLPA 3H2LA 1R27B 4PQUA 2WVEA 4I2QA 3KLVA 4DZ6A 4MYUA 1R0AB 3RZAA 2N82B 3HKZD 4PG6A 1HWLA 2VKRA 3G2XA 4DV7F 3RR7A 4E0DA 1BGXT 3R6LB 4O0NA 4MKBA 4B9UA 1Q4RA 1LKZA 5D4LA 4AXIA 4ZJLA 3PR5B 3CCZA 4DSJA 2DR6A 1BQXA 2WZ1A 4DG1A 3BKTA 4WK1A 3NWGA 2UUCJ 3K59A 1JLEB 3KJQB 3OFGA 3JSRA 1T94A 3EWGA 2JDJA 3K8WA 1RWPB 2GVZA 3MAAA 1NU4A 1TV6A 2VB6A 5CZVA 5ETNA 4DXLA 2XQCA 1VQ4S 1IKVB 3T6BA 1BQNB 3ILLA 2X51A 1FWLA 4OYMA 4TU7A 4W98A 1VQKS 4MK8A 4NEZA 3CJRA 4UY85 4FYDA 2BACA 4C8KA 2I5JA 3LAMA 4J91A 1P6TA 4NLQA 2GMHA 5JVGQ 5J2QA 3OLAA 3M8WA 2ALYB 3FBBA 2MQPA 4CIOA 5AXLA 2MLXA 3RU0A 1FJEB 2V9WA 2FLOA 2M0GB 2CQPA 3NBPA 3ZFVA 4DUZJ 2HEKA 4NLYA 4YHHJ 3CIZA 4OJGA 5C25A 2ZZMA 3GPAA 3BS9A 3QT8A 5F8GA 4EZ6A 1RHJB 4YR2A 1YHQS 1XNRJ 1PJ7A 2M70A 1RKJA 1JJ2R 3N0VA 3OFEA 2GVZB 2R9LA 2CQDA 3GIJA 3F44A 2YX7A 4RWWA 4DG1B 5C24B 4B3MF 1O6XA 1RJJA 1SJQA 1HNZF 3Q24A 3TVKA 3THPA 4USIA 2N3OA 3EDQB 4EU0A 3W1YC 3HPOA 2A1BA 2DXDA 3K89A 4JI3J 4CDIA 4J9NA 1QAIA 3V6DA 1R8BA 1TL1B 3A8JA 2DYAA 2P6SA 3U7JA 4B9MA 3D6HB 4C3KA 3MM6A 3ZZYA 2QFIA 1XR5A 1T8EA 4HKQA 1YJTA 3JQMA 4PABA 2LEAA 3CC7S 3CNQP 4DR1F 1FI4A 1S1TB 2YQ1A 2GW8A 2PE8A 1FRHA 3EVWA 2MKHA 2V4JA 3FMWA 3MI7X 3V81B 3NNHA 2GV1A 4EFAC 1DTQB 2D69A 3HULA 3D6TB 2BKNA 4QBUA 3E8OA 2RQMA 1N36J 1S0VA 3PFOA 4I1TA 2DNRA 5BR8F 2OFGX 4D3HA 5L1IA 2UVWA 3R6GB 4DSLA 2D3O1 2IJRA 4ATNA 3BYPA 1Q81T 2C2DA 2FJBB 1HBNA 2GIFA 1PG5B 1BXNA 1Y5NB 1ULRA 2OI2A 2IJFA 2DIVA 1U48A 5K5MA 4WFNQ 1WEZA 1C1CB 2W7PA 4K4ZA 1HNXF 4BWJA 1OPIA 1HA1A 2DK2A 2J0XA 3M2UB 4AL7A 1CJTA 3GSIA 4U7UD 3VR1A 3MTJA 1ZTTA 3BM7A 3KLHB 1JNZB 3AD7C 4WZMA 1EARA 3MECA 2ZITA 1B0TA 3MEDA 3BPSP 3R5AA 3OTEA 3HFVA 5E3PA 3C16B 4HYKA 2N7CA 1DHMA 3O5TB 4WP3A 3W9IA 4LF5J 2OTJS 1TKXA 1BY9A 2ZKUA 1U25A 2RAQA 3SEOA 4P74A 3SSSA 4DV3F 1T9XA 3TX0A 4CH7A 3OR2B 4J9LA 3E51A 3MUTP 4DR6J 3RJMB 2KJWA 2QSFA 4O4GA 2UXBJ 3PIPQ 2P5VA 2PN6A 2W2PP 2HWTA 2HQFA 1IR1A 3IA0A 4TLQA 4AQYF 1PILA 1G4CA 2G2YA 5H9EJ 4F8RA 3X3UA 3HHLB 1UVIA 1Y3JA 4DQIA 3R8YA 3VGUA 1J27A 2C3MA 4EI2A 4NI2A 4OYAA 1NJWA 1JWWA 1NK7A 1VQOS 2NYIA 5IC6B 4ZVQB 4P2XA 3QBCA 1NMEB 3GJRB 2UU9F 1R31A 3BSCA 3GYNA 2YKNB 3C16A 1CQNA 3C6UA 3DXSX 4L76A 1HW8A 5D0EA 3GB0A 3Q8VA 3HVRA 3HO1A 1Y7PA 4NXMF 2EFVA 1C4CA 4CRJA 1TAUA 1LWEB 1RE1B 4CO4A 1ACMB 2RD5C 2HAFA 2ZHAA 1FX4A 3DLGA 1VRTA 5IM0B 1I51B 1YGYA 2Z2LA 3C14B 2MZ1A 3K5OA 3MM9B 2UXCF 2HVZA 4DR2J 4CO5A 1MMLA 1P8GA 2XHWA 1VDHA 1Q5VA 2BRLA 2CJ9A 1R0CB 4IG3B 4OI3A 4WIIA 5HVHA 4U95A 3VAIA 5HLFA 4PKDB 4N8NA 3BB5A 4KQZA 1EETB 2FGOA 1NCLA 2VC1A 3RB4A 1C4AA 1RT5B 4NLWA 3VGVA 2WK4A 4O3QA 9RUBA 3LUYA 2XMUA 4USTA 5ETVA 3FGVA 4YHHF 4B02A 2OHDA 2GJ2A 1JJCB 3UN2A 3GIKA 1VLOA 2OMOA 2PSZA 3D66A 1FRLA 5C7PA 4JI6J 2VODA 1SC6A 4QYRA 1QAYA 1UETA 4FBUA 3R9LA 3LPYA 2DO0A 4WF9Q 2MXYA 3AA9A 1X4FA 1U49A 3A13A 3CCSS 1BC6A 2G0IA 2F9DA 2Z57B 1V3SA 4KH0B 4Q2MA 4ZPAA 3UN3A 4DR3J 1FKPA 4I2PA 4MMOA 2OKQA 3J7AN 1HMVA 4G1QA 4X4SA 2GA7A 3RAMA 2XG8A 3KOAA 2DNHA 2KTQA 2AYMA 2IVMA 1JLEA 4QW9A 1T9UA 3W63A 3VAHA 4P10A 1EKRA 1S5ZA 1FESA 2A6MA 4O4GB 2R7SA 3M8QB 3KLIB 2FC8A 3G87A 3KG1A 2LEPA 5C5JA 2Y1IA 4B3TJ 1RAAB 2AT1B 3MTKA 3ULHA 2I2YA 3BH7B 3GCWP 5KFFA 3GV8B 5IWAF 2DNOA 2GHVC 3N9UC 1JLBA 3V6KA 1N34F 4BS2A 4A8FA 2F4VJ 1RAFB 5ETSA 4EO6A 1WTFA 3VHQA 3JAMU 5HVGA 4N47A 1CQMA 3OPKA 5ETPA 3QO9B 1WJ9A 3QZ8A 1NJZA 2HFUA 4JI1F 1SVDA 1WNEA 5EWEA 3GG0A 4PXDA 1YIJS 5GADI 1QVFR 1MG7A 1T9YA 5HVFA 5HATA 1WOSA 2AP6A 3V4IA 1X4EA 1HNXJ 4UUXA 4LF4J 5F8MA 3MURP 5F8JA 2V2QA 1QAXA 3UDCA 1HIYA 3WX8A 2DGUA 1S1VA 3I4HX 4L75A 3TWZA 2DCLA 2E1RA 4G3IA 4GC7A 2H65B 5KFGA 2LP4A 4CO1A 2VQEF 1S99A 1U1OA 4R8UB 1J5OB 3CDAA 4ILRA 4H4KA 3EPIA 3CJ4A 1LW0A 4WTYA 2CG4A 2ZBPA 2B43A 4HI2A 4BLGA 1S10A 1HBOB 3TEHB 1D3WA 3M30A 4K7QA 1DTQA 5HK4A 3J81j 1PO6A 1MROB 1VHFA 4H4MA 4U96A 3Q22A 1M5VC 4F2RA 3ZTPA 3UR0A 4ZA1A 3HM9A 4NXNJ 1NSQA 2HRTA 2AJQA 3P5TL 5JUMA 1UW4A 1CULA 3MMCB 5THWA 4DV4J 4MT1A 2O01C 5J2NA 1XMQF 2ZFHA 4WBFA 2DGQA 1NK9A 5EGYA 3TZWA 1MWZA 1YJ7A 5F8IA 4ECYA 1JLCA 1U1LA 2CQHA 5I42B 5CABA 2DH8A 3NGDA 2IBKA 4DL5A 2QFJA 1WTBA 4NRTA 1S6OA 1S6QA 1RTIB 2APOA 4X66F 4HACB 1X4CA 2EG1A 2VOPA 3DYAB 1X5PA 2O1PA 4PYAA 3CCLS 2R8KA 3S1TA 1WF2A 2DHAA 3EUNA 4HEA9 2K1RA 2MZRA 5EX0A 1VQLS 2W9CB 1SC1B 3HI9A 1H38A 1PYOB 2ZBRA 3CDWA 2KI2A 3AY0A 1QE1B 1N5QA 5CH7B 2OIHA 3QZ7A 2JFDA 1AA1B 1LW0B 2DNGA 4ICLA 2V8DA 2X1AA 1D9DA 2FVSA 1YK9A 3DGPA 1UJ6A 2E7WA 5L38A 1B0PA 4YEAA 2DEIA 3DFEA 3T9ZA 2OPSB 4P52A 4C7QA 2J7WA 3NBPB 3Q2SC 3G8TA 3CIMA 4JV1A 5ETOA 2DT9A 3Q89A 1U47A 3O1LA 1TKDA 2XYPB 4J9VA 2FTRA 1M90T 2NCKL 4F26A 2CZVC 3WX4A 5DGBA 2QG9B 1KLMA 1EB0A 5A0YA 5KFNA 3OVSA 5KFSA 2C2NA 2FHJD 3TP2A 2OPQA 3DHXA 2NR0A 3CULA 2Z2ZA 1O8BA 5K8OA 2MY7A 4LF5F 1T9VA 1O51A 1TP7A 4ES1A 1SC4B 3BO3A 3PTWA 5KG5A 1FK9B 5A8RA 4YB7A 1OYDA 1KOHA 1S6UA 1DTTA 4IQXA 3GTYX 4DU7A 2EW9A 3RRKA 2E5GA 2B6AB 3ITHA 2C42A 2WSFC 3JSBA 3KKFA 5HANA 2PI5A 2O5DA 3HP6A 3CJSA 1KVJA 1U1NA 3BO2A 2AYEA 1G1XA 2JVOA 1IM4A 3L9ZA 2B4PA 1ZZFA 4IG3A 1B7FA 1SKUB 3PM9A 4F3QA 2HRUA 1LWCA 3MGJA 2QLXA 1SL1A 3LO3A 3MM7B 3MUMP 2E7VA 2HLTA 5CYJA 3T1HJ 3R2DJ 1NH8A 4F02A 4N76A 1VRTB 4J37A 5IM0A 2IVYA 3L09A 3W60A 3KMSA 5KFJA 3H4BA 4LT6A 1YVFA 4RW8B 2RIJA 3CJQA 2KM8B 4C8NA 1UEVA 1Q53A 4M5MA 1RTDA 1HPZB 4H4KC 2QC3A 2RDDA 2W24A 1RHRB 3U1LA 5DQIA 4JI1J 3D2WA 1Y4ZB 1YBUA 2WAQD 2CRLA 4N8OA 4DPUA 4IRKA 2GVDA 4XPEA 1ZAXA 1N32J 1VJQA 5GAGU 1KFSA 3RR8A 1TL5A 1PKUA 6FDRA 1R0BG 3H5SA 2HFZA 3MFHA 3SDEB 2X1FA 2L9NA 3NG8A 1VRUA 2C2MB 2JLFA 5ETMA 5KFDA 4MIWA 1M5PC 3TAMA 4ER8A 2ZZNA 4PPZA 2RHSB 3ETOA 3QRPA 4JOUA 4A8KA 4LMZA 1OY6A 4DV0J 1RGVA 1VCTA 2VFUA 3MMAB 4KHRA 4YDXA 2VQFJ 1G7CB 2BX6A 3ENQA 4AXJA 2V4QA 2XZWA 3C14A 4OX6A 3A8KA 2HMIB 2DISA 3DLHA 3LA0A 4KBIA 3SV4A 3D54A 2DY9A 2LFVA 4R5PA 2VQEJ 1WSVA 5GAEI 1WHYA 3CCVS 5RUBA 1S1UB 2AV5A 4WWSA 5U47A 2OPQB 3I87A 1ZH5A 4RR5A 1GXTA 2W8KA 2DNYA 2RRNA 2LXUA 4MIBA 3SQOP 3GV5B 3W64A 2XSFA 5C42A 1LK5A 4M5NA 4DJBA 4K4WA 1B3TA 3B6BA 1KVIA 1TL7B 2A2CA 2Q6BA 3GONA 4N5SA 5A8WB 2ZE2B 3IC1A 5HMYA 5J1PA 4AT1B 2FZCB 3KWMA 3KUEA 3C6TB 4I6YA 4ALZA 4QPXA 3TA0A 2N3LA 4M94A 1IM6A 3PYEA 3PHTA 2R4FA 1Q86T 1P1TA 1AFIA 4Z7CA 5IWAJ 2B0GA 1N5SA 1K0VA 1NPKA 4KO0A 5CYMB 4PG8A 1F60B 4S0MA 2BXJA 3MF5A 4WU3A 4DL3A 1TV6B 3CCES 1Q0NA 2AX1A 3E01A 4RO0A 5DM7Q 3R27A 4ZP7A 5IT4A 4C3MA 4TYAA 2W4CA 4I69A 1A6LA 5K14A 4CP5A 4ZITA 2MZQA 3T1YF 1YG0A 4OZ1A 2BDPA 3SSRA 2HNDA 2PFDA 1U1MA 1RT1B 3VAGA 2UUAF 2COLA 3QGPA 1N54B 2XCPA 3KK2B 2VBWA 1VRQC 4ECQA 2MQMA 2W2QP 4DL7A 3T5LA 4QR2A 1YQHA 2ABYA 4LFAJ 1HNVA 4NLXA 4EBEA 1YJ9S 1QM9A 3CPWR 2Y1RI 1MWYA 2DRBA 1CEZA 1JIHA 3KK1B 1S72S 5E41A 2OH2A 1WELA 2HQIA 5KOWA 4K4XA 5D15A 1X4HA 2J9DE 2OLWA 1IQTA 1S0MA 1S4EA 5F9LA 2JLEA 4EYHB 2QA2A 4M5LA 2XC9A 3OHBA 3DI6A 1U2RA 2VG6B 1NPRA 2J9DA 4RPFA 4QWBA 2Q66A 4QU7A 2QV6A 2RUGA 2J6SA 4LR7A 4U7CA 2OD4A 3D6MB 3MMJA 2W1BA 2XGQA 1FKPB 4I2PB 4DN9A 1T05A 4OX9F 2MY8A 3W2WB 1WDDA 3FFIB 2BKOA 3OFFA 3KYLA 4Z7YA 3CJ2A 3VAFA 2W01A 2MB0B 5IS2A 4WCEQ 4X4QA 1IR0A 3CCJS 2W7OA 3ZZOA 1SUQB 3P5BP 4PWDA 3O8WA 4KY3A 1DURA 3V6DB 1DJ0A 4OQJA 5DDPC 2UUWA 3IO1A 5AXKA 4C0HA 2K06A 1ZETA 1K47A 2CNKB 2DNMA 3BGRB 3J81Y 1D1UA 3CDEA 1ZAVA 2YNIA 3AH6A 1REVB 2YNGA 1YI2S 3D0GE 3TZZA 2UUTA 4YMEA 1XC9A 4C2MA 3WQPA 4KHMA 4CO0A 3N6LA 2BJEA 1IQZA 4CZCA 3TUIC 3Q86A 3OTCA 4HVZA 2V0NA 3IP0A 1OQ6A 2VJUA 1CBKA 3NOGA 1CVJA 1FJGJ 2A0FB 1H73A 3QSIA 3KLIA 4RX6A 3SYZA 3DLGB 3KHLA 4ILMA 1HL6A 5CD4H 3H59A 1JLFA 3T1YJ 1LWFB 5J2PA 3JB9k 1PC4A 4TY8B 2ZHOA 2YBVA 1PYTA 2ZOGA 1CJVA 2W4DA 2CZ9A 2DCUB 5IT9Y 1P1LA 3H40A 4YP3A 2B3TB 1WHXA 4KYZA 3W2VB 5L9NA 3L7OA 3T5JA 2E66A 3SBMA 2CA9A 4KGXB 4IR9A 1PBAA 1X8DA 3SI8A 3GJQB 3W2VA 4RW9A 5F9NA 3MCMA 1WOPA 4LQ9A 3BQ2A 2HZVA 1BQNA 2XWYA 1CPZA 2DR8A 2SXLA 3BYRA 1YJVA 1JKHB 1HKAA 5KG4A 5J1EB 4LFCJ 1FRXA 1M5SA 2DNZA 2FYXA 2KRRA 3P3DA 2VU5A 4P2FA 2HS0A 2VG7A 2JLGA 2LXFA 4FBTA 1RHKB 2FJEB 3H7HB 1HBUB 4AUKA 2VH7A 2XULA 4AQYJ 3QJJA 4G1IA 2Z30B 2P6TA 2P9EA 3KUGA 4PG5A 3UCUP 4DV1J 5KFEA 2HG4A 3ISZA 2W9CA 2GX8A 2M4MA 3GJTB 5HQ8A 3TW0A 2AJ4A 4CM2A 3MEGA 3AD9C 5GAHU 2CUYA 2BMBA 1YSJA 2W25A 5ADZA 1T03A 2BABA 3IG1B 2CXEA 4UZBA 2N7YA 2VC0A 2KM8C 1YWXA 1DLOB 2XTJP 4HHUA 2V2KA 3BH6B 2NXJA 3LP1A 1OY8A 3NAHA 4F25A 5HMWA 3M8SA 3RAQA 4ELTA 2Y9HA 2Q43A 4JI2F 1MLAA 1RT2A 4Y2IA 1NM2A 1TVRA 1M1HA 2XMKA 3M05A 2L9DA 2B4UA 4KFBB 4PPDA 2XLJA 3BO4A 2CFXA 4ETZA 1WC0A 4DX6A 2Y3YA 4ZJOA 4NLDA 2YH0A 2GQQA 3GIMA 4KFBA 2VA3A 4KHPF 3DMJB 2F8EX 3SZ2A 4CLYA 3H5YA 4DFKA 1L3TA 1HBOA 2R3VA 2YY3A 1Y5IB 4LFBF 1Q5YA 4L3NA 1ITPA 3GJSB 4NASA 5HQLA 3FDSA 4P6QA 5MAOA 3NOCA 3DU5A 5AT1B 3TX8A 3OW2R 1X0FA 1NK5A 3DYAA 3OL7A 2LQ9A 2VFVA 2HHXA 1O0PA 1U7LA 1VLYA 2RJZA 3LGNA 5E0OA 3MEDB 4CCHA 2F63A 1UZHA 1LW2B 2LLZA 1NEEA 4UF4A 3V4IB 1IWGA 1NHVA 5E3RA 4F7VA 1DLOA 4KJIA 2R7VA 3PG9A 3QGGA 4JI7J 1SIZA 4E8UA 3W9JA 2HBRB 3QO9A 4I56A 1RYRA 3EJMA 3WIUA 5A2QY 2JZ5A 2B8PA 4NL5A 4ED2A 1AFJA 4K4YA 1H6KX 4YUDA 1KR4A 2YNFB 4JI5F 4P73A 3NMAA 2FLPA 1FK9A 3JQJA 5A8RB 5BR8J 5DM6Q 4ID5B 1HBNB 2DVIA 1XERA 1KBRA 1HQUB 3N5BA 2PGCA 3B78A 3M6WA 3OD2A 4RNHA 5D4NA 3FSIA 5FDLB 4DSFA 1IBKF 2XNRA 2KU7A 2RDJA 3TUZC 5HBMA 1NBEB 5F8LA 2QYCA 4WP9A 3OJSA 4JI7F 4MFBA 5DG7A 1HQ2A 3CJ0A 3M6VA 2V94A 5JXSA 4EEYA 4I68A 4CTAB 2F8HA 2H4YB 2CQBA 4L3KA 3MR6A 1YTYA 2PFFB 1HFEL 4USHA 4IOAQ 5HSPA 2C1EB 2FQQB 3OUYA 1U6BA 3C2PA 2J0WA 3LH2S 1VBYA 1IKWB 3C66A 5IT0A 4OYOA 1K8AT 4JV0A 3W5ZA 3TJ8A 2IFXA 4ED6A 4X2BA 4JP8A 3NCQA 4Y6IA 2CNNB 5F8NA 3PIOQ 4FYXB 3PO4A 1RT3A 2LVWA 1UL3A 4A47A 2Q1LA 1UMJA 2AQ4A 1SH2A 2HW3A 2ATCB 1W25A 3M2VA 4OHZA 3BN7A 3CDUA 5IXUA 9ATCB 4B3SF 1JLQB 3RBXA 4DR5J 2LKZA 1X60A 3QFHA 2RE1A 2HNZA 2ZOFA 1RA7A 2JNJA 3JAMY 3MOJB 1M5OC 2ERRA 2CVEA 2XI3A 2KDOA 2KVQE 2ZH1A 3BSNA 3THTA 1EX8A 1T7PA 1A9NB 1WKLA 1WKJA 4ENOA 3G6VA 2M8DB 5HMZA 4P7TA 1SKWA 2D74B 4TU8A 2HK2A 3TQ1A 1RTJB 3M8ZA 2YTCA 2K7JA 2OEKA 2B7CB 3QWPA 4DUTA 2BANA 4JYAJ 2OPRA 1VC6A 4M5DA 4G65A 1NXIA 3BGRA 1IKXA 3VAJA 1K44A 3W5YA 1C0TA 5K8MA 2ASDA 4DBQA 2BOPA 1ICEB 3QMQA 4N77A 4OYXA 4DX8H 3FEYB 2HHUA 3BGOP 1TFYA 1RAIB 4WIQA 2X7IA 1KRPA 3FZ2A 1KQKA 2MQQA 2I5JB 1V5IB 3HDSA 4V19X 4XIUA 3TANA 3BKUA 4RW6B 4EK2A 2RKIB 4OZJA 3DN9A 3MWBA 4NWBA 3MAAB 3AFGA 4V1Ak 4WYWA 5KFYA 4DU8A 4ZP6A 5JMNA 1SH0A 5CAAA 4MKAA 4C0BA 4A8YA 4DR1J 4RUBA 1WG4A 5HBMB 1GH8A 4IDKA 4Q0BA 1R8PA 1GTEA 4LSLB 1VIOA 3EM1A 3LANA 2ROEA 2B6AA 4DF8A
chains in the Genus database with same CATH topology
2Z57B 3A3OB 3WIUA 2Z56B 2PMWA 2Z30B 3WIVA 1R6VA 4JP8A 2W2OP 2ZWOA 2W2PP 2W2QP 3P5BP 4NMXA 3BGOP 2ZWPA 2W2NP 3A3NB 3WHIA 1ITPA 1V5IB 4NE9C 3CO0P 3H42A 2Z2YB 3QFHA 4YN3B 3VV2B 4OV6A 2E1PA 3CNQP 3GCWP 2Z2ZA 2XTJP 3AFGA 2W2MP 3GCXP 2Z58B 2QTWA 3BPSP 3T41A 3A3PB 3VHQA 1SCJB 4K8RA 3SQOP 1SPBP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z57 B;  3A3O B;  3WIU A;  2Z56 B;  2PMW A;  2Z30 B;  3WIV A;  1R6V A;  4JP8 A;  2W2O P;  2ZWO A;  2W2P P;  2W2Q P;  3P5B P;  4NMX A;  3BGO P;  2ZWP A;  2W2N P;  3A3N B;  3WHI A;  1ITP A;  1V5I B;  4NE9 C;  3CO0 P;  3H42 A;  2Z2Y B;  3QFH A;  4YN3 B;  3VV2 B;  4OV6 A;  2E1P A;  3CNQ P;  3GCW P;  2Z2Z A;  2XTJ P;  3AFG A;  2W2M P;  3GCX P;  2Z58 B;  2QTW A;  3BPS P;  3T41 A;  3A3P B;  3VHQ A;  1SCJ B;  4K8R A;  3SQO P;  1SPB P; 
#chains in the Genus database with same CATH topology
 5ETK A;  1D09 B;  1FRJ A;  1HWU A;  3DNC A;  3EIC A;  4NRU A;  2JFK A;  2OML A;  1LWE A;  4BWM A;  2QL9 B;  3C15 A;  3WIV A;  4DCO B;  5DJB A;  2BVZ A;  5K8P A;  4Y2M A;  1U24 A;  3L7U A;  1EP4 B;  2Q6C A;  4NA3 A;  4RKU C;  5K14 B;  4C48 A;  4IUF A;  5D8H B;  3D9B A;  3NEK A;  3DU6 A;  2VPW B;  3FCW A;  1L5U A;  1RAB B;  1RWU A;  4DCJ B;  2DIU A;  4NLS A;  4RUA A;  3CJT A;  1YZ6 A;  1RT1 A;  3KDN A;  4WK3 A;  4KO0 B;  5CYM A;  2I6W A;  2XLI A;  1T3O A;  4MTP A;  1F3V A;  4ZS6 A;  4O3N A;  2ZH8 A;  4LF7 J;  3MUV P;  4DL6 A;  1FFG B;  1MNE A;  2GML A;  3QSY B;  5E33 A;  4CLU A;  2L08 A;  3G71 S;  5A2Q U;  1UA0 A;  1HWI A;  1HNZ J;  2Q79 A;  3EGZ A;  4RNN A;  3R2C J;  2AEJ A;  4EO8 A;  4EBD A;  1FNX H;  1S4F A;  4O0I A;  2CVI A;  2OJ3 A;  2VIC A;  2GFF A;  2RRB A;  4CH1 A;  4I7F A;  1KQS R;  1G3O A;  2IY5 B;  2BOA A;  2DHG A;  3N6N A;  2Z56 B;  4LRB A;  5ETR A;  3OSN A;  2IMO A;  4DV7 J;  4FS2 A;  3BSA A;  3V2U C;  4KTQ A;  3C6T A;  1T95 A;  1WEY A;  1AYE A;  2YNF A;  4K5R A;  2CQI A;  1C0T B;  4Z37 A;  3KLH A;  3IWX A;  1WAC A;  3L7P A;  1HWK A;  3PYF A;  4HAC A;  4XAK A;  5LMU F;  2B56 A;  4ZDN A;  1FTR A;  1X9S A;  1QVG R;  1PAE X;  4X62 J;  2M52 A;  2C3U A;  4NLP A;  3M9O B;  1E6V A;  2UP1 A;  2I8E A;  1RLD A;  4MH8 A;  4MJK A;  4GVL A;  4C0O C;  3MCN A;  3UD4 P;  4FYW B;  3TAM B;  4ZCI A;  3NGT A;  3CB4 A;  1NPP A;  3R5J B;  1UP1 A;  2ZBI A;  2CJX B;  5EX3 A;  8ATC B;  2KG1 A;  4KH1 B;  2BQR A;  1FFS B;  3SDE A;  3GZ7 A;  2DR7 A;  4NXM J;  1V5V A;  3K2Y A;  3LWM A;  1QDU B;  3VCD A;  2Y0S D;  1RT7 B;  2IA0 A;  2R2R A;  2LQJ A;  2YXL A;  1OSC A;  4X4P A;  2D3O R;  4G6V B;  1Y0H A;  2V6A A;  1W2I A;  3DDI A;  4FPR A;  3ELH A;  4OX7 A;  2VPY B;  4RBT A;  1S9E A;  2QA1 A;  3CSK A;  4X62 F;  4QU6 A;  4XK8 C;  4ECW A;  3EGN A;  1YJU A;  2Z2Y B;  3IFE A;  3S6E A;  1Z2L A;  2WVB A;  1RZM A;  2MLY A;  2HQC A;  5FLX U;  1KP6 A;  1UFL A;  2XSJ A;  1WC5 A;  5CYQ A;  4HHJ A;  3DRS A;  4NYZ A;  2EFQ A;  3M9N B;  3HHL A;  1Q8L A;  5IV4 A;  4BC7 A;  4XPC A;  1U8W A;  3OL9 A;  2CDQ A;  4TY9 A;  3PO5 A;  2NSB A;  2HS3 A;  3M2R A;  4X65 F;  2XY5 A;  2A6O A;  3GYX B;  2DR5 A;  4DQS A;  1RB0 A;  2DXF A;  4LFA F;  2Z8Q A;  3FCH A;  1ZA1 B;  4TLR A;  5KT7 A;  1FXL A;  3IAS 9;  2BE7 D;  3PV8 A;  2GIR A;  3DGV A;  2HHH F;  3D6F B;  2FC9 A;  3GWC A;  3H90 A;  3HMJ G;  6FD1 A;  2B9E A;  1SQF A;  3MM7 A;  4B3R J;  3DRR A;  3AD8 C;  1RTD B;  2GQC A;  2LDY A;  2WON B;  1OWX A;  5F3Z A;  2HWH A;  2HPU A;  2F4F A;  3D4J A;  3AT1 B;  4IH7 A;  5I4M A;  2DO4 A;  3IM8 A;  3LP0 A;  4ED5 A;  1S9G B;  1Q7L B;  5B0A A;  4X4N A;  1TUV A;  4FKX A;  2DGX A;  3D28 A;  4J9M A;  2UVR A;  3S7R A;  2MKY A;  3SSQ A;  4EGL A;  5DG9 A;  2YNH B;  1WOO A;  4X65 J;  2AWZ A;  5KFL A;  2J9E A;  1GQE A;  5F8H A;  3S8S A;  4ECS A;  2DJW A;  4ZP9 A;  1R0A A;  1HI8 A;  1HR0 J;  2DHS A;  3DRS B;  3I5B A;  5M2P A;  1X4A A;  2HHP A;  2AD9 A;  5DDR C;  3UE2 A;  1B7Y B;  2HQG A;  2LXI A;  1VIX A;  1X7V A;  2NYH A;  1L3V A;  1MRO A;  4H4M B;  4ZPC A;  3TO8 A;  1MMN A;  3IBF B;  1I3O B;  2VDH A;  1GEH A;  2VPX B;  3Q8R B;  3PX6 A;  2DGW A;  4DDF A;  4PG4 A;  4X4U A;  2WCX A;  3UDL A;  3UCZ P;  1EQ0 A;  4I67 A;  3IS9 B;  4H4O A;  2QX0 A;  1ZYQ A;  3K58 A;  2PEB A;  4LVN P;  1NKB A;  3TEG A;  4HR2 A;  5D6G A;  3DXB A;  1LXN A;  4AL5 A;  3MM5 A;  2DGT A;  2ZKT A;  1HNW F;  2V69 A;  1TKZ A;  2LU1 A;  2YKM A;  1S6Q B;  3HJV A;  4OMF G;  5KFU A;  4ZLN A;  1LK7 A;  5J2M B;  3PKY A;  3TJA A;  1NDL A;  2V5H G;  2W9B A;  1PJ6 A;  5J1N A;  5HRO B;  2VDI A;  1HNI B;  2DGS A;  1LXJ A;  1LQ9 A;  5B0D A;  2GJF A;  4J5O A;  3H5U A;  3CF5 Q;  2EK1 A;  3LQV A;  4KT0 C;  5ETQ A;  4JI8 F;  1T03 B;  2ZZT A;  3PY8 A;  1S9F A;  2XGP A;  3TQE A;  1C1B A;  3ZO7 A;  3HK2 A;  2GNK A;  2HZC A;  4NLV A;  4U67 Q;  2AMC B;  5KG2 A;  2XYG B;  2MYF A;  1JXV A;  4NYO A;  4B9S A;  3B8H A;  3IR6 B;  2J8S A;  1RI7 A;  1VR6 A;  2CPE A;  1IKW A;  2HBY B;  2X3D A;  4DPY A;  3KTQ A;  2RF2 B;  2B5J B;  4M5H A;  1U8S A;  2CPX A;  3BKF A;  3FRZ A;  4H4O B;  4HLB A;  3UI3 A;  4YB1 P;  4V19 J;  2DY1 A;  2M3D A;  1RBO B;  1JLG B;  3RB6 A;  1JKH A;  4LRC A;  2HHS A;  4M1K A;  1TL7 A;  2AZ1 A;  4BBY A;  5HP1 B;  2M2B A;  5B0E A;  4JV5 J;  3QT5 A;  3CCU S;  5IQ6 A;  1WI8 A;  1N8R T;  4OJ1 A;  1SBR A;  4ZVR B;  4J9S A;  2UXD F;  2UUB J;  2HNY A;  2OSR A;  3QLH A;  3PJX A;  2XNQ A;  3NLC A;  2QIF A;  2DXE A;  2AEF A;  3KNG A;  3NKY A;  4C6A A;  4UOF A;  8RUC A;  2DPJ A;  2E5I A;  2QE5 A;  2CPD A;  2BR0 A;  1KFD A;  4M5D B;  2EC0 A;  2QL7 B;  3DOK A;  3KXD A;  5AXM A;  3DLL Q;  1N5V A;  2HVE A;  3PX4 A;  4NLU A;  4JV2 A;  2BE2 B;  2M88 A;  3HVA A;  1RCX B;  4ILL A;  2RS8 A;  1FD2 A;  4DUY J;  3VQS A;  4KPY A;  3BJY A;  3A3P B;  1RK8 A;  1IBL J;  2L41 A;  3T3F A;  4JI0 F;  1TKZ B;  2C2O B;  2YKM B;  3E01 B;  4OV1 A;  4RJV A;  4DOZ A;  4GVB A;  4QYZ J;  2RKI A;  5DRK A;  4ZOS A;  2WB1 D;  4RUH A;  4IFY B;  3TJ9 A;  2RS2 A;  1N56 A;  2RNE A;  5LSR A;  4LF6 F;  1YRX A;  2YWE A;  4RWX A;  2BJ1 A;  1LFP A;  1RT3 B;  2KT3 A;  2B51 A;  3HZG A;  2M7S A;  1SQE A;  2Z2M A;  1HPZ A;  2G1H A;  1WHV A;  2KXF A;  3LPE A;  3UW1 A;  2DR9 A;  4PWD B;  4W4M A;  4C8Y A;  3LWL A;  1VRU B;  2YKO A;  4JI4 J;  1UJ5 A;  2VBZ A;  2FJX A;  2NXC A;  2KHC A;  2XSJ B;  4KV8 A;  4CWB A;  5A6P A;  2A18 A;  3CCM S;  2OPR B;  2MMY A;  4DN0 A;  2DIT A;  4LF1 A;  1VQ5 S;  2HGL A;  3I5A A;  1S9E B;  1XMB A;  1GK8 A;  3W5X A;  1CC8 A;  2XMA A;  2WW8 A;  3GIL A;  2G9O A;  3MPY A;  3ILO A;  2RSQ A;  2C3O A;  4X4R A;  2DGV A;  3C8Y A;  3WDO A;  1T02 A;  1VQ8 S;  4DSK A;  4LF4 F;  2MQN A;  3SV3 A;  1F1B B;  4PRF A;  4B3O A;  1ZA2 B;  2C3P A;  3WC0 A;  1N32 F;  3GSD A;  1FHT A;  1HQU A;  3FJ2 A;  2OO4 A;  4QIW D;  1CSJ A;  5KG3 A;  4K0K J;  1WC3 A;  5E2Q A;  3MR3 A;  1SL2 A;  2DPI A;  4Q44 A;  4FXD A;  2ZWO A;  2R7T A;  3M32 A;  2AEM A;  3DLE A;  1HR0 F;  2NPI A;  1AXQ A;  1ZM3 A;  2RB7 A;  4PQA A;  2JEI A;  1P27 B;  3S01 A;  1IUJ A;  2P8I A;  4X64 J;  4C4W A;  1OJ4 A;  2JSX A;  5GME A;  5HI7 A;  1NHU A;  3M2R B;  3EZ5 A;  4DPT A;  2E1P A;  5A8K B;  2J76 E;  2PII A;  4DUZ F;  2ZDO A;  3CD0 A;  3IMQ J;  3UCG A;  2KJV A;  2QTW A;  1XR7 A;  1RDR A;  2HS4 A;  5J1E A;  4HHH A;  3MAH A;  3R1L A;  4ECX A;  1Q7Y T;  3ZTR A;  4Q5V A;  1RIS A;  1PJ5 A;  1C0U A;  3LAK A;  5DS7 A;  1XK8 A;  1JXE A;  1XBW A;  3HHK A;  2AX0 A;  3PYG A;  3JTN A;  3Q83 A;  3G96 A;  4F67 A;  1U1P A;  3CC4 S;  4K4S A;  1G2E A;  4X64 F;  2NSC A;  4I6W A;  3O44 A;  2R7Q A;  1FXD A;  4WFA Q;  4DR6 F;  4TY8 A;  3BGL A;  3UVJ B;  3BQ0 A;  1NZ8 A;  4NA1 A;  3WHI A;  3KHH A;  3CO0 P;  4BHQ A;  3DLB A;  3M7V A;  4NPO A;  4UOH A;  3I4P A;  1SQG A;  4YB5 A;  4JI0 J;  3E3X A;  5KFB A;  1XTZ A;  3K5N A;  1VQS A;  1TKX B;  4PUO A;  2HVD A;  2DH7 A;  1J2V A;  1F2H A;  1C1C A;  3LP1 B;  4IYQ A;  3NNC A;  2A2D A;  2ZH6 A;  2XMM A;  3MEC B;  2XMJ A;  3KLG A;  5EHH A;  1QAJ A;  3LGH A;  3NNA A;  4B3O B;  4UT4 A;  4DV5 F;  2V9K A;  3SQG A;  3A12 A;  2G13 A;  1KLM B;  5DDQ C;  3MEG B;  3KUH A;  5A0Y B;  5EWG A;  2BE9 B;  4B08 A;  1GMW A;  1MN7 A;  3EPG A;  1SUQ A;  4J9K A;  2YH1 A;  3MOZ A;  4IFV A;  5GVQ A;  3KHR A;  2IMW P;  2GS8 A;  2DH9 A;  3HVW A;  2R8G A;  2Y8W A;  1FT8 A;  2V4J B;  2JC1 A;  3D7S B;  3QT7 A;  3EGW B;  3R5B A;  4HH1 A;  3IRX A;  4R8U A;  2FB0 A;  3W2W A;  3MPW A;  2IDL A;  2QGF B;  4IOC Q;  3D3B J;  1YJR A;  4ZN3 A;  5MLC V;  4EWT A;  4EZ9 A;  1EAY C;  2DHX A;  3OL6 A;  1TUG B;  3MM6 B;  4QZV B;  1X5S A;  2GMJ A;  1ZZN A;  4DX7 A;  1UVL A;  2IRU A;  2MKJ A;  2VAS A;  2A10 A;  4XO0 A;  2ILY A;  1AW0 A;  2CPH A;  3KK3 A;  3R1H A;  2FY8 A;  5AJ3 J;  5CXT A;  4GRS A;  5L8R C;  4JI8 J;  2G2Z A;  1TAQ A;  2NXU A;  5KFI A;  3VGT A;  1XNQ F;  1RHU B;  2LQ8 A;  2MKS A;  2V63 A;  4ZJQ A;  2UXB F;  1UPP A;  2DKO B;  4IG0 A;  5SUH A;  4KB7 A;  1ZBT A;  1N0U A;  4ZCK A;  1IBM F;  3OTB A;  3GLJ A;  4LR9 A;  1HNV B;  3POT B;  1F0X A;  2EBE A;  4ZVG A;  3HXM A;  3UWT A;  3DKD A;  3H0P A;  1M1K T;  1Q78 A;  5E3A A;  2UVV A;  2QRR A;  3C15 B;  3N01 A;  4P72 A;  4NLR A;  5FII A;  1CLF A;  2FLN A;  4TN2 A;  4Y00 A;  2E9Z A;  1S6P B;  3CMQ A;  3HSG A;  2VFT A;  4FZV A;  4A8M P;  3AA8 A;  1U2C A;  1TR0 A;  4ZKA A;  4DL2 A;  3UVJ A;  2MKC A;  1IKY B;  4L72 B;  3J81 U;  2NLW A;  3I9Z A;  2RU9 A;  3IS9 A;  1HI1 A;  3IBC B;  4TKT A;  2CNO B;  1FDB A;  1RT4 A;  5L46 A;  4NLG A;  3GFX A;  1FTC A;  1FO1 A;  2CPI A;  1TMJ A;  3TI0 A;  3DRX A;  4RNM A;  1KVK A;  2R7U A;  4RW9 B;  2DRA A;  2AJ0 A;  4C9D A;  3VQT A;  1WI6 A;  4WFZ A;  3OR1 A;  4B9T A;  1UVK A;  2V34 A;  3DOL A;  3HZE A;  3BF4 A;  3ISN C;  3SIP B;  2Y1J A;  2QLJ B;  1URN A;  2H5I B;  4C98 A;  4HL9 A;  2A3J A;  3M6X A;  4QIE A;  1TQL A;  2W2O P;  3O3L A;  4LBH A;  3KLF B;  1IJE B;  4OZ0 A;  5GMD A;  2XB2 D;  1N5T A;  1JB0 C;  4KKO B;  3J7A 1;  1FDD A;  1GT8 A;  4HH0 A;  3Q8P B;  3PX0 A;  4URS A;  2WSC C;  3OV7 A;  4N56 A;  2KT5 A;  3F73 A;  3SCI E;  2ZHB A;  1EET A;  1U0H B;  3RW6 A;  3MEE A;  5IFM A;  3HHL D;  4P71 A;  4F4A A;  3NS6 A;  4DPO A;  4PR6 A;  3H4D A;  3U27 A;  3A4T A;  2HRY A;  4ZIV A;  3IRW P;  2ROP A;  1VFJ A;  3I9V 9;  2FJD B;  4WU2 A;  1QJH A;  4ANE A;  2LEB A;  1RYS A;  4QCL A;  4ZVO B;  1SCJ B;  4I2Q B;  1IKY A;  2RML A;  1MU2 A;  3I0S A;  4CLP A;  3KK1 A;  4DS5 A;  3G6Y A;  4OZ5 A;  1U0S A;  4YB6 A;  3AOC A;  5LSO A;  4ERD A;  3KG0 A;  2IJN A;  3NRB A;  5I3U A;  3ENW A;  3MHY A;  3GFH A;  3MAQ A;  3HKW A;  1WC6 A;  3TOQ A;  3OSP A;  5D3G B;  3AJD A;  2GGP A;  2E5L J;  1XR6 A;  4PAA A;  2CQ0 A;  1SI9 A;  5HRO A;  1HD1 A;  1U2F A;  3VZI A;  2W9B B;  2D7S A;  4ZCL A;  3EE3 A;  4P7V A;  5LT5 A;  2KKH A;  5B7W A;  2EFN A;  1AZS A;  3MMB B;  4Q2L A;  1KTQ A;  2D9O A;  3MCS A;  1RTH A;  4P2M A;  4JBC A;  4NML A;  4ZPT R;  3GCX P;  1Q82 T;  4KGK A;  4KGZ B;  3T1A A;  3OVA A;  2CPJ A;  2X1B A;  2ZC3 A;  3IGV A;  4MK7 A;  2NXN A;  3ZNJ 1;  4HDH A;  4MKY A;  1FJG F;  3BRE A;  4OHW A;  4CNY A;  1UCN A;  4O4R A;  1UTA A;  3BGF A;  2BEF A;  1MWQ A;  3VF0 B;  2RT3 A;  3PEJ A;  3KNA A;  1L3U A;  2BKP A;  2PMH A;  4L73 A;  4I4B A;  4OL8 A;  5D78 A;  2H1Y A;  1BD6 A;  1OSD A;  1TZ0 A;  3CW2 C;  1RAH B;  4AND A;  4DS4 A;  4ECT A;  1I94 J;  3G82 B;  3JQK A;  3ZZU A;  5HMX A;  1QD1 A;  4ECZ A;  2FDN A;  3HX9 A;  4L6V 3;  3IWL A;  1HBM B;  1OIA A;  2ZWP A;  3AJ1 A;  3QAE A;  1RT6 A;  1DRZ A;  4F3O A;  4F4K A;  2J5A A;  3ZTQ A;  2J0S D;  1D9F A;  3OXF A;  4OZN A;  3K8V A;  3SQG B;  4F3M A;  2LCW A;  2BJ8 A;  3FBF A;  5BYR A;  5JJB A;  5LJ3 Y;  4DV2 F;  4CO2 A;  4IOB A;  3G4S S;  2VBY A;  5B09 A;  1S1U A;  1S79 A;  3OJU A;  3GII A;  3JSM A;  3G8Q A;  1Q1K A;  5G4D A;  2CQ2 A;  3GMG A;  3RW7 A;  5LJ5 Y;  2H5J B;  4O3O A;  4NLT A;  1UWA A;  3L4B C;  4TU9 A;  2ZUA A;  5L9X A;  1PC5 A;  5CQG A;  1X5T A;  1F6T A;  4Q0B B;  3Q23 A;  1RWV B;  3D3C J;  4RW4 B;  1HBM A;  4IO9 Q;  4X4O A;  2MPU A;  3H2U B;  1VI7 A;  4FVM A;  2B4O A;  2CQC A;  5KFO A;  3MPU B;  2QN6 B;  3X1L B;  2C2R A;  4FNI A;  2CDR B;  3HD1 A;  4OJH A;  1IXK A;  1P9Y A;  3PCO B;  2MLZ A;  3PFE A;  2CJQ A;  5G0R A;  4ZN1 A;  2F3J A;  2HWI A;  2WBR A;  2E9R X;  4FYV B;  1ARO P;  1H2U X;  2WVD A;  4OZ2 A;  2BQU A;  1N4L A;  1FD8 A;  3TA2 A;  3JXO A;  1VQ6 S;  1C1B B;  1JNR B;  3NXZ A;  1J5E F;  1CJV B;  1H3D A;  4XDD A;  3N4W A;  3K0J A;  3TUP A;  2JWN A;  4DQR A;  3JSM B;  3LAL A;  1Y10 A;  4DV6 F;  2ZEJ A;  5A8K A;  1RHQ B;  3D0I E;  1VOM A;  4NZ6 A;  1NZA A;  2HKE A;  1N36 F;  2WBM A;  3M2U A;  4LSL A;  4UZC A;  4JI4 F;  1RBA A;  2YKA A;  2KL8 A;  4QR0 A;  3BQ1 A;  2XLK A;  1KNZ A;  3W66 A;  1VQP S;  4GKJ F;  1XQI A;  4LVO P;  2WOM B;  4LRD A;  3NGS A;  1I1G A;  2XCA A;  1OMS A;  4CLZ A;  1I6J A;  5KG0 A;  1U02 A;  5BXI A;  2KZZ A;  1HI0 P;  4YN3 B;  2QZ8 A;  2OUG A;  2V67 A;  3SFU A;  5C2G A;  3NAI A;  5AJ3 F;  1QTN B;  2JH3 A;  3M2V B;  3R7N B;  3FBE A;  1U1R A;  1H2V Z;  2U2F A;  1BWV A;  3VVU A;  1NDK A;  3AB4 B;  4QPT A;  4DR7 F;  2AIR B;  1VQN S;  3UN5 A;  3US5 A;  1KOO A;  1Z2Z A;  4DV4 F;  5CCM A;  2Y8Y A;  1V6H A;  1WHW A;  3OR1 B;  3PZP A;  4Y2C A;  2MTL A;  4RW8 A;  3SFG A;  4M5I A;  4JI5 J;  2X1G A;  5F3T A;  4IH5 A;  2KZM A;  2CJY B;  3TZX A;  3LOU A;  1S1V B;  2LA4 A;  1URR A;  4OIX A;  3ZZP A;  4OLP A;  2H9Z A;  3G6X A;  2F8M A;  1NUE A;  3ZZZ A;  1VK3 A;  2OGU A;  3TVY A;  5A6W A;  5M2R A;  3OTD A;  1LWC B;  1PIE A;  3K17 A;  4IH6 A;  1KQF B;  2JHE A;  5AE3 A;  1VBK A;  4ED1 A;  3AQP A;  2ASL A;  1R43 A;  3V6H A;  3IWN C;  1S9G A;  5H9E K;  2JX2 A;  1X4D A;  3BBF A;  1KDN A;  3RRG A;  3W9H A;  3AOB A;  5D4O A;  1YJN S;  2WON A;  3DOK B;  2VHG A;  4DFJ A;  3R3T A;  1DFD A;  2PC6 A;  1WG5 A;  2IM0 A;  3HD2 A;  1KQG B;  2RVJ A;  1OO0 B;  4OX9 J;  3UR3 C;  2O3D A;  3MM8 B;  4USK A;  2ILZ A;  1RWN B;  4A8Q A;  4AFF A;  3Q8S B;  2G0C A;  5D77 A;  4FVC A;  3TYT A;  1F9H A;  2FVC A;  2RQ4 A;  2QLW A;  2YKQ A;  4HTJ A;  1RWM B;  1XEZ A;  3NGK A;  1J5E J;  4ED0 A;  1JJH A;  1H2T Z;  2EK6 A;  3L95 X;  3QAU A;  4X4T A;  5LMN F;  3Q0A A;  3V4M A;  4JV5 F;  3CXC R;  1S97 A;  3A1Y G;  1SC3 B;  4QYZ K;  3MEK A;  2DBB A;  3G9C A;  2QT7 A;  4NXN F;  3PVX A;  1K1Q A;  1RAC B;  2E5H A;  4OFZ A;  3QJL A;  3RRH A;  1NDP A;  2GC8 A;  4HT5 A;  3G82 A;  5HJX A;  3FKB A;  5JVH Q;  2R7X A;  2HIY A;  2XZD B;  2F65 A;  4FKY A;  1UVJ A;  1UVN A;  5HAO A;  4YS2 A;  3GQC A;  5IOL A;  4W90 B;  7AT1 B;  1TUW A;  3IBW A;  3DM2 B;  2R2S A;  3JTO A;  4ECU A;  2XS5 A;  1N5Y B;  2IRX A;  2CPF A;  2WB4 A;  1Y11 A;  1NH7 A;  3AJ2 A;  4TVA B;  2ASJ A;  4DWI A;  4C8M A;  1N5Y A;  1LV5 A;  4K0K F;  2LQ5 A;  4G1P A;  4P2S A;  1EHW A;  1FNO A;  5KFT A;  2RH3 A;  4GKK J;  3IRX B;  2KT2 A;  2LU2 A;  3VZH A;  3VTI A;  2HQ3 A;  3QNW B;  5C42 B;  1AZS B;  3MMB A;  3CJK A;  2EPI A;  4JI2 J;  2VD3 A;  1RLC L;  1Q16 B;  4DR4 J;  1SJ1 A;  3BDP A;  4KE5 A;  3T6J A;  4RBV A;  1CG2 A;  1TL1 A;  4LBP A;  4K50 A;  2KB2 A;  2CJB A;  1WWH A;  2MSS A;  4U7U K;  1PYS B;  4WE1 A;  3A8I A;  1AUS L;  1N33 J;  2UVU A;  2BQ3 A;  4LFC F;  3K5M A;  1DQA A;  2QO3 A;  4PWW A;  1QTM A;  4K59 A;  2CQG A;  5E3C A;  2M5Y A;  4IG0 B;  1VC0 A;  3MXH P;  1ZS6 A;  3DOM B;  2X3G A;  2UV8 G;  4E2F B;  1HYS B;  3CD7 A;  2CJA A;  3TUJ C;  3RTV A;  2UXD J;  3HJF A;  2KHD A;  5J2M A;  1FF2 A;  1REG X;  5KFW A;  3L3C A;  5F0W A;  2QLF B;  2U1A A;  5KFV A;  3ADA C;  2QA4 S;  4NX9 A;  4F4X A;  3OLB A;  1F3F A;  4LBI A;  2CQ4 A;  1HQE A;  3BZQ A;  2G4B A;  1H74 A;  2GVD B;  2NUU G;  1LOU A;  3QGI A;  5E5N A;  3RGI A;  3PW0 A;  1VS3 A;  4LUB A;  1B64 A;  2OP5 A;  1Q95 G;  3HCX A;  5DQG A;  3CWJ A;  2PI4 A;  5D4P A;  2RQC A;  4TQS A;  1TL3 A;  2OPP B;  2K2P A;  4IR1 A;  3DOL B;  3P4U B;  1GXU A;  1YRU A;  4DL4 A;  5EUH A;  4GKJ J;  4LRA A;  4PG7 A;  3KJV A;  2D9P A;  2EFO A;  2NQP A;  3CCW A;  2ZH4 A;  1BQM B;  3KLE A;  1Z1Z A;  4J9Q A;  4ZVE A;  3CT9 A;  3ZZT A;  4MIA A;  1UEU A;  5LXY A;  2ALZ A;  3CED A;  2RRA A;  3PDN A;  1LWF A;  2PEH A;  5J2P B;  1MW7 A;  1Q79 A;  2HFV A;  2VUG A;  3FVY A;  2QA4 G;  3H98 A;  3ISN D;  1X4G A;  1BLU A;  3Q8U A;  2R2T A;  4M5G A;  1VGY A;  2EVZ A;  5KFQ A;  3DLK A;  3M6U A;  3CC2 S;  1OYE A;  3FSY A;  1YIT S;  2NXE A;  4N41 A;  1LWX A;  1TL4 A;  1KS2 A;  2QEX S;  4LSN B;  2GQ2 A;  2HGN A;  4R0E A;  3H25 A;  4X4V A;  1PBU A;  2FHJ A;  7FDR A;  1OPZ A;  5F41 A;  5FJ4 A;  2JOQ A;  2KXH A;  4ZP8 A;  2YKN A;  5BJR A;  3V81 A;  4ZPW R;  1ZTW A;  2QLB B;  2ZVS A;  1H98 A;  2P9C A;  2VBX A;  4FDF A;  2FZK B;  2Y0B B;  3CE8 A;  4OI6 A;  4QIF A;  4LF8 J;  2RHQ B;  5HO4 A;  3I55 S;  1DQ8 A;  4P75 A;  3TRG A;  4F4Z A;  2CYY A;  2LDI A;  2BM1 A;  4A46 A;  1QE1 A;  3F56 A;  2LQB A;  1BMQ B;  1VMB A;  5LL6 d;  3M8P A;  1NK4 A;  2F40 A;  2FUG 9;  2C3Y A;  3WBZ A;  1FXR A;  4ZLJ A;  5KFK A;  4KSE B;  3OTO J;  4UY8 T;  2EC2 A;  2ZBC A;  1S7I A;  4LRF A;  5D0G A;  4OX8 A;  3THV A;  2HNZ B;  4C11 B;  2MHE A;  1FKO B;  1G6B A;  4ZPD A;  4J9P A;  3G6E S;  3IG1 A;  1MU2 B;  3I0S B;  3MD1 A;  2KRB A;  3HT0 A;  4QOT A;  4OI1 A;  1RP5 A;  2YVS A;  4GMK A;  2GIQ A;  3PW4 A;  2IA6 A;  3Q2T C;  1NSA A;  2GHW A;  1FVS A;  2H48 B;  4NZ0 A;  5I42 A;  2MKK A;  1QY7 A;  1Y5L B;  4NEY A;  1CC7 A;  2B9Y A;  2EKY A;  3R97 A;  4YDD B;  1NSP A;  1NND A;  3H8Y A;  1GAO A;  3HVT A;  2AJ2 A;  3OFH A;  5DO2 A;  1U4B A;  1RU2 A;  4MYT A;  5T7L B;  1FNM A;  4KGV B;  3DLJ A;  1D9A A;  1BUX A;  3A3O B;  5EDW A;  5HP1 A;  4LF9 J;  3HHE A;  5KFA A;  2R2U A;  3BV8 A;  2VG5 A;  1JLG A;  1JQG A;  1RAO A;  1F9F A;  3R7S B;  5KG7 A;  3J7Z 5;  4DMZ A;  1VYA A;  1FEE A;  1N0V C;  1RA6 A;  2HBZ B;  4NZ7 A;  4B9L A;  1GX6 A;  1FEH A;  1XNR F;  3LP2 A;  4DV5 J;  3VAL A;  3LW5 C;  3BR9 A;  1VC5 A;  1IVZ A;  3EDR B;  1SV5 A;  2ZNY A;  3DM2 A;  3FUY A;  3KDO A;  1ZPW X;  2UXC J;  3Q8Y A;  4OHY A;  1RQ0 A;  1DY3 A;  1OS5 A;  4WTO B;  1N6Q A;  1K1S A;  3P49 B;  4ETX A;  3OVB A;  3H20 A;  4PXE A;  1B4S A;  4FF2 A;  2N4C A;  1HHT P;  1YKW A;  3PRB A;  1UVM A;  3FRY A;  2CWX A;  3N6M A;  2VON A;  1I5O B;  2EKN A;  3BPD A;  2UV8 A;  2WHO A;  3CMA S;  2MHN A;  3PEH A;  2UUA J;  1FFW B;  4ECR A;  1MSW D;  4ZVS B;  3RB3 A;  4K8R A;  4URQ U;  2BAN B;  2EEY A;  3BGU A;  3ILI A;  1WOR A;  4TXS A;  3B82 A;  1R6V A;  2MJU A;  1XIQ A;  2E9T A;  4OHV A;  3CCQ S;  3TAP A;  2KO1 A;  3NGR A;  5CCL A;  4WXO A;  4U8Y A;  1AUD A;  5J2N B;  1LNQ A;  1VQ7 S;  1FDA A;  3OXL A;  4AE5 A;  1N6Q B;  3B54 A;  3PKM A;  1S0O A;  3AXK A;  3VV2 B;  3PAC A;  3DHW C;  3FEZ A;  2OSQ A;  2XM3 A;  1ZM9 A;  1FDN A;  4L74 A;  3UDE A;  3MMA A;  1BE4 A;  2W2M P;  4PEO A;  4UQT A;  3BBB A;  1HW9 A;  3GIR A;  3LP2 B;  3TNV A;  1XNQ J;  3AQO A;  2XZT B;  2NS1 B;  4A8X A;  5KT2 A;  4UTG A;  3ZTO A;  1JK9 B;  3F41 A;  2EWH A;  3GYG A;  5M2U A;  3CD6 S;  3GR1 A;  2ADB A;  1RSC A;  2HYI B;  4OYI A;  1TVR B;  3PRD A;  1L3K A;  2PMW A;  4ES3 A;  3EZU A;  5DG8 A;  4ED3 A;  2ATL A;  2XWX A;  3VVT A;  4WYL A;  3CCT A;  2WVF A;  5C2C A;  1NJX A;  2W7A A;  4W92 B;  1NO8 A;  3ZZ0 A;  4JI3 F;  1NKE A;  1W7W A;  3BBC A;  5B0G A;  2POK A;  3FK4 A;  1SIW B;  3SCJ E;  3T9N A;  1U6Z A;  4ZIW A;  3GE9 A;  5C24 A;  4BCA A;  1JLQ A;  5KFM A;  4MAK A;  5ETT A;  1ZPV A;  1IWA A;  3M1V B;  4C97 A;  1DBD A;  2W4P A;  1ZOT A;  2ZBQ A;  4DF4 A;  4WKR A;  2EFG A;  1F5C A;  5B0B A;  3RBD A;  1BHN A;  3DRP A;  3ZXW A;  4ECV A;  1RAE B;  1UWB A;  3MR7 A;  1I94 F;  3W62 A;  1VQM S;  2XMT A;  3M8Q A;  3ZTS A;  4TQR A;  2XS2 A;  3RG6 A;  1PCA A;  2RIL A;  3KFW X;  2IYI A;  3CD5 A;  4WP8 A;  1T9W A;  1P9Q C;  1BQM A;  2VFR A;  3KLE B;  3BDE A;  3I31 A;  3LGM A;  3POT A;  3SCL E;  3J7Y I;  2HFS A;  1FWP A;  1V3Z A;  4HTI A;  1GXL A;  5CYQ B;  4CYU A;  5GAE U;  3K57 A;  2R8I A;  1S77 D;  1F5A A;  4DR2 F;  4IQM A;  5J2Q B;  3OTO F;  2K7K A;  2YWH A;  4NI2 B;  1NHK L;  1JLA B;  3OL8 A;  2GJI A;  2VV5 A;  3OUY B;  1IBL F;  3M4X A;  5FDL A;  2HGM A;  2QL5 B;  2FHM A;  2HFN A;  3DRY A;  4B3M J;  4JYA F;  1NK0 A;  2VKZ G;  2ZD1 B;  3FMB A;  4LF9 F;  2HVI A;  2B7B B;  2MST A;  4PXB A;  4RW4 A;  2UUC F;  4KRW A;  4F36 A;  5IC4 B;  1O5J A;  2ZM6 F;  2R7W A;  2BBE A;  5DLG A;  4A4J A;  3IAM 9;  4CLL A;  3IR7 B;  3T1H F;  4QJV A;  1N48 A;  3G8S A;  4ED8 A;  2P9G A;  4ZMM A;  2C28 A;  2JJ4 D;  3B4M A;  1XMO F;  4IRC A;  1F2G A;  4IO1 A;  4U6P A;  3DRR B;  2AKW B;  3MZI A;  2HZA A;  2C2E A;  1IJF B;  2EBG A;  2JVR A;  2IAJ A;  1GMV A;  2DD8 S;  3BR8 A;  3I0R A;  5FLX Y;  3PR4 A;  3OHA A;  3JYT A;  4KHP J;  3QRR A;  2V50 A;  1RTI A;  5KFH A;  3PHE A;  1D8Z A;  3JYT B;  4H54 A;  2DNK A;  3QYY A;  4AYB D;  1CJU B;  2MQO A;  1E6V B;  1TMM A;  2EXU A;  3T41 A;  4OLO A;  4DR5 F;  2J6T A;  2DNL A;  3J80 Y;  4RNO A;  4LJM A;  1R8A A;  4GC6 A;  1XMQ J;  3LF0 A;  2AGO A;  4USW A;  2PA8 D;  4DPX A;  4KV8 B;  2PO4 A;  3UNG C;  1CS4 B;  5GAG I;  4OYW A;  4ICL B;  2VG7 B;  2O66 A;  4UW2 A;  5E3Q A;  2ZD1 A;  2PD1 A;  5AE2 A;  5K9F A;  1D0E A;  4FF1 A;  2H51 B;  2DEJ A;  2IDE A;  2D1C A;  2E1M C;  1ZM2 A;  1Y00 A;  1S1W B;  5T41 A;  3DC2 A;  2OEM A;  2FIU A;  4UUW A;  3D1O A;  4N7T A;  1KKH A;  4K4T A;  1IN0 A;  1SL0 A;  1GNK A;  3JTP A;  3RUB L;  4EMD A;  5B0C A;  4IRD A;  1NB7 A;  3MCO A;  4LF6 J;  4DV2 J;  5A76 A;  1RWW B;  1R89 A;  4JUZ A;  3M9M B;  2Q3P A;  1UW9 A;  3KJF B;  3K7R A;  4NLO A;  1NJY A;  1WDT A;  3ET6 B;  2BJ7 A;  2RDI A;  4AL6 A;  2IM3 A;  2IPO B;  2IYG A;  3PW2 A;  3KK2 A;  1AT1 B;  1IBK J;  2WVC A;  2R8H A;  4Y3C A;  3LTO A;  3QIP B;  3ICL A;  3FBC A;  1EZZ B;  2XI2 A;  1E6Y A;  3ZZR A;  3DLK B;  2HHV A;  3I56 S;  4HT7 A;  4USM A;  2DGO A;  4K4U A;  1JJ4 A;  1RT6 B;  2EG2 A;  3ITH B;  5IZH A;  4C8L A;  2W9A A;  1UZD A;  4CLW A;  2MGZ B;  4RW7 B;  3QT6 A;  2QJ3 A;  4CM0 A;  3DLE B;  4PWU A;  5IV3 A;  2R7R A;  4GO7 X;  3HT3 A;  2ZH5 A;  3B4D A;  2YWG A;  4B3T F;  3IR5 B;  4WFY A;  2HNY B;  2WSE C;  2YNI B;  1RKI A;  1WG1 A;  2V68 A;  3NCP A;  3EXC X;  3UO0 A;  1U1K A;  2I9S A;  3K5P A;  1J5O A;  1C0U B;  1RAD B;  3W61 A;  4A8S A;  3R7B B;  4RU2 A;  4USV A;  1L3S A;  4YOE A;  5L1K A;  2R42 A;  3OBI A;  4ZK7 M;  4RU9 A;  3P6Y C;  5GAH I;  2V8P A;  1FKA F;  4BC9 A;  5DET A;  2ROG A;  3CJ5 A;  5KT5 A;  1UA1 A;  4CQ1 A;  5KTQ A;  3FFI A;  4YR3 A;  4LIR A;  2K3I A;  4O44 B;  4RW6 A;  5D0H A;  2R8J A;  2P2C B;  2BZ2 A;  1IBC B;  2MZT A;  4FF4 A;  2GAH C;  4DUY F;  2GCF A;  4NCG B;  1T0T V;  2VF3 A;  2CNL B;  2CKW A;  4X66 J;  3M8R A;  2VOO A;  5DDO C;  4QQB A;  3CJ3 A;  3TAR A;  2FJV A;  1R8H A;  3EVO A;  4ANC A;  4ED7 A;  5DQH A;  3PXG a;  3W8P A;  3CVK A;  3IXQ A;  1RT7 A;  1WC4 A;  4ZLL A;  1FE4 A;  5I3U B;  2FHO B;  5E7O B;  4CT8 A;  3H42 A;  2ZUG A;  2KG0 A;  3H2V E;  4KAI A;  3ONQ A;  4JI6 F;  4LFB J;  1RAG B;  4WPA A;  5KT6 A;  1TEL A;  4IDK B;  3M8P B;  4KR0 B;  2UUB F;  1JLC B;  5GMK a;  2ZJP Q;  3UQS A;  3VAM A;  3MM9 A;  4QWE A;  2CAD A;  1GTH A;  2GO8 A;  5L1L A;  3OQ2 A;  4DR3 F;  1HMV B;  4G1Q B;  3MEE B;  3BEG B;  2MZS A;  4NOH A;  4F50 A;  1U1Q A;  1SJF A;  3CO9 A;  4DV1 F;  1SPB P;  1H72 C;  1X4B A;  4AD6 A;  2HFO A;  4Y28 C;  1XN9 A;  1NK6 A;  2HHQ A;  1X0P A;  2GAG C;  5GAD U;  3NS5 A;  4KKO A;  3FSX A;  2XY7 A;  1K9M T;  3FQL A;  5AE1 A;  5DGA A;  1F9E B;  2H54 B;  3IM9 A;  2FGC A;  1FVQ A;  1YX2 A;  1HLW A;  2E5J A;  2HIQ A;  2L9W A;  2LYV A;  2YQ3 A;  4MFB B;  5KT4 A;  3M30 B;  1HD0 A;  3KK3 B;  1NRK A;  3HSJ A;  2AGP A;  2HHH J;  1ROF A;  1XJW B;  2HSE B;  3GG1 A;  4CNZ A;  4YFU A;  2XHC A;  5L1J A;  4FN5 A;  2B9X A;  3F0N A;  3P96 A;  2JC0 A;  1RT5 A;  3HLU A;  1VK8 A;  3D1Q A;  3KG4 A;  4Y65 A;  2FVR A;  2DTJ A;  3TR5 A;  2V2Z A;  5BYQ A;  2Z58 B;  4LF2 A;  3N5F A;  3V5R A;  4CH0 S;  5KOX A;  1K73 T;  1TFW A;  2ZC4 A;  1B0V A;  4X84 A;  1UFW A;  1WC1 A;  4IFV B;  4PCQ A;  5LMN J;  2J7K A;  4Q7A A;  5L39 A;  2CAJ A;  3PW7 A;  2ZH3 A;  2F5G A;  3W3S A;  2MJN A;  2C22 A;  3MR5 A;  4FYY B;  2D3U A;  2HND B;  3ZC4 A;  1V9O A;  4ZVT B;  3AAW B;  1R6Y A;  2ZH7 A;  5K20 B;  1KLN A;  4CLK A;  4RBU A;  4LSZ B;  2KFY A;  1M5K C;  2FHK A;  3OXG A;  2WW4 A;  3HFK A;  3EGV A;  4O3P A;  2ZM6 J;  1JMT A;  1RAJ A;  1RWO B;  1JLB B;  3O6Q A;  4ZVP B;  3SMZ A;  1KSP A;  1VHI A;  3KJV B;  1V3R A;  2MQ8 A;  4DV0 F;  1NKC A;  2XS7 A;  1FKO A;  4I64 A;  4QW8 A;  2IIH A;  1UAW A;  4OYZ A;  4ZVU B;  1RXO B;  5H1S V;  4OZL A;  1NSK L;  4GO5 X;  2KYZ A;  1EIY B;  2RUS A;  1LW2 A;  2NUH A;  1CJK A;  2E29 A;  2PT0 A;  3RBZ A;  5EN1 A;  3DDK A;  4XTT A;  3ET6 A;  4Y2K A;  1F5B A;  1S0N A;  1S76 D;  2XBP A;  3D68 A;  3FNN A;  5H9F K;  1LEO A;  1CS4 A;  2B9W A;  3U1N A;  2IVF B;  4CT9 A;  2BRK A;  2M8H A;  2IM2 A;  1RUS A;  1NAQ A;  1S57 A;  2L3M A;  2QMW A;  2YPZ A;  3NY0 A;  4I0W A;  1QSY A;  1RT2 B;  4LR8 A;  1N52 B;  2EFP A;  2VZ9 A;  3EX7 B;  2IM1 A;  1QLN A;  3CTR A;  2FY1 A;  4ID5 A;  3JSY A;  2ACY A;  1CJU A;  2K1R B;  1U6F A;  2PA3 A;  3MPD A;  4OYB A;  4J9U E;  4WXW A;  4RUC A;  1RTH B;  2MGZ A;  1RHM B;  2K8G A;  3DCA A;  3PJW A;  1IKX B;  4ZPV R;  3SXL A;  2ACM A;  3U02 A;  3MFI A;  2JEJ A;  1YLX A;  1YJW S;  2M9K A;  3ENV A;  5T7L A;  4OHX A;  2VJV A;  3VAK A;  2I1R A;  3R5C A;  3HVT B;  1U26 A;  5T14 A;  4DSE A;  1RTJ A;  1TK5 A;  1NJI T;  3FZB A;  4O3R A;  3QWU A;  4YY3 F;  1TKT B;  2D3Z A;  3HSZ A;  3MD3 A;  4PUO B;  4MK9 A;  2YWK A;  2WRM A;  3HFZ B;  3QFW A;  4PXC A;  3CJK B;  4B17 A;  4FXW A;  1WD6 A;  1YDL A;  2IRY A;  2PDA A;  4DZD A;  1JX4 A;  2HMI A;  1RWK B;  5H9F J;  1VBZ A;  2J7U A;  1S1X A;  4PYD A;  1C2P A;  1H0H B;  2PMZ D;  4K4V A;  1KHV A;  1UEK A;  1FER A;  2BW7 A;  4I6A A;  4PZV A;  5B08 A;  1KTV A;  1RU1 A;  5ITH A;  4EYI B;  1SJ4 P;  3N28 A;  4URG A;  2G1D A;  1FWK A;  1SXL A;  2MQL A;  1KEK A;  1T9T A;  3WZ0 A;  4WFX A;  2CJK A;  1EKS A;  4C3L A;  1IBM J;  4Q8E A;  1HNW J;  5KG6 A;  1A0O B;  1JLA A;  4C8O A;  3QID A;  1S1T A;  1B70 B;  1HBU A;  6AT1 B;  4DFP A;  2D41 A;  2OFH X;  3NCR A;  4USU A;  4OV6 A;  4EUV A;  3H5X A;  2BA9 A;  2H4W B;  1T3N A;  3G86 A;  1SH3 A;  4A8O A;  1YZ7 A;  2J9C A;  2Y1L B;  3N79 A;  3HHN B;  2YX4 A;  2E44 A;  1ELO A;  1CJK B;  4RLE A;  5KFP A;  3T5K A;  2JEF A;  4F0M A;  2OPS A;  4CI0 B;  4ZHR B;  2GGP B;  2NPF A;  4DL0 C;  3TZY A;  1PGZ A;  4OYP A;  2YWF A;  3GFY A;  2WTF A;  3QQC D;  2JL9 A;  1TTH B;  3C46 A;  4ELU A;  1WF1 A;  1FRK A;  2AW0 A;  4USJ C;  3M8Y A;  1TU0 B;  4DI6 A;  3T5H A;  2FVQ A;  1RT4 B;  1H7W A;  2CIM A;  2FD2 A;  4M8L A;  4QIG A;  2QSW A;  3M32 B;  5KFZ A;  4DFM A;  1M1G A;  4DHV A;  3CDB A;  3AOA A;  1BWE A;  2XO6 A;  2CQ3 A;  2XMW A;  1S1X B;  5B0F A;  4DR7 J;  5CZX A;  5ETL A;  1Y3K A;  5C25 B;  1UKU A;  2CG8 A;  4WJB A;  5I3P A;  4B9N A;  3PRV A;  1GMU A;  3FC9 A;  5D0R A;  3TA1 A;  1X5O A;  1QSS A;  4OI2 A;  1DTT B;  4LRE A;  1TKT A;  3M1V A;  3MPV A;  4ZHR A;  1RCO B;  2BUN A;  1HHQ A;  3U1M A;  4F4Y A;  2BJ9 A;  4LQ3 A;  2F7V A;  1YRT A;  1S12 A;  1REV A;  2DB1 A;  2IBO A;  4Y34 A;  3CCR S;  1NK8 A;  2ZJR Q;  4FF3 A;  1FX2 A;  4Y0F A;  1W26 A;  4J90 A;  1LFW A;  5K8N A;  3UD3 P;  3EYZ A;  2AYG A;  3ILJ A;  3UPF A;  4EBC A;  1SJR A;  3PW5 A;  4O23 A;  2VG6 A;  2ZH9 A;  2FVP A;  1FRI A;  1FA0 A;  2DNP A;  3D67 A;  2JEG A;  1Q8B A;  4NA2 A;  3DMJ A;  1HQE B;  1MN9 A;  4I7F B;  2B5J A;  3JS9 A;  3R5D A;  5HJY A;  3I82 A;  1JLF B;  2GO9 A;  1VQY A;  4YY3 J;  4R0J A;  3EMT A;  2IHR 1;  4GVB B;  1QUP A;  4OJ3 A;  4F0K A;  1UWB B;  2DHH A;  3DRP B;  3FCV A;  1WSR A;  2XYH B;  4OZ3 A;  3QAT A;  2AZ3 A;  4WE1 B;  4U8V A;  1S48 A;  4CLF A;  3CME S;  1APS A;  3NWR A;  3D5M A;  4F4W A;  2E5L F;  4NCB A;  2FJW A;  2BYC A;  4KPC A;  1HYS A;  1PSD A;  4YR0 A;  1OY9 A;  2MEW A;  2YPY A;  1WUU A;  3DOM A;  3TAQ A;  3QRQ A;  5KT3 A;  4RL1 A;  2YNG B;  1Z4U A;  1K0T A;  4DX5 A;  3OT9 A;  4ITS A;  2JRS A;  2VFS A;  2GZO A;  3PNI A;  4YQW A;  1X31 C;  2GHP A;  2YX1 A;  3AXM A;  1N88 A;  1FRM A;  3MM8 A;  1EP4 A;  5LSL A;  3EZO A;  3NP5 A;  2YQ0 A;  1U09 A;  2IC3 B;  5F0U A;  5HN0 A;  3GV7 B;  2ZJQ Q;  3WC2 A;  4LF8 F;  1WF0 A;  3D1H A;  4KIA A;  4NCG A;  4NE9 C;  2J6U A;  4WKY A;  1GX5 A;  1UFK A;  1SV5 B;  3EVM A;  2V4R A;  3CGI A;  3HHL C;  1U0H A;  3KMQ A;  1ZM4 A;  2HHT A;  5BYS A;  2AJ1 A;  1UPM B;  3I5C A;  4R25 A;  5CA5 A;  4B3S J;  3HHD A;  1XWL A;  2XEX A;  2KFN A;  3E2E A;  2RQK A;  1B99 A;  2CWK A;  5A8W A;  1AB8 A;  2HLU A;  2K3K A;  2ZNZ A;  3AOD A;  5CD4 A;  3Q8Q B;  3ETM A;  1XMO J;  1N34 J;  1A7G E;  2F4V F;  2BJ3 A;  1IR2 A;  1OQ3 A;  3QPI A;  2CPY A;  4J7C A;  1M0S A;  5I3Q A;  3R5G A;  1EJ7 L;  2Z4P A;  3J7Y U;  1Y9O A;  1DAR A;  1S49 A;  4FPI A;  3MR2 A;  1KC8 T;  3RBE A;  4CYU B;  2I0X A;  2IC3 A;  1FCA A;  2E1A A;  2QMX A;  5DZ6 A;  2G0J A;  2W8L A;  1KHW A;  1R8C A;  2ZE2 A;  2MZJ A;  3KHG A;  3C3L A;  3QJP A;  4Q45 A;  4Z2X A;  1T11 A;  1SKS A;  1QSL A;  2NZC A;  1DQ9 A;  3PYD A;  3A3N B;  3V6J A;  4K2J A;  2YNH A;  4XDC A;  2KVI A;  2VL1 A;  4DLG A;  1UJ4 A;  3IN5 A;  2ADC A;  1E6Y B;  3T19 A;  4OI0 A;  2HQD A;  2LA6 A;  1VIS A;  4ZCM A;  1S6P A;  2NZ4 A;  3W65 A;  4P9S A;  2B8Q A;  4E98 A;  1KON A;  3MDF A;  4J9O A;  3RB0 A;  2E7X A;  1TK8 A;  2ASY A;  1KN6 A;  2OEJ A;  4J9R A;  4FP9 A;  4ELV A;  4ZVH A;  4QIV A;  2ZOM A;  8AT1 B;  5EWF A;  2LEC A;  4U9R A;  2RU3 A;  4LIW A;  2KFZ A;  4RZR A;  1FJ7 A;  4TNO A;  3MM5 B;  2ZH2 A;  4PQU B;  2CPZ A;  1HHS A;  4F04 B;  3UNY A;  2XY6 A;  2UU9 J;  2ZDP A;  4F2S A;  1ZAW A;  1WKK A;  2XO7 A;  2AU0 A;  2AGQ A;  2LMI A;  2OEL A;  3C6U B;  3GR0 A;  2G2O A;  4M5K A;  2YWW A;  3W8G A;  2CZ4 A;  4F0H A;  5DLF A;  5LOQ A;  2I38 A;  4DR4 F;  2HHW A;  3QGH A;  3GFZ A;  5G0R B;  2UZA A;  1FE0 A;  3W7B A;  4ID8 A;  4O44 A;  3HF5 A;  1SKR A;  2OD6 A;  1T05 B;  4LSN A;  2FLL A;  2BJD A;  4CO3 A;  2BV3 A;  2MDA A;  3UD5 A;  2N4D A;  4HDG A;  5HLF B;  3IGN A;  3VGS A;  4UOC A;  1NB2 A;  3DI6 B;  4FXV A;  4KC5 A;  4QWC A;  1M5H A;  3BN4 A;  1RWX B;  4CLT A;  2FJA B;  4R5P B;  1X9W A;  4ES2 A;  2Z0G A;  3DDN A;  1W2B R;  3LP0 B;  4ED4 A;  4FNH A;  2XMV A;  2H5E A;  1D8Y A;  2KH9 A;  2OTL S;  1GFW B;  4C11 A;  2VIH A;  2MKI A;  1RTZ A;  2NRE A;  2AJF E;  3KLG B;  3GU0 A;  1YBT A;  2C2Z B;  2BW2 A;  2AHO B;  2WOM A;  5AXN A;  4RW7 A;  4WZQ A;  4NMX A;  4QWD A;  2V8G A;  2BE2 A;  5FD1 A;  2HK3 A;  4A8W A;  4NYP A;  3I6P A;  1WEX A;  3NGU A;  2L48 A;  2V8V A;  2FPH X;  1VQ9 S;  1KD1 T;  5HQM A;  5LXR A;  2KYX A;  3QIP A;  2DNQ A;  2FZG B;  3PJ9 A;  1DAX A;  4M63 A;  3K5L A;  3BSO A;  2BM0 A;  4QWA A;  2C2K B;  4WFB Q;  4GKK F;  2V8H A;  4CTA A;  3KLF A;  5LMU J;  3EXY A;  4CLS A;  3ZNU A;  4IKA A;  1U45 A;  3DGP B;  2V2V A;  4BDP A;  3O2I A;  3I32 A;  3P45 B;  4KGM A;  4Q43 A;  3KJN B;  4LF7 F;  4JB8 B;  2OAU A;  3CJ8 A;  4DSI A;  4QR1 A;  5KG1 A;  1S59 A;  5KFR A;  2O67 A;  1GMW D;  1X9M A;  4B9V A;  4MKV A;  4OI4 A;  4UOG A;  1NDC A;  3D0H E;  4O3S A;  4M5J A;  4NCA A;  3CUN A;  3TVZ A;  3C19 A;  2W2N P;  3I96 A;  2DRD A;  5KFX A;  3J80 U;  2VG5 B;  1HWJ A;  2ZVI A;  1PAU B;  2QMU B;  3OR2 A;  3J7Z T;  3RAX A;  2KXN B;  3AB2 B;  5KAK A;  1QUV A;  2YKP A;  3NMR A;  2DNN A;  1TK0 A;  3HSD A;  1HAR A;  3A8E A;  5KFC A;  3P8B B;  3RYL A;  1SJ3 P;  4FS1 A;  1FJC A;  4ZPB A;  5D3G A;  1JXL A;  4DQQ A;  2J0Q D;  5IQQ A;  4DEZ A;  2E1C A;  2AF6 A;  2HAI A;  5CHC B;  1SB6 A;  2HUR A;  3QLH B;  4DPW A;  1CJT B;  2EI5 A;  2R7O A;  4HI1 A;  1TL3 B;  2OPP A;  2IAJ B;  1KWM A;  1HNI A;  1R7I A;  3AHP A;  3I0R B;  1R3N A;  1S7H A;  3UFC X;  2VQF F;  4K5S A;  1NLK L;  4D3G A;  4ZVF A;  1S1W A;  1Q8I A;  2AYB A;  1MMD A;  2J8A A;  3VWS A;  3GP9 A;  3UDV A;  4A48 A;  7FD1 A;  4DQP A;  4M95 A;  2RF2 A;  1CUL B;  3MMC A;  4RNF A;  4UQG A;  4Q8F A;  1H7X A;  1RBL A;  2VPZ B;  4B3R F;  3NL0 A;  1N33 F;  4DV6 J;  1DZ5 A;  5LM7 E;  1YBA A;  2HBQ B;  4TYB A;  3NS7 B;  2QYG A;  2B4V A;  4DLE A;  4C8Z A;  4DV3 J;  2VA2 A;  4Y2A A;  3FEX B;  5SZT A;  1Q8K A;  5HL7 Q;  5IT9 U;  2F9J A;  5DZ7 A;  1EQM A;  2CQ1 A;  1VJW A;  2F1F A;  2H3E B;  3FQK A;  1VBX A;  3SCK E;  4K2X A;  2HVH A;  4IFY A;  4DCP B;  2KN4 A;  3ENA A;  1IKV A;  4ZLP A;  3H2L A;  1R27 B;  4PQU A;  2WVE A;  4I2Q A;  3KLV A;  4DZ6 A;  4MYU A;  1R0A B;  3RZA A;  2N82 B;  3HKZ D;  4PG6 A;  1HWL A;  2VKR A;  3G2X A;  4DV7 F;  3RR7 A;  4E0D A;  1BGX T;  3R6L B;  4O0N A;  4MKB A;  4B9U A;  1Q4R A;  1LKZ A;  5D4L A;  4AXI A;  4ZJL A;  3PR5 B;  3CCZ A;  4DSJ A;  2DR6 A;  1BQX A;  2WZ1 A;  4DG1 A;  3BKT A;  4WK1 A;  3NWG A;  2UUC J;  3K59 A;  1JLE B;  3KJQ B;  3OFG A;  3JSR A;  1T94 A;  3EWG A;  2JDJ A;  3K8W A;  1RWP B;  2GVZ A;  3MAA A;  1NU4 A;  1TV6 A;  2VB6 A;  5CZV A;  5ETN A;  4DXL A;  2XQC A;  1VQ4 S;  1IKV B;  3T6B A;  1BQN B;  3ILL A;  2X51 A;  1FWL A;  4OYM A;  4TU7 A;  4W98 A;  1VQK S;  4MK8 A;  4NEZ A;  3CJR A;  4UY8 5;  4FYD A;  2BAC A;  4C8K A;  2I5J A;  3LAM A;  4J91 A;  1P6T A;  4NLQ A;  2GMH A;  5JVG Q;  5J2Q A;  3OLA A;  3M8W A;  2ALY B;  3FBB A;  2MQP A;  4CIO A;  5AXL A;  2MLX A;  3RU0 A;  1FJE B;  2V9W A;  2FLO A;  2M0G B;  2CQP A;  3NBP A;  3ZFV A;  4DUZ J;  2HEK A;  4NLY A;  4YHH J;  3CIZ A;  4OJG A;  5C25 A;  2ZZM A;  3GPA A;  3BS9 A;  3QT8 A;  5F8G A;  4EZ6 A;  1RHJ B;  4YR2 A;  1YHQ S;  1XNR J;  1PJ7 A;  2M70 A;  1RKJ A;  1JJ2 R;  3N0V A;  3OFE A;  2GVZ B;  2R9L A;  2CQD A;  3GIJ A;  3F44 A;  2YX7 A;  4RWW A;  4DG1 B;  5C24 B;  4B3M F;  1O6X A;  1RJJ A;  1SJQ A;  1HNZ F;  3Q24 A;  3TVK A;  3THP A;  4USI A;  2N3O A;  3EDQ B;  4EU0 A;  3W1Y C;  3HPO A;  2A1B A;  2DXD A;  3K89 A;  4JI3 J;  4CDI A;  4J9N A;  1QAI A;  3V6D A;  1R8B A;  1TL1 B;  3A8J A;  2DYA A;  2P6S A;  3U7J A;  4B9M A;  3D6H B;  4C3K A;  3MM6 A;  3ZZY A;  2QFI A;  1XR5 A;  1T8E A;  4HKQ A;  1YJT A;  3JQM A;  4PAB A;  2LEA A;  3CC7 S;  3CNQ P;  4DR1 F;  1FI4 A;  1S1T B;  2YQ1 A;  2GW8 A;  2PE8 A;  1FRH A;  3EVW A;  2MKH A;  2V4J A;  3FMW A;  3MI7 X;  3V81 B;  3NNH A;  2GV1 A;  4EFA C;  1DTQ B;  2D69 A;  3HUL A;  3D6T B;  2BKN A;  4QBU A;  3E8O A;  2RQM A;  1N36 J;  1S0V A;  3PFO A;  4I1T A;  2DNR A;  5BR8 F;  2OFG X;  4D3H A;  5L1I A;  2UVW A;  3R6G B;  4DSL A;  2D3O 1;  2IJR A;  4ATN A;  3BYP A;  1Q81 T;  2C2D A;  2FJB B;  1HBN A;  2GIF A;  1PG5 B;  1BXN A;  1Y5N B;  1ULR A;  2OI2 A;  2IJF A;  2DIV A;  1U48 A;  5K5M A;  4WFN Q;  1WEZ A;  1C1C B;  2W7P A;  4K4Z A;  1HNX F;  4BWJ A;  1OPI A;  1HA1 A;  2DK2 A;  2J0X A;  3M2U B;  4AL7 A;  1CJT A;  3GSI A;  4U7U D;  3VR1 A;  3MTJ A;  1ZTT A;  3BM7 A;  3KLH B;  1JNZ B;  3AD7 C;  4WZM A;  1EAR A;  3MEC A;  2ZIT A;  1B0T A;  3MED A;  3BPS P;  3R5A A;  3OTE A;  3HFV A;  5E3P A;  3C16 B;  4HYK A;  2N7C A;  1DHM A;  3O5T B;  4WP3 A;  3W9I A;  4LF5 J;  2OTJ S;  1TKX A;  1BY9 A;  2ZKU A;  1U25 A;  2RAQ A;  3SEO A;  4P74 A;  3SSS A;  4DV3 F;  1T9X A;  3TX0 A;  4CH7 A;  3OR2 B;  4J9L A;  3E51 A;  3MUT P;  4DR6 J;  3RJM B;  2KJW A;  2QSF A;  4O4G A;  2UXB J;  3PIP Q;  2P5V A;  2PN6 A;  2W2P P;  2HWT A;  2HQF A;  1IR1 A;  3IA0 A;  4TLQ A;  4AQY F;  1PIL A;  1G4C A;  2G2Y A;  5H9E J;  4F8R A;  3X3U A;  3HHL B;  1UVI A;  1Y3J A;  4DQI A;  3R8Y A;  3VGU A;  1J27 A;  2C3M A;  4EI2 A;  4NI2 A;  4OYA A;  1NJW A;  1JWW A;  1NK7 A;  1VQO S;  2NYI A;  5IC6 B;  4ZVQ B;  4P2X A;  3QBC A;  1NME B;  3GJR B;  2UU9 F;  1R31 A;  3BSC A;  3GYN A;  2YKN B;  3C16 A;  1CQN A;  3C6U A;  3DXS X;  4L76 A;  1HW8 A;  5D0E A;  3GB0 A;  3Q8V A;  3HVR A;  3HO1 A;  1Y7P A;  4NXM F;  2EFV A;  1C4C A;  4CRJ A;  1TAU A;  1LWE B;  1RE1 B;  4CO4 A;  1ACM B;  2RD5 C;  2HAF A;  2ZHA A;  1FX4 A;  3DLG A;  1VRT A;  5IM0 B;  1I51 B;  1YGY A;  2Z2L A;  3C14 B;  2MZ1 A;  3K5O A;  3MM9 B;  2UXC F;  2HVZ A;  4DR2 J;  4CO5 A;  1MML A;  1P8G A;  2XHW A;  1VDH A;  1Q5V A;  2BRL A;  2CJ9 A;  1R0C B;  4IG3 B;  4OI3 A;  4WII A;  5HVH A;  4U95 A;  3VAI A;  5HLF A;  4PKD B;  4N8N A;  3BB5 A;  4KQZ A;  1EET B;  2FGO A;  1NCL A;  2VC1 A;  3RB4 A;  1C4A A;  1RT5 B;  4NLW A;  3VGV A;  2WK4 A;  4O3Q A;  9RUB A;  3LUY A;  2XMU A;  4UST A;  5ETV A;  3FGV A;  4YHH F;  4B02 A;  2OHD A;  2GJ2 A;  1JJC B;  3UN2 A;  3GIK A;  1VLO A;  2OMO A;  2PSZ A;  3D66 A;  1FRL A;  5C7P A;  4JI6 J;  2VOD A;  1SC6 A;  4QYR A;  1QAY A;  1UET A;  4FBU A;  3R9L A;  3LPY A;  2DO0 A;  4WF9 Q;  2MXY A;  3AA9 A;  1X4F A;  1U49 A;  3A13 A;  3CCS S;  1BC6 A;  2G0I A;  2F9D A;  2Z57 B;  1V3S A;  4KH0 B;  4Q2M A;  4ZPA A;  3UN3 A;  4DR3 J;  1FKP A;  4I2P A;  4MMO A;  2OKQ A;  3J7A N;  1HMV A;  4G1Q A;  4X4S A;  2GA7 A;  3RAM A;  2XG8 A;  3KOA A;  2DNH A;  2KTQ A;  2AYM A;  2IVM A;  1JLE A;  4QW9 A;  1T9U A;  3W63 A;  3VAH A;  4P10 A;  1EKR A;  1S5Z A;  1FES A;  2A6M A;  4O4G B;  2R7S A;  3M8Q B;  3KLI B;  2FC8 A;  3G87 A;  3KG1 A;  2LEP A;  5C5J A;  2Y1I A;  4B3T J;  1RAA B;  2AT1 B;  3MTK A;  3ULH A;  2I2Y A;  3BH7 B;  3GCW P;  5KFF A;  3GV8 B;  5IWA F;  2DNO A;  2GHV C;  3N9U C;  1JLB A;  3V6K A;  1N34 F;  4BS2 A;  4A8F A;  2F4V J;  1RAF B;  5ETS A;  4EO6 A;  1WTF A;  3VHQ A;  3JAM U;  5HVG A;  4N47 A;  1CQM A;  3OPK A;  5ETP A;  3QO9 B;  1WJ9 A;  3QZ8 A;  1NJZ A;  2HFU A;  4JI1 F;  1SVD A;  1WNE A;  5EWE A;  3GG0 A;  4PXD A;  1YIJ S;  5GAD I;  1QVF R;  1MG7 A;  1T9Y A;  5HVF A;  5HAT A;  1WOS A;  2AP6 A;  3V4I A;  1X4E A;  1HNX J;  4UUX A;  4LF4 J;  5F8M A;  3MUR P;  5F8J A;  2V2Q A;  1QAX A;  3UDC A;  1HIY A;  3WX8 A;  2DGU A;  1S1V A;  3I4H X;  4L75 A;  3TWZ A;  2DCL A;  2E1R A;  4G3I A;  4GC7 A;  2H65 B;  5KFG A;  2LP4 A;  4CO1 A;  2VQE F;  1S99 A;  1U1O A;  4R8U B;  1J5O B;  3CDA A;  4ILR A;  4H4K A;  3EPI A;  3CJ4 A;  1LW0 A;  4WTY A;  2CG4 A;  2ZBP A;  2B43 A;  4HI2 A;  4BLG A;  1S10 A;  1HBO B;  3TEH B;  1D3W A;  3M30 A;  4K7Q A;  1DTQ A;  5HK4 A;  3J81 j;  1PO6 A;  1MRO B;  1VHF A;  4H4M A;  4U96 A;  3Q22 A;  1M5V C;  4F2R A;  3ZTP A;  3UR0 A;  4ZA1 A;  3HM9 A;  4NXN J;  1NSQ A;  2HRT A;  2AJQ A;  3P5T L;  5JUM A;  1UW4 A;  1CUL A;  3MMC B;  5THW A;  4DV4 J;  4MT1 A;  2O01 C;  5J2N A;  1XMQ F;  2ZFH A;  4WBF A;  2DGQ A;  1NK9 A;  5EGY A;  3TZW A;  1MWZ A;  1YJ7 A;  5F8I A;  4ECY A;  1JLC A;  1U1L A;  2CQH A;  5I42 B;  5CAB A;  2DH8 A;  3NGD A;  2IBK A;  4DL5 A;  2QFJ A;  1WTB A;  4NRT A;  1S6O A;  1S6Q A;  1RTI B;  2APO A;  4X66 F;  4HAC B;  1X4C A;  2EG1 A;  2VOP A;  3DYA B;  1X5P A;  2O1P A;  4PYA A;  3CCL S;  2R8K A;  3S1T A;  1WF2 A;  2DHA A;  3EUN A;  4HEA 9;  2K1R A;  2MZR A;  5EX0 A;  1VQL S;  2W9C B;  1SC1 B;  3HI9 A;  1H38 A;  1PYO B;  2ZBR A;  3CDW A;  2KI2 A;  3AY0 A;  1QE1 B;  1N5Q A;  5CH7 B;  2OIH A;  3QZ7 A;  2JFD A;  1AA1 B;  1LW0 B;  2DNG A;  4ICL A;  2V8D A;  2X1A A;  1D9D A;  2FVS A;  1YK9 A;  3DGP A;  1UJ6 A;  2E7W A;  5L38 A;  1B0P A;  4YEA A;  2DEI A;  3DFE A;  3T9Z A;  2OPS B;  4P52 A;  4C7Q A;  2J7W A;  3NBP B;  3Q2S C;  3G8T A;  3CIM A;  4JV1 A;  5ETO A;  2DT9 A;  3Q89 A;  1U47 A;  3O1L A;  1TKD A;  2XYP B;  4J9V A;  2FTR A;  1M90 T;  2NCK L;  4F26 A;  2CZV C;  3WX4 A;  5DGB A;  2QG9 B;  1KLM A;  1EB0 A;  5A0Y A;  5KFN A;  3OVS A;  5KFS A;  2C2N A;  2FHJ D;  3TP2 A;  2OPQ A;  3DHX A;  2NR0 A;  3CUL A;  2Z2Z A;  1O8B A;  5K8O A;  2MY7 A;  4LF5 F;  1T9V A;  1O51 A;  1TP7 A;  4ES1 A;  1SC4 B;  3BO3 A;  3PTW A;  5KG5 A;  1FK9 B;  5A8R A;  4YB7 A;  1OYD A;  1KOH A;  1S6U A;  1DTT A;  4IQX A;  3GTY X;  4DU7 A;  2EW9 A;  3RRK A;  2E5G A;  2B6A B;  3ITH A;  2C42 A;  2WSF C;  3JSB A;  3KKF A;  5HAN A;  2PI5 A;  2O5D A;  3HP6 A;  3CJS A;  1KVJ A;  1U1N A;  3BO2 A;  2AYE A;  1G1X A;  2JVO A;  1IM4 A;  3L9Z A;  2B4P A;  1ZZF A;  4IG3 A;  1B7F A;  1SKU B;  3PM9 A;  4F3Q A;  2HRU A;  1LWC A;  3MGJ A;  2QLX A;  1SL1 A;  3LO3 A;  3MM7 B;  3MUM P;  2E7V A;  2HLT A;  5CYJ A;  3T1H J;  3R2D J;  1NH8 A;  4F02 A;  4N76 A;  1VRT B;  4J37 A;  5IM0 A;  2IVY A;  3L09 A;  3W60 A;  3KMS A;  5KFJ A;  3H4B A;  4LT6 A;  1YVF A;  4RW8 B;  2RIJ A;  3CJQ A;  2KM8 B;  4C8N A;  1UEV A;  1Q53 A;  4M5M A;  1RTD A;  1HPZ B;  4H4K C;  2QC3 A;  2RDD A;  2W24 A;  1RHR B;  3U1L A;  5DQI A;  4JI1 J;  3D2W A;  1Y4Z B;  1YBU A;  2WAQ D;  2CRL A;  4N8O A;  4DPU A;  4IRK A;  2GVD A;  4XPE A;  1ZAX A;  1N32 J;  1VJQ A;  5GAG U;  1KFS A;  3RR8 A;  1TL5 A;  1PKU A;  6FDR A;  1R0B G;  3H5S A;  2HFZ A;  3MFH A;  3SDE B;  2X1F A;  2L9N A;  3NG8 A;  1VRU A;  2C2M B;  2JLF A;  5ETM A;  5KFD A;  4MIW A;  1M5P C;  3TAM A;  4ER8 A;  2ZZN A;  4PPZ A;  2RHS B;  3ETO A;  3QRP A;  4JOU A;  4A8K A;  4LMZ A;  1OY6 A;  4DV0 J;  1RGV A;  1VCT A;  2VFU A;  3MMA B;  4KHR A;  4YDX A;  2VQF J;  1G7C B;  2BX6 A;  3ENQ A;  4AXJ A;  2V4Q A;  2XZW A;  3C14 A;  4OX6 A;  3A8K A;  2HMI B;  2DIS A;  3DLH A;  3LA0 A;  4KBI A;  3SV4 A;  3D54 A;  2DY9 A;  2LFV A;  4R5P A;  2VQE J;  1WSV A;  5GAE I;  1WHY A;  3CCV S;  5RUB A;  1S1U B;  2AV5 A;  4WWS A;  5U47 A;  2OPQ B;  3I87 A;  1ZH5 A;  4RR5 A;  1GXT A;  2W8K A;  2DNY A;  2RRN A;  2LXU A;  4MIB A;  3SQO P;  3GV5 B;  3W64 A;  2XSF A;  5C42 A;  1LK5 A;  4M5N A;  4DJB A;  4K4W A;  1B3T A;  3B6B A;  1KVI A;  1TL7 B;  2A2C A;  2Q6B A;  3GON A;  4N5S A;  5A8W B;  2ZE2 B;  3IC1 A;  5HMY A;  5J1P A;  4AT1 B;  2FZC B;  3KWM A;  3KUE A;  3C6T B;  4I6Y A;  4ALZ A;  4QPX A;  3TA0 A;  2N3L A;  4M94 A;  1IM6 A;  3PYE A;  3PHT A;  2R4F A;  1Q86 T;  1P1T A;  1AFI A;  4Z7C A;  5IWA J;  2B0G A;  1N5S A;  1K0V A;  1NPK A;  4KO0 A;  5CYM B;  4PG8 A;  1F60 B;  4S0M A;  2BXJ A;  3MF5 A;  4WU3 A;  4DL3 A;  1TV6 B;  3CCE S;  1Q0N A;  2AX1 A;  3E01 A;  4RO0 A;  5DM7 Q;  3R27 A;  4ZP7 A;  5IT4 A;  4C3M A;  4TYA A;  2W4C A;  4I69 A;  1A6L A;  5K14 A;  4CP5 A;  4ZIT A;  2MZQ A;  3T1Y F;  1YG0 A;  4OZ1 A;  2BDP A;  3SSR A;  2HND A;  2PFD A;  1U1M A;  1RT1 B;  3VAG A;  2UUA F;  2COL A;  3QGP A;  1N54 B;  2XCP A;  3KK2 B;  2VBW A;  1VRQ C;  4ECQ A;  2MQM A;  2W2Q P;  4DL7 A;  3T5L A;  4QR2 A;  1YQH A;  2ABY A;  4LFA J;  1HNV A;  4NLX A;  4EBE A;  1YJ9 S;  1QM9 A;  3CPW R;  2Y1R I;  1MWY A;  2DRB A;  1CEZ A;  1JIH A;  3KK1 B;  1S72 S;  5E41 A;  2OH2 A;  1WEL A;  2HQI A;  5KOW A;  4K4X A;  5D15 A;  1X4H A;  2J9D E;  2OLW A;  1IQT A;  1S0M A;  1S4E A;  5F9L A;  2JLE A;  4EYH B;  2QA2 A;  4M5L A;  2XC9 A;  3OHB A;  3DI6 A;  1U2R A;  2VG6 B;  1NPR A;  2J9D A;  4RPF A;  4QWB A;  2Q66 A;  4QU7 A;  2QV6 A;  2RUG A;  2J6S A;  4LR7 A;  4U7C A;  2OD4 A;  3D6M B;  3MMJ A;  2W1B A;  2XGQ A;  1FKP B;  4I2P B;  4DN9 A;  1T05 A;  4OX9 F;  2MY8 A;  3W2W B;  1WDD A;  3FFI B;  2BKO A;  3OFF A;  3KYL A;  4Z7Y A;  3CJ2 A;  3VAF A;  2W01 A;  2MB0 B;  5IS2 A;  4WCE Q;  4X4Q A;  1IR0 A;  3CCJ S;  2W7O A;  3ZZO A;  1SUQ B;  3P5B P;  4PWD A;  3O8W A;  4KY3 A;  1DUR A;  3V6D B;  1DJ0 A;  4OQJ A;  5DDP C;  2UUW A;  3IO1 A;  5AXK A;  4C0H A;  2K06 A;  1ZET A;  1K47 A;  2CNK B;  2DNM A;  3BGR B;  3J81 Y;  1D1U A;  3CDE A;  1ZAV A;  2YNI A;  3AH6 A;  1REV B;  2YNG A;  1YI2 S;  3D0G E;  3TZZ A;  2UUT A;  4YME A;  1XC9 A;  4C2M A;  3WQP A;  4KHM A;  4CO0 A;  3N6L A;  2BJE A;  1IQZ A;  4CZC A;  3TUI C;  3Q86 A;  3OTC A;  4HVZ A;  2V0N A;  3IP0 A;  1OQ6 A;  2VJU A;  1CBK A;  3NOG A;  1CVJ A;  1FJG J;  2A0F B;  1H73 A;  3QSI A;  3KLI A;  4RX6 A;  3SYZ A;  3DLG B;  3KHL A;  4ILM A;  1HL6 A;  5CD4 H;  3H59 A;  1JLF A;  3T1Y J;  1LWF B;  5J2P A;  3JB9 k;  1PC4 A;  4TY8 B;  2ZHO A;  2YBV A;  1PYT A;  2ZOG A;  1CJV A;  2W4D A;  2CZ9 A;  2DCU B;  5IT9 Y;  1P1L A;  3H40 A;  4YP3 A;  2B3T B;  1WHX A;  4KYZ A;  3W2V B;  5L9N A;  3L7O A;  3T5J A;  2E66 A;  3SBM A;  2CA9 A;  4KGX B;  4IR9 A;  1PBA A;  1X8D A;  3SI8 A;  3GJQ B;  3W2V A;  4RW9 A;  5F9N A;  3MCM A;  1WOP A;  4LQ9 A;  3BQ2 A;  2HZV A;  1BQN A;  2XWY A;  1CPZ A;  2DR8 A;  2SXL A;  3BYR A;  1YJV A;  1JKH B;  1HKA A;  5KG4 A;  5J1E B;  4LFC J;  1FRX A;  1M5S A;  2DNZ A;  2FYX A;  2KRR A;  3P3D A;  2VU5 A;  4P2F A;  2HS0 A;  2VG7 A;  2JLG A;  2LXF A;  4FBT A;  1RHK B;  2FJE B;  3H7H B;  1HBU B;  4AUK A;  2VH7 A;  2XUL A;  4AQY J;  3QJJ A;  4G1I A;  2Z30 B;  2P6T A;  2P9E A;  3KUG A;  4PG5 A;  3UCU P;  4DV1 J;  5KFE A;  2HG4 A;  3ISZ A;  2W9C A;  2GX8 A;  2M4M A;  3GJT B;  5HQ8 A;  3TW0 A;  2AJ4 A;  4CM2 A;  3MEG A;  3AD9 C;  5GAH U;  2CUY A;  2BMB A;  1YSJ A;  2W25 A;  5ADZ A;  1T03 A;  2BAB A;  3IG1 B;  2CXE A;  4UZB A;  2N7Y A;  2VC0 A;  2KM8 C;  1YWX A;  1DLO B;  2XTJ P;  4HHU A;  2V2K A;  3BH6 B;  2NXJ A;  3LP1 A;  1OY8 A;  3NAH A;  4F25 A;  5HMW A;  3M8S A;  3RAQ A;  4ELT A;  2Y9H A;  2Q43 A;  4JI2 F;  1MLA A;  1RT2 A;  4Y2I A;  1NM2 A;  1TVR A;  1M1H A;  2XMK A;  3M05 A;  2L9D A;  2B4U A;  4KFB B;  4PPD A;  2XLJ A;  3BO4 A;  2CFX A;  4ETZ A;  1WC0 A;  4DX6 A;  2Y3Y A;  4ZJO A;  4NLD A;  2YH0 A;  2GQQ A;  3GIM A;  4KFB A;  2VA3 A;  4KHP F;  3DMJ B;  2F8E X;  3SZ2 A;  4CLY A;  3H5Y A;  4DFK A;  1L3T A;  1HBO A;  2R3V A;  2YY3 A;  1Y5I B;  4LFB F;  1Q5Y A;  4L3N A;  1ITP A;  3GJS B;  4NAS A;  5HQL A;  3FDS A;  4P6Q A;  5MAO A;  3NOC A;  3DU5 A;  5AT1 B;  3TX8 A;  3OW2 R;  1X0F A;  1NK5 A;  3DYA A;  3OL7 A;  2LQ9 A;  2VFV A;  2HHX A;  1O0P A;  1U7L A;  1VLY A;  2RJZ A;  3LGN A;  5E0O A;  3MED B;  4CCH A;  2F63 A;  1UZH A;  1LW2 B;  2LLZ A;  1NEE A;  4UF4 A;  3V4I B;  1IWG A;  1NHV A;  5E3R A;  4F7V A;  1DLO A;  4KJI A;  2R7V A;  3PG9 A;  3QGG A;  4JI7 J;  1SIZ A;  4E8U A;  3W9J A;  2HBR B;  3QO9 A;  4I56 A;  1RYR A;  3EJM A;  3WIU A;  5A2Q Y;  2JZ5 A;  2B8P A;  4NL5 A;  4ED2 A;  1AFJ A;  4K4Y A;  1H6K X;  4YUD A;  1KR4 A;  2YNF B;  4JI5 F;  4P73 A;  3NMA A;  2FLP A;  1FK9 A;  3JQJ A;  5A8R B;  5BR8 J;  5DM6 Q;  4ID5 B;  1HBN B;  2DVI A;  1XER A;  1KBR A;  1HQU B;  3N5B A;  2PGC A;  3B78 A;  3M6W A;  3OD2 A;  4RNH A;  5D4N A;  3FSI A;  5FDL B;  4DSF A;  1IBK F;  2XNR A;  2KU7 A;  2RDJ A;  3TUZ C;  5HBM A;  1NBE B;  5F8L A;  2QYC A;  4WP9 A;  3OJS A;  4JI7 F;  4MFB A;  5DG7 A;  1HQ2 A;  3CJ0 A;  3M6V A;  2V94 A;  5JXS A;  4EEY A;  4I68 A;  4CTA B;  2F8H A;  2H4Y B;  2CQB A;  4L3K A;  3MR6 A;  1YTY A;  2PFF B;  1HFE L;  4USH A;  4IOA Q;  5HSP A;  2C1E B;  2FQQ B;  3OUY A;  1U6B A;  3C2P A;  2J0W A;  3LH2 S;  1VBY A;  1IKW B;  3C66 A;  5IT0 A;  4OYO A;  1K8A T;  4JV0 A;  3W5Z A;  3TJ8 A;  2IFX A;  4ED6 A;  4X2B A;  4JP8 A;  3NCQ A;  4Y6I A;  2CNN B;  5F8N A;  3PIO Q;  4FYX B;  3PO4 A;  1RT3 A;  2LVW A;  1UL3 A;  4A47 A;  2Q1L A;  1UMJ A;  2AQ4 A;  1SH2 A;  2HW3 A;  2ATC B;  1W25 A;  3M2V A;  4OHZ A;  3BN7 A;  3CDU A;  5IXU A;  9ATC B;  4B3S F;  1JLQ B;  3RBX A;  4DR5 J;  2LKZ A;  1X60 A;  3QFH A;  2RE1 A;  2HNZ A;  2ZOF A;  1RA7 A;  2JNJ A;  3JAM Y;  3MOJ B;  1M5O C;  2ERR A;  2CVE A;  2XI3 A;  2KDO A;  2KVQ E;  2ZH1 A;  3BSN A;  3THT A;  1EX8 A;  1T7P A;  1A9N B;  1WKL A;  1WKJ A;  4ENO A;  3G6V A;  2M8D B;  5HMZ A;  4P7T A;  1SKW A;  2D74 B;  4TU8 A;  2HK2 A;  3TQ1 A;  1RTJ B;  3M8Z A;  2YTC A;  2K7J A;  2OEK A;  2B7C B;  3QWP A;  4DUT A;  2BAN A;  4JYA J;  2OPR A;  1VC6 A;  4M5D A;  4G65 A;  1NXI A;  3BGR A;  1IKX A;  3VAJ A;  1K44 A;  3W5Y A;  1C0T A;  5K8M A;  2ASD A;  4DBQ A;  2BOP A;  1ICE B;  3QMQ A;  4N77 A;  4OYX A;  4DX8 H;  3FEY B;  2HHU A;  3BGO P;  1TFY A;  1RAI B;  4WIQ A;  2X7I A;  1KRP A;  3FZ2 A;  1KQK A;  2MQQ A;  2I5J B;  1V5I B;  3HDS A;  4V19 X;  4XIU A;  3TAN A;  3BKU A;  4RW6 B;  4EK2 A;  2RKI B;  4OZJ A;  3DN9 A;  3MWB A;  4NWB A;  3MAA B;  3AFG A;  4V1A k;  4WYW A;  5KFY A;  4DU8 A;  4ZP6 A;  5JMN A;  1SH0 A;  5CAA A;  4MKA A;  4C0B A;  4A8Y A;  4DR1 J;  4RUB A;  1WG4 A;  5HBM B;  1GH8 A;  4IDK A;  4Q0B A;  1R8P A;  1GTE A;  4LSL B;  1VIO A;  3EM1 A;  3LAN A;  2ROE A;  2B6A A;  4DF8 A; 
#chains in the Genus database with same CATH homology
 2Z57 B;  3A3O B;  3WIU A;  2Z56 B;  2PMW A;  2Z30 B;  3WIV A;  1R6V A;  4JP8 A;  2W2O P;  2ZWO A;  2W2P P;  2W2Q P;  3P5B P;  4NMX A;  3BGO P;  2ZWP A;  2W2N P;  3A3N B;  3WHI A;  1ITP A;  1V5I B;  4NE9 C;  3CO0 P;  3H42 A;  2Z2Y B;  3QFH A;  4YN3 B;  3VV2 B;  4OV6 A;  2E1P A;  3CNQ P;  3GCW P;  2Z2Z A;  2XTJ P;  3AFG A;  2W2M P;  3GCX P;  2Z58 B;  2QTW A;  3BPS P;  3T41 A;  3A3P B;  3VHQ A;  1SCJ B;  4K8R A;  3SQO P;  1SPB P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...