1SPBP

Subtilisin bpn' prosegment (77 residues) complexed with a mutant subtilisin bpn' (266 residues). crystal ph 4.6. crystallization temperature 20 c diffraction temperature-160 c
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
71
structure length
71
Chain Sequence
b'EKKYIVGFKQTMSTMSAAKKKDVISEKGGKVQKQFKYVDAASATLNEKAVKELKKDPSVAYVEEDHVAHAY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUBTILISIN BPN' PROSEGMENT
publication title The prosegment-subtilisin BPN' complex: crystal structure of a specific 'foldase'.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Complex (serine proteinase/prosegment)
total genus 17
structure length 71
sequence length 71
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 1995-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF05922 Inhibitor_I9 Peptidase inhibitor I9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 1spbP00
3CNQP 3SQOP 2W2MP 1SPBP 1R6VA 4NMXA 3VHQA 3A3NB 3A3OB 3AFGA 3GCWP 4NE9C 4YN3B 2XTJP 3CO0P 3WIVA 2Z2ZA 2Z58B 2ZWPA 2QTWA 2Z56B 2E1PA 3WIUA 2W2PP 4JP8A 3A3PB 3GCXP 1SCJB 2W2QP 3VV2B 2ZWOA 2Z30B 2W2NP 2Z57B 3P5BP 2PMWA 4K8RA 3WHIA 3BPSP 3BGOP 1ITPA 1V5IB 3H42A 2W2OP 3QFHA 4OV6A 3T41A 2Z2YB
chains in the Genus database with same CATH superfamily
2IRUA 4YY3J 3QLHB 5A8KB 4X4TA 4NEYA 1UJ6A 2CVEA 5K14A 4ZK7M 2O66A 2QA2A 1DQ8A 1HD1A 1WD6A 4JYAF 2GA7A 1TKTB 3NOCA 2B4VA 2VG5A 4NCGB 1SH3A 1UFLA 1NM2A 1YJVA 2ZBCA 3BPSP 1M0SA 5C25A 4K0KF 2A3JA 4C11B 2QC3A 1QVGR 4BS2A 2VQFJ 2BKPA 3BO3A 2H5JB 1BQMA 1RAJA 2XZTB 2UVWA 4OV1A 3IG1B 2KO1A 1KLMB 1HYSA 4ZVQB 5B0BA 1S1UB 3MHYA 1RAAB 3TANA 2DNGA 3AOCA 2ROGA 1TKZB 4WZQA 5KT7A 4QR1A 3AODA 3OT9A 2DNMA 4NLTA 1AROP 1YWXA 2WAQD 2COLA 1GMWD 2BKNA 3HHLA 4C97A 5F3TA 3D6HB 3PNIA 1YG0A 3LP1B 2UXBJ 1N32F 1SJRA 3UPFA 2B5JA 3VVTA 1KVJA 2HHTA 3U1LA 3DLJA 4BWMA 2CPJA 4WXOA 1DJ0A 4NZ7A 5DM6Q 3ENWA 3OJUA 4DZDA 4R5PB 2YX4A 2QGFB 4U96A 1BY9A 5B0EA 1D3WA 4EUVA 4CLYA 3CTRA 2F8HA 2Q43A 4TQRA 3T1AA 3CDAA 4AD6A 3J81Y 1G6BA 2YKPA 3GTYX 4A8WA 1SJ4P 1BC6A 1XBWA 4LF9F 2MZ1A 4I69A 4DJBA 1YJUA 3R5JB 3KJQB 3OTOF 1FDDA 2R2UA 4LVNP 4X4RA 4N8OA 3MM5B 5CYQA 3BN7A 4HTJA 1YJTA 2HWTA 1C2PA 2DNYA 1CPZA 2ATLA 4DF8A 3H7HB 4QIWD 1PO6A 5CH7B 3C6TB 2P9CA 5B09A 3QT7A 2E5JA 3DI6A 3PCOB 1TMMA 4B3RJ 1BUXA 1E6VA 2NR0A 4OHYA 1HWJA 1NDCA 1RQ0A 2VFSA 3FSXA 5ITHA 3G86A 1WKLA 1RAIB 2JOQA 3CCZA 2MLXA 3S1TA 2FUG9 2IJRA 2ZH5A 2R7QA 2OGUA 4KC5A 1NJXA 3FRZA 2BA9A 2JLGA 5HATA 4RW7B 1LWFB 3EXYA 5E2QA 3MR5A 1JLEA 2HRUA 2DGSA 2GO8A 2J9DE 1T3OA 2EFGA 1NNDA 2FLLA 1VJQA 5DG7A 4U7UD 4M5LA 2WB1D 5DQGA 3PKMA 5ETLA 2ROPA 3ZZOA 4JI7J 4KO0A 3OJSA 1H7XA 3VAJA 1NUEA 1V6HA 2OH2A 3H5SA 4O44B 4Q0BA 2G0IA 3F41A 2DXFA 1HD0A 4CO2A 2RKIB 1S6OA 5HL7Q 4Q8FA 1BHNA 2D1CA 3W8PA 5D8HB 2EC0A 4WBFA 4WTOB 4DX8H 3T1YJ 4EZ9A 2C3UA 5KFPA 1TUGB 2HQIA 2ZEJA 3C15A 2FVCA 4PCQA 3JSMB 4K4YA 3IR6B 1KQFB 5L9NA 3WHIA 2NXNA 2C2ZB 5E0OA 4KQZA 4LRDA 5EDWA 2QA4G 2Z2LA 4FBTA 3SDEA 5HMXA 2GQ2A 4CQ1A 3GPAA 3HFZB 1T03B 4KE5A 1HWLA 3J7A1 5HVFA 4EYHB 1VBZA 3M30B 3OR2B 4K8RA 4ES2A 5KAKA 1AFJA 2ZC4A 4RKUC 4DR2F 1Q8IA 2F1FA 4YEAA 2AJFE 1U8WA 4P2MA 1NJIT 1IKWB 1IM6A 2JEJA 4O3OA 4F0MA 4WXWA 1RAHB 1EP4A 1LW2B 1T11A 4WFNQ 1X4BA 3M8QB 2E66A 2CA9A 1WUUA 4MYTA 3R1HA 5AT1B 2DY1A 2UUCJ 2E9TA 5CHCB 1U1PA 3I32A 1SJ3P 2AF6A 1XERA 4CRJA 1U1NA 4J9VA 3H8YA 4IFYA 2NSCA 4MKYA 3F0NA 4LSLB 4J9KA 2OJ3A 2J0XA 1H38A 2OEKA 2FVPA 1K47A 3E01A 1FFSB 1NJYA 2G2ZA 2EFVA 2E5LJ 2JFDA 3C14A 1EETA 3ULHA 1JKHA 2EW9A 5DLFA 2JVOA 3K58A 5KFZA 1Y11A 3W9HA 2CQ1A 4M5MA 3ENQA 3OSPA 4ZPVR 1IKXA 1HR0J 4QWDA 2Y8WA 5JJBA 3Q23A 1SXLA 3L7OA 2RS8A 3KK2B 3MUVP 1FRIA 2YKNA 1RZMA 1WHVA 1S49A 3NS6A 3KJVB 4A46A 5ETOA 2XC9A 3I5CA 1WHWA 5IFMA 2MB0B 2QEXS 2HZAA 3M2UA 4X4PA 4A8FA 3MUTP 1VRUB 3I55S 2EFOA 4TLRA 2LA4A 3KHGA 4QWEA 1MMNA 4CLTA 3D0GE 2ZBQA 1NPPA 2HVEA 4DPTA 1R8PA 3X1LB 4ZMMA 3HT0A 4UY85 3D4JA 4DR5J 3MCOA 1NJWA 2ZHAA 2IM3A 4NXMJ 1YRXA 2B4UA 3QPIA 3W2WB 4TNOA 2FD2A 1SI9A 4J9SA 1RAGB 3FBBA 1H3DA 5LSOA 5CQGA 2AT1B 2V8GA 3HK2A 3H90A 4AE5A 1KLNA 4CI0B 1RT6B 3HJVA 2RILA 4DL7A 3FNNA 5KFKA 1C0TA 3H4BA 3IS9B 2L3MA 1U1OA 2HNZB 2MTLA 2XMTA 1HNWF 1KP6A 4X4UA 3N01A 2W9BA 1NKBA 3DLEB 1RWWB 1Z2LA 1C1CB 2PMHA 2BACA 3H0PA 2R9LA 1X5TA 2FQQB 4W4MA 1N52B 1N5YB 4DXLA 1VK8A 4D3GA 2YXLA 4DFJA 3FCHA 2FHOB 2KJVA 5F8LA 5KG2A 4DPOA 3C3LA 2XI2A 1T9TA 2DHSA 1RABB 3P3DA 3IN5A 1IKVB 4DR1J 4OZLA 3CD6S 5LXRA 4RW9A 4DSJA 1SJ1A 3CJQA 3JYTA 1M5OC 1NZ8A 4DU7A 5KFXA 1KVKA 4I2QB 2CQPA 1AW0A 3OLBA 3NNHA 1NH7A 4DV4J 1DARA 1JJ2R 2ZM6F 4P7TA 2UVRA 3VALA 4Z2XA 3KNGA 1BGXT 1ZZNA 1NHUA 5HROA 1N5TA 4FXWA 2KB2A 1BWVA 4F04B 2WSEC 3QIPB 1S57A 3OTBA 2YNGB 3LWMA 3BN4A 2QV6A 3EDRB 1X0FA 4ED5A 3UD4P 1C1BA 3HVRA 1SC3B 5C2GA 4CTAA 2V4JB 2GW8A 1WDDA 1APSA 1IBKF 3FRYA 4RUBA 2PN6A 1HQUB 5I42A 5L8RC 2CPIA 1SC6A 4KFBB 2AU0A 3VGUA 3R1LA 1YDLA 1RB0A 2LCWA 1RT4B 3MM8B 3F73A 4JV0A 3W60A 3DOLA 2K1RA 1RTIB 1HBUA 2FGOA 2OMLA 2CZ4A 4FDFA 2VB6A 4YUDA 3HHLD 1QTNB 3GG1A 3IGNA 1W7WA 3TW0A 1FCAA 2AGOA 4LFAF 2F9DA 3MR6A 1X4CA 4DCPB 4K4VA 3A1YG 4R8UA 4P52A 3NS5A 1REVA 2G1DA 4H54A 4JUZA 5EWFA 4LMZA 1CJUA 3DHWC 3M2RA 2IJFA 2OI2A 3CCSS 4W98A 2P8IA 3ICLA 1OIAA 4WK3A 1IN0A 5RUBA 4TN2A 4TU8A 1DRZA 1N5SA 4QU7A 2B6AB 5ETVA 3C66A 1VBYA 4PR6A 2DK2A 2HQDA 1RT5A 1X60A 3T19A 1TKXA 4YB7A 2KJWA 4RNNA 2HK2A 2IMOA 3UO0A 4YQWA 1IQTA 1S1TB 3CJ3A 4MKVA 3FCWA 4LFCJ 2HHWA 5SZTA 4CLUA 1HBNB 3O1LA 4I2PB 4HHJA 1UCNA 2X1AA 4UOHA 2KFNA 4HVZA 1NPKA 4DUZF 2L9WA 1UVIA 2NLWA 2J9CA 2ZH7A 2NXCA 4Q5VA 2HFZA 3DYAA 3UVJA 3QO9A 1LWXA 3KOAA 3SSRA 1UMJA 5IWAJ 5GAGU 1AB8A 1M90T 4F36A 2LU1A 1XMOJ 4LBPA 4OYZA 1EIYB 3HHDA 5HBMA 4N5SA 3AQOA 2C3OA 4DWIA 2UV8A 4BHQA 4DL5A 1MNEA 1R8AA 2G1HA 4CO1A 1R43A 4WE1B 2EBEA 3AOBA 3CCTA 3UDLA 3KUHA 3KLGA 3LPEA 2YPZA 3FZ2A 3H98A 1RWPB 4USTA 1CC8A 5GMEA 3MM9B 3UE2A 2F5GA 1JX4A 1NU4A 1CJKA 5H1SV 1UETA 3DDKA 2ZBRA 5A8WB 1H73A 1QDUB 3ZZZA 2FIUA 3MMBA 3IRXA 1FRJA 3C46A 2XWYA 4UUWA 1JLFB 3ETMA 3M2VA 1TK8A 2X1BA 4Y0FA 1GX6A 1CJVB 4D3HA 2HAIA 1HARA 1VQYA 2NZ4A 2WVDA 1SBRA 4P2FA 3JTNA 5IT9U 4JYAJ 4JI2J 1SL2A 2B7CB 2OSQA 2Y9HA 1HNZF 1HNVB 4EYIB 4ECVA 1KTVA 3ADAC 4RNOA 3FUYA 3GP9A 3LO3A 3NWGA 4EWTA 3BQ0A 3KLEB 1TV6A 5ETNA 3V4IA 3FBFA 2XGPA 2XY5A 3LANA 4YR2A 3ET6B 3I0SA 3UCUP 3IC1A 4RJVA 3W5YA 1KTQA 2KHCA 5DGAA 5CXTA 4NX9A 5D3GA 1S7IA 1KBRA 2CADA 1TP7A 1RDRA 5J2PB 4NEZA 2F9JA 4F3QA 4OJHA 2H5EA 3RB0A 3PW7A 3AJDA 3GV8B 3PACA 1OYDA 4U8YA 2Q1LA 2K3IA 3G6YA 3C6UB 2X51A 5CYJA 2H1YA 1RP5A 2A6OA 1DTQB 3AHPA 1N32J 4W90B 1RTDB 4O4GA 4DL2A 3CC2S 5K8NA 4QCLA 3M05A 2C2NA 3JAMY 3IR5B 3J80Y 2E44A 2AKWB 2LQBA 3OL6A 4DN9A 2BUNA 1LFPA 2DIVA 1PG5B 3RR7A 1R0BG 3MPUB 5GAHI 4K2XA 1SQGA 3W2VB 5KOXA 5KFNA 3NAIA 2WW4A 4OHVA 5DGBA 4LF9J 2HBZB 1CLFA 3GWCA 5D6GA 5AE1A 2E9RX 1UA1A 4OJGA 3TVZA 3AJ1A 3W9JA 4DV1F 1MROA 2CPZA 5L39A 1NHKL 2CJQA 1WKJA 2F8EX 3RUBL 4OYIA 3EVMA 3AH6A 5KFBA 3KJFB 1VYAA 3CUNA 3IG1A 1FTRA 1S1UA 4PEOA 2V8HA 3I87A 1PC4A 5J2QB 1Q81T 2V4QA 1JLGB 2DITA 3DDIA 2IRYA 1P8GA 1TKZA 4XTTA 1AFIA 2QA4S 1LK5A 2HFUA 2NSBA 2AZ1A 4OI6A 2KYZA 1NLKL 2V4RA 3JQMA 1BQNB 3GR1A 5B7WA 4FNHA 2XCPA 2L08A 3CB4A 3I82A 2LU2A 4GKJJ 2UP1A 4LRCA 2VL1A 3U02A 2QN6B 1RCXB 4RW6B 2CAJA 2Z58B 5D4LA 3VAHA 4B17A 2QMXA 2CJKA 1RK8A 2ILZA 4PG7A 3CCQS 3AJ2A 3QAEA 1X4DA 2E5IA 1BLUA 1JMTA 1U45A 2D69A 2OPSA 1NB7A 5GVQA 1KS2A 3PEHA 4R5PA 1MMDA 2L48A 1GX5A 2B9WA 4RNFA 3JSYA 3FSYA 1CQMA 2EG1A 2IAJA 2QA1A 1C4AA 1FDBA 3MTJA 4X62F 4O3RA 3CJ2A 3QRQA 3CT9A 4USHA 4LBIA 1ZTWA 2M2BA 2FB0A 2XS7A 1NCLA 2J7UA 1Q78A 2NXUA 3AA9A 5HO4A 1YTYA 3VGSA 1RT2B 1DY3A 1VHIA 2AQ4A 4IQMA 2I6WA 4ELUA 5I4MA 2R7UA 5DG9A 4IG0A 3M9OB 3MAAB 4XK8C 2XB2D 4TXSA 3MEDB 3R5CA 2W7PA 3GZ7A 4FYVB 2OFGX 2ZH8A 3PO4A 2HNYB 2QFJA 3PVXA 2QL7B 1UWBA 4P2SA 1F5CA 1U1LA 4AYBD 1WNEA 4RW7A 1RU2A 1LWFA 1H2VZ 2H3EB 5K9FA 2W25A 4MK9A 2M88A 4NL5A 5DS7A 1H74A 4LRBA 1P27B 5B0CA 1HW8A 3BO4A 2J5AA 1QTMA 4QIFA 3K5PA 4WFYA 1P9QC 2CUYA 2BJ1A 2KFYA 3QWUA 1Q95G 5FDLA 2CZVC 4KGXB 3EVOA 2IVMA 1K0TA 1VI7A 4GC7A 4QIGA 2DT9A 3C16B 4LFBF 4BCAA 1VLOA 3NBPB 4UUXA 5J2MA 2YWGA 4GVBA 5DLGA 3PKYA 2C2MB 4O44A 4KHRA 4DSEA 2HHHF 2B3TB 2RKIA 3R7BB 4R0EA 3KLFB 3OFEA 1VQMS 1TQLA 4PUOB 1QLNA 2K7JA 3PHEA 2MQQA 2XSJB 1JLAB 1FA0A 3JSMA 4CO5A 4AQYF 2E1CA 4YP3A 2LEPA 4K5SA 3MEKA 2DO4A 1T03A 1WI8A 4F8RA 3O3LA 1BWEA 2APOA 3M30A 3UDEA 1ULRA 4DEZA 2YBVA 5JMNA 3I9ZA 5LM7E 3CCUS 1K1QA 1PJ7A 1F3FA 2HLTA 1F9HA 1IKWA 1VQ7S 3SXLA 1OMSA 5HLFB 2D3OR 1FTCA 2CNLB 1WWHA 5HI7A 1V3RA 1FWLA 1S12A 1KKHA 3M8QA 2ZZMA 4NLUA 4V19J 3US5A 2ATCB 2QLWA 5HQLA 3CJSA 2RQ4A 3SYZA 1FXRA 1NMEB 2UUAJ 3AAWB 3CDEA 3CCRS 2JNJA 4ECRA 2FHJA 1YQHA 3QIDA 4J90A 4DL4A 2GVDB 1HNWJ 4LSLA 2MJUA 1EB0A 4IUFA 3PO5A 2BW7A 1Z2ZA 2I2YA 1S1XB 3DRXA 2UV8G 2BOAA 3EGWB 4WCEQ 2BX6A 1R6YA 2W24A 1YHQS 3TA2A 3B78A 4A8MP 3R6LB 4NI2B 1UVLA 5D0GA 5KFQA 3CSKA 4M8LA 1LNQA 5F8GA 2ZUGA 2NCKL 1SC1B 1Q79A 4F4XA 1UVMA 1VRQC 2FHMA 1RAOA 4B3TF 3DCAA 2CJAA 3KK2A 1SH2A 2FC9A 3CO9A 2MGZB 4ELVA 1G2EA 4BLGA 2GAGC 3KJVA 2ZDOA 3U1MA 1H2UX 1ZAVA 3W7BA 1R31A 4DV6J 1P9YA 1B99A 3I31A 2I38A 3T5HA 3G6VA 5BJRA 1QAJA 2RNEA 3CVKA 5E3PA 2DR7A 4ATNA 5FJ4A 3NGDA 1UL3A 3MAQA 1FRHA 1FNMA 1RTZA 3U1NA 2MKCA 2ZOFA 4HI1A 4M5GA 3K7RA 3IBCB 3KKFA 2HQFA 4GKKJ 3LWLA 1FVQA 2V63A 2HZVA 4LQ9A 1NXIA 2BEFA 1EQ0A 4ECQA 1U48A 3W2WA 4K2JA 2XMWA 5H9FJ 2F4FA 4Z37A 1Q7LB 1D0EA 4LF5J 4I64A 1RT6A 2VG6B 2FJBB 1Q8LA 4B02A 1OY6A 1IBKJ 1G7CB 3QSYB 2VJVA 3MEEA 1N36F 3IS9A 4O3SA 5F8NA 2HNZA 4MH8A 2LQJA 3DLKB 4NRUA 2ZH2A 4ZN3A 3NG8A 1AT1B 1UJ5A 2OD4A 1XIQA 4RUHA 1VRTB 3RW7A 1C1CA 2QL9B 2C2DA 2RQCA 4YHHF 4DV0F 2F7VA 3R7SB 4OLPA 1N5YA 3NMAA 2WOMB 2CQBA 4NRTA 3LF0A 2BQRA 4TYAA 5CD4A 3A4TA 4LSNB 1UEVA 1TMJA 1IKVA 1RWVB 4FKXA 1YITS 1S9EB 1F2GA 5K20B 4F0KA 4PZVA 1Z1ZA 4I2QA 4FKYA 1SPBP 3WZ0A 3QZ8A 2J0WA 4QJVA 2M4MA 4OYAA 2CFXA 3A3OB 3BSAA 5B0DA 2MY8A 3DGVA 5A8RB 1ZA1B 3F44A 5DDPC 4UTGA 1YBAA 1QAXA 2N7YA 1UW9A 1CS4B 3GYXB 4KB7A 3ISNC 1NZAA 1NK5A 3TQEA 4L3KA 4N8NA 2DRAA 2HMIB 1U1QA 3QIPA 2H48B 3RBXA 2YKMB 5AXKA 1JLCA 2E5HA 4U6PA 2YNGA 4PWWA 7FDRA 4RNMA 2ZKUA 4DR3J 5T7LB 3UWTA 5G0RB 1JB0C 3HHLC 2W4CA 3IWXA 4DSFA 1DTTA 4DUZJ 3O44A 4OI0A 3SCJE 3BGUA 5ETRA 4KFBA 4A48A 1PYTA 2OPPB 2B7BB 2LVWA 2VJUA 1RT4A 4CH1A 4IO9Q 1L3TA 1NH8A 4RBTA 4X4NA 2ZWOA 4S0MA 2LXFA 2MZSA 2K2PA 4RWWA 3ILJA 3CCVS 2MY7A 2UXCJ 2JEIA 2HFNA 2ZJPQ 4KGKA 3HHKA 4DV2J 2AP6A 5KG6A 1GT8A 5DDQC 4EBEA 3FJ2A 4RW8B 1RWUA 1X8DA 4LJMA 2QIFA 4M94A 2Y0SD 2BV3A 3I96A 7FD1A 1RT7B 1WEXA 1LK7A 4Y65A 2RHSB 2HZCA 3P6YC 1K9MT 1J5EJ 3OL9A 1LQ9A 2ZH9A 5C5JA 3UFCX 2B6AA 3OD2A 1U2CA 4E8UA 1RISA 3THVA 4ECSA 1U2RA 1U6FA 1URNA 1DAXA 2O5DA 1S1TA 4ZCIA 3N9UC 5KG4A 4OI2A 5HJYA 1H2TZ 3F56A 1RHJB 4DG1B 1NK8A 1FX2A 1HNZJ 3EZOA 2V2KA 1HBNA 2AYEA 2YKQA 4I2PA 5LOQA 1ZTTA 3BH7B 1RGVA 1E6YB 2QZ8A 2E1PA 3LGNA 3UNGC 4QU6A 3FFIB 1WOOA 2KZMA 5G4DA 2GGPB 4F50A 3GLJA 2DY9A 1P6TA 2KG0A 4OZJA 1Q8BA 2UXBF 1VIOA 3SCKE 4FBUA 4CH0S 2BABA 5L1JA 3QT6A 3PW5A 3QSIA 5LJ5Y 2HS4A 2VPXB 1VIXA 5LSRA 4LF6F 4YDXA 2GMHA 2CJYB 4WE1A 2IIHA 3M7VA 4C0BA 4ED0A 5LL6d 2ZZNA 2F3JA 1OJ4A 3GJRB 2W01A 2LEBA 1FDAA 3MPWA 2HPUA 3B82A 2QSFA 1T8EA 4ZLLA 2JFKA 3OTCA 1TUWA 4XIUA 4MMOA 2RQMA 5A8WA 1X5PA 3QRPA 2AD9A 3B54A 3JTPA 2JSXA 5KTQA 1JLFA 3MOJB 4DSIA 1WG1A 4O3NA 3BKTA 1CJVA 4IDKA 3AB2B 2VA3A 5HP1B 2WW8A 3MTKA 2VONA 2J8AA 3HX9A 4ILLA 5JXSA 3K0JA 1D09B 4ED2A 3EICA 2DHXA 1N88A 3ZZ0A 5JVHQ 2JZ5A 1EARA 4ZVOB 4NLWA 5IQQA 2J8SA 2HIYA 4B3RF 5THWA 3GV7B 2DGVA 5IZHA 4YMEA 4IH6A 5ETMA 2YPYA 1FJ7A 1VS3A 4Y3CA 1HNVA 3ZXWA 5KT2A 4FF4A 2Q66A 2IPOB 4H4OB 2V67A 4P74A 5AXMA 3BR8A 4DQIA 3IMQJ 3U27A 3B8HA 2RDJA 4FP9A 3EJMA 4ZJQA 3ET6A 2H4YB 4WTYA 2EK6A 3PRBA 3BGLA 2RAQA 4FYYB 4B3SJ 5T41A 1GTHA 1X7VA 2Z0GA 4LQ3A 4JI7F 4QWAA 2FHJD 2DPJA 4K59A 3V4MA 3D5MA 4A8KA 2G13A 3MDFA 1DTQA 1B7FA 4DZ6A 1CULB 2I8EA 5ETQA 3IBWA 1ICEB 5D78A 1RTDA 4ICLA 1U1MA 4KRWA 4OI1A 2ADBA 2W2MP 4E0DA 1KOOA 2J9EA 1TK0A 1TL5A 3HVTB 1IQZA 9RUBA 2IA6A 1LXJA 1Q5YA 5KFMA 1H7WA 1RWKB 1SIZA 2W2OP 5A0YB 4Q2LA 3W2VA 4X62J 3KG0A 4U67Q 3FC9A 2E29A 3MZIA 3NCQA 3MCNA 4HHHA 3T9NA 4QW8A 5IT9Y 2OIHA 4USMA 8ATCB 1RYRA 3M32A 1YK9A 4NE9C 3D1HA 2WZ1A 2MPUA 4C3MA 1L5UA 3CE8A 3THTA 2DPIA 1RE1B 3CD0A 4J9OA 3GQCA 4C2MA 1Y5LB 3UCZP 3HFKA 2HHQA 3RAXA 2PFFB 5J2QA 4IH5A 3VF0B 1JLGA 3MMAB 2RSQA 3DLLQ 4XDCA 3RAMA 3HMJG 1XN9A 1XR5A 3IXQA 2QLBB 4WWSA 4CT9A 2FY1A 1W2IA 2KM8C 5HVHA 1I94J 1A7GE 3GIKA 2GZOA 4CLWA 2D3ZA 3RB3A 1BQNA 4OIXA 3ENVA 1RXOB 2E5LF 2W1BA 2Q6BA 4FPIA 9ATCB 3AY0A 1IBCB 3GFZA 2RB7A 4NOHA 5F8HA 4ECZA 4P6QA 4WK1A 1QSLA 3OQ2A 2PEBA 2J0SD 4DPUA 2QFIA 2E1RA 4QOTA 1NDKA 3JB9k 3BGRA 3G96A 4LFBJ 3A3NB 4ZPTR 2MHNA 1SIWB 1V3ZA 2Q6CA 1XK8A 4J5OA 2XGQA 2HHHJ 1DURA 4XO0A 4JV2A 2KL8A 2KRBA 1VQLS 1ZS6A 3MCMA 2EC2A 4KGZB 2GVZB 3FEYB 3EM1A 3BV8A 4QYZJ 2ASJA 2PC6A 4DR5F 4AQYJ 2CXEA 3QGHA 1RSCA 2OFHX 4LUBA 3W5XA 1FKPB 3BGOP 2EBGA 4DBQA 1VC5A 2GHPA 2C28A 3IRWP 3QGGA 1MU2B 2RF2B 1KC8T 1PYSB 1PILA 3MXHP 4N76A 5J2NB 2MQLA 4IR9A 3FK4A 3V6HA 2EFPA 1S7HA 1RCOB 3ONQA 2ZNYA 3MAAA 4Q44A 1LWEB 5DDRC 2HG4A 3W62A 4TVAB 4KY3A 1FWKA 3UN3A 1LWCB 3B4MA 3SQGA 2HNYA 1O5JA 3VAKA 4Y28C 4OZNA 1X5OA 4HDHA 3ZNJ1 3IM8A 1JLBB 3TZZA 5D4PA 3LH2S 1RTHB 3Q8QB 2VC1A 4GVLA 1VDHA 3QJPA 2PIIA 3E8OA 1U1RA 1RT3B 5KG1A 4Q43A 5CZVA 1W26A 1HHQA 4DF4A 2HGNA 4MT1A 4J9NA 1H6KX 4USIA 4DR1F 3DM2B 3KMQA 4MTPA 3NKYA 3NS7B 4K4UA 4KKOB 2CQ3A 3N0VA 2G9OA 3HI9A 2CVIA 3NBPA 2NS1B 2LDIA 4H4KC 3OHBA 1QD1A 2HWHA 3M6UA 4B3TJ 2WVEA 5A76A 3DFEA 4PUOA 1NKCA 1Q53A 2GX8A 2XSJA 2P5VA 1JLAA 4Y00A 3NEKA 4AL6A 1EKSA 2D7SA 3DRYA 2EWHA 2BJEA 5DZ6A 3CC4S 4CO3A 3D54A 1UPMB 1X9SA 1VQ4S 1TL1B 2VOPA 2D74B 4KTQA 4TU9A 3RB6A 4ENOA 2KVIA 4KV8B 3K59A 5HAOA 3NGRA 4IYQA 5IQ6A 3HHEA 4QPXA 5FD1A 3KG1A 5U47A 3TAMB 3CCMS 1ZAXA 2YQ0A 3S8SA 1XTZA 4L73A 3VAGA 3PR4A 1XNQJ 4QIVA 3N28A 2R8KA 1SKUB 2BDPA 1YLXA 3H40A 2R7TA 3H5YA 5L46A 3ELHA 3BJYA 1N36J 3WDOA 1FKAF 2QRRA 5HMYA 2GVDA 1QJHA 5F0UA 1RADB 1RAEB 3KFWX 5K8MA 3TAQA 5H9FK 3WC0A 1UPPA 4OFZA 1FK9A 4ID5B 4I7FB 2ADCA 3S01A 1T0TV 4YHHJ 3V5RA 4DV0J 3POTA 1V5IB 2C2EA 1SV5B 2V2ZA 4OLOA 1D1UA 3GU0A 3PFOA 5CYMB 1QY7A 4F4WA 2EFQA 3QWPA 2MGZA 2IA0A 3VVUA 4FYDA 4LR7A 2DR6A 1T9XA 3W66A 3Q89A 4EBDA 3N6LA 4PQAA 1Y3KA 3L9ZA 4LF4F 3A8EA 3LAMA 6FDRA 1S0VA 4RR5A 4LFCF 3QRRA 2IVFB 2OTJS 3X3UA 4AL7A 2IVYA 1VCTA 3T6BA 2UVVA 3ZTRA 4C9DA 3LAKA 1N34F 3DC2A 1N48A 2ERRA 2DHHA 2VG7B 2QL5B 3EGNA 2AJQA 4FF3A 4NLQA 4DR4F 4DU8A 2ZC3A 1MG7A 4ZVPB 5L1IA 1IBMJ 1B70B 1N33J 3T5JA 4B08A 1NJZA 3V6DB 4QBUA 3CCLS 1KQGB 3K17A 3IWNC 2IDEA 3NP5A 2QYGA 3BQ1A 2XULA 3CD7A 3DLKA 4MKAA 1CVJA 1RWXB 1RLDA 1VRTA 1Y7PA 3OR1B 4ED3A 3HKZD 1S10A 1B0VA 3TX8A 3RW6A 2XBPA 2RRAA 4UT4A 2WOMA 2Y0BB 2B9EA 3FZBA 1NK4A 3NL0A 2FZGB 1VQPS 3SCIE 4LSNA 2ACYA 2AEFA 3P8BB 1S9EA 4QYRA 1F0XA 3ETOA 2BW2A 1XR7A 2DNKA 5J1EB 2R8JA 1U6ZA 4ZN1A 1HIYA 4DX6A 3FMBA 1RT1A 5K14B 4JI2F 1S9FA 1HI0P 5KFJA 1FNXH 2JHEA 3ZTQA 1TL4A 3RTVA 4DN0A 4P9SA 4PG4A 2VG5B 4ECYA 1SL0A 3LGMA 5J1PA 2WVCA 3KMSA 2YQ1A 1CS4A 3HSGA 1JLQB 3SCLE 3JSBA 3MECB 4N56A 2HVIA 1T7PA 3CWJA 1FERA 2YKOA 1KSPA 2YKMA 3GFYA 1XNRJ 1L3UA 2EFNA 2OAUA 1P1TA 3M8SA 1IKYB 5T7LA 5KFDA 4F02A 4CLZA 2X3GA 5G0RA 3G9CA 2XO7A 4ZJOA 2NZCA 2CQIA 1QSSA 1GH8A 2CPDA 1N5VA 4B3OA 2DH8A 3BDEA 4JI8F 2A18A 1JQGA 4F3OA 4JI5F 3HDSA 4DMZA 2OKQA 3AXMA 2QMUB 2YWEA 3BB5A 2B8PA 3RRHA 2NQPA 1Y10A 2I0XA 5DM7Q 1S0NA 1B64A 3VV2B 3DGPB 1ITPA 1EAYC 1S1VB 2B5JB 2FJDB 3TEHB 3VHQA 4ZVEA 2JL9A 2RDIA 2CQCA 2V68A 3GMGA 4LF6J 4RW8A 3E2EA 4ZPWR 3CDBA 2MZJA 2AJ1A 4LREA 4RW4B 4OI3A 2KYXA 4CNYA 3LQVA 1RT7A 4OX7A 2MQMA 1HW9A 2YNFA 1N4LA 4G1IA 2BJ8A 1D9FA 3MUMP 3OVSA 2FJXA 1X31C 4O3PA 2RVJA 2DXDA 3QJJA 4WF9Q 3CJ5A 1HI8A 3I0RA 4WFZA 2B9YA 4CYUB 1EHWA 4EO6A 2ZWPA 3O2IA 4OX9F 1Y5NB 1FRKA 4MIAA 2UUTA 3TWZA 2CJ9A 3FQLA 4A8QA 3SI8A 1RBOB 2CQ2A 3T41A 2MHEA 2KI2A 2OO4A 4KPYA 3DI6B 4DG1A 3UR0A 4TY9A 4FN5A 1GAOA 4FS2A 4M5DA 1HBMA 4E98A 5J1NA 1E6YA 1Y5IB 3CC7S 5IT4A 3UD3P 2GGPA 2H5IB 3IM9A 4GKJF 4A4JA 2Z2MA 1S9GB 4I68A 5HSPA 1JLEB 1X5SA 2PT0A 1RUSA 2KKHA 2VPWB 3EGZA 4WPAA 2CDRB 2C2OB 4ZPCA 3EPGA 3TX0A 2XMVA 1UFWA 3PW4A 2NREA 4JI1J 3KJNB 5LT5A 3EMTA 1FE4A 3TAPA 1RLCL 3JQJA 1S48A 2QE5A 3OPKA 4P7VA 1S6UA 2BANB 3BREA 3ZZTA 3AB4B 1D9AA 2UZAA 3RBDA 3T1HJ 4OJ3A 1MN9A 3FEZA 3D66A 3NWRA 3WQPA 1ZZFA 2HHPA 4CLSA 2ZH6A 2VIHA 1IR1A 1C0UA 2DISA 5T14A 2UVUA 3FDSA 3CCWA 1S59A 3BDPA 4RNHA 3HFVA 3PTWA 1X4GA 3H2UB 5B08A 1YKWA 1RHQB 3R8YA 3GFXA 4H4OA 2YWFA 1FRLA 2DGXA 4ZPAA 3HSZA 1QUVA 3OXFA 3I5BA 2ASDA 3PZPA 3CXCR 5DZ7A 2UU9F 2ROEA 3BBBA 1NSKL 4Q2MA 4NCBA 3TVYA 3J7YI 4B9MA 3W5ZA 3UN2A 4ITSA 4HI2A 2VBWA 4IFYB 2RMLA 2KZZA 2CQ0A 8AT1B 1T02A 1WELA 3GIIA 4USJC 2C1EB 3MOZA 3VAIA 2RRBA 1U47A 1RHUB 2GMJA 3PV8A 2Z30B 1TL3A 3P5BP 4L75A 2B9XA 1O6XA 3E01B 4EEYA 4PG5A 2J7WA 2IC3B 4X2BA 2ACMA 1EETB 3D6MB 4YB5A 1CULA 1KNZA 2P9EA 2VQEF 2E7XA 3HPOA 1GEHA 1IKXB 3RJMB 2HAFA 4PQUB 3KLVA 4FXDA 4TU7A 5BYRA 1B0TA 3VZIA 5E41A 1R8HA 2BQ3A 1OYEA 4P10A 5E3AA 2E5GA 2D41A 2LQ8A 5IM0B 2VDIA 5EGYA 3AD7C 4KH0B 2H4WB 1FD8A 3S7RA 1HWUA 4OX8A 3VCDA 3GJTB 3E3XA 2XG8A 2ALYB 4OYPA 3KUEA 4HKQA 3ILLA 2HHXA 2XHWA 2XNRA 4DFMA 4K4XA 1U0HA 3H20A 3GYGA 4QYZK 4HH1A 3V6JA 1ACMB 3TRGA 2UUAF 3TP2A 3MMAA 2HHSA 1KEKA 1YI2S 3H2LA 5B0FA 4PPZA 4U9RA 2J0QD 1WOPA 2QSWA 4YR0A 3KHLA 4V1Ak 3FVYA 1N0VC 4MIBA 1PCAA 3KYLA 1T9WA 2J6UA 4ZA1A 4WIIA 1X0PA 3BS9A 1S76D 2KFZA 4ZCKA 3BSCA 2QLFB 3EGVA 4MKBA 4HDGA 4C98A 1OPIA 4FVMA 1U24A 4C8ZA 1WHXA 3DLBA 4NYOA 3FEXB 5C7PA 2KT3A 5DQIA 2MKYA 1XMQF 3DOMA 4RW9B 3KLHB 4DV6F 3SEOA 4OJ1A 1OPZA 2Z2ZA 3Q22A 3IFEA 4MFBB 3FMWA 1FDNA 3LW5C 2QT7A 2L9NA 1EJ7L 1A9NB 3M6XA 1Y00A 3W61A 4BBYA 1TZ0A 2FZKB 5E3QA 4GKKF 3BSNA 3NNCA 2OHDA 2OP5A 4K5RA 4NA1A 3NCPA 4WZMA 1MU2A 2RF2A 3EPIA 2V2VA 5J2NA 2YNHA 1S6QB 2GIQA 4IRKA 2VFVA 1QE1A 1ZAWA 4LF5F 1C1BB 3ISND 5SUHA 1H0HB 1GXUA 1LWEA 4CTAB 3KTQA 3MI7X 1FI4A 2FVRA 2XQCA 5I42B 4Y2IA 3I5AA 2DRBA 2OSRA 2IY5B 2CPEA 4DQSA 3WBZA 4FS1A 3CULA 1RTHA 2QTWA 2KG1A 2IMWP 5BXIA 4CM0A 3VGVA 1XQIA 2D9PA 2HFOA 1NRKA 3KK1B 1AZSA 2KVQE 2PO4A 4WFAQ 1AXQA 2LKZA 3PJWA 5GAHU 4QPTA 3DN9A 3QFWA 1GNKA 2GIFA 2VDHA 2VKRA 1YVFA 4ZIWA 3J7Z5 2CWKA 3DM2A 2VH7A 3QYYA 3WC2A 3ITHB 2NPFA 4ZHRA 4CLPA 1OQ6A 4USWA 5C2CA 3M2RB 4BC7A 1MWQA 1F5BA 1SKSA 1ZM3A 2U1AA 2ZDPA 1V9OA 4XPEA 5KFCA 2BE2B 3N6MA 2X7IA 1S97A 1FEEA 2RT3A 4H4KA 4CIOA 3KDOA 4JV5J 3DMJB 2Y8YA 5KFFA 2ZKTA 1HPZA 1TKXB 1WC1A 4C8LA 3VWSA 4WJBA 4LF4J 1ZM9A 3NGSA 3SBMA 3MM6A 1RTJA 5GAEI 2PMZD 3MPYA 3GONA 4DR3F 2DGUA 1HQ2A 5KFSA 1N34J 1KN6A 2LLZA 2DVIA 4KV8A 2HHVA 2KH9A 1GFWB 3OV7A 4J9PA 4TY8B 4DR4J 4RUAA 3TAMA 2QMWA 3THPA 2Q79A 1Y0HA 1SUQB 3DYAB 3UVJB 3A3PB 3QO9B 2XI3A 2H51B 2DCLA 1UW4A 2QX0A 1WC5A 4KHMA 2UXCF 5KFYA 4OYOA 3IAM9 1IJEB 1HL6A 1YGYA 2HK3A 1I6JA 3HT3A 4DV2F 1TL7A 1NDLA 3BGFA 2C22A 5AE2A 3QNWB 3ZZPA 1NB2A 5HK4A 1JNZB 3SV4A 3T9ZA 3BO2A 1Q1KA 3C2PA 1X4FA 2FJEB 3MEGB 4ID5A 2BJ7A 4OHXA 4UQGA 2ZJQQ 2R7XA 3IO1A 3V6KA 2IM1A 1J5EF 3RBEA 1SV5A 1OSDA 3GSDA 2HURA 5BYQA 1RKJA 3M2VB 1WTFA 2GFFA 1KVIA 4KHPF 3SZ2A 1MWYA 3CJTA 5CYMA 3DLGA 2R7OA 3WX8A 1S77D 4GRSA 4UY8T 5LSLA 2GO9A 1PJ5A 3UW1A 1JXLA 3HULA 2HVDA 5GADI 3D6FB 4IFVB 1VQ9S 2XMMA 4E2FB 3M8WA 4LF1A 4DR7F 2K7KA 3EX7B 1JJ4A 4YS2A 1U26A 3R9LA 2VC0A 4OYBA 3KNAA 4ED1A 2VG7A 4L3NA 1KQKA 3V4IB 1K8AT 1XC9A 4RO0A 1S6PB 4TYBA 3A8JA 2HNDB 3I0SB 4DV5J 2KU7A 3SSQA 2CNNB 2ASLA 2R42A 2M8DB 4I4BA 5D3GB 5HMZA 4JP8A 2W9AA 1VQ6S 4R0JA 2ZVIA 2LP4A 5LMNF 3GIRA 2M0GB 2MKJA 4LIWA 4C0OC 1X9WA 4ECWA 3HZEA 4JI8J 4JI5J 1FX4A 4OYXA 2VV5A 1IXKA 2CPXA 2HBYB 1FVSA 2FTRA 3EZUA 4LR9A 3OR1A 2ZE2B 4QWCA 3QT8A 4NPOA 3OFHA 1VK3A 4IOCQ 3S6EA 2DGWA 2BXJA 4M5JA 1Q4RA 2FHKA 1NDPA 3DLHA 1QVFR 4BC9A 1FXLA 2J6SA 3JQKA 2DJWA 3IWLA 2OTLS 2MKIA 1RHMB 3MR2A 2W4DA 2KXFA 4I67A 2R8IA 2AHOB 3QLHA 5A8KA 3NLCA 1RA6A 5KFWA 4USUA 3TUZC 5J1EA 1M1KT 1S5ZA 2U2FA 3TJ9A 4I1TA 3L3CA 4Y2KA 2EG2A 1NHVA 3K5NA 3Q8UA 1TKTA 2DGOA 1N8RT 1B4SA 4NCGA 3ZTSA 2F4VJ 2AV5A 3BKFA 1RJJA 4U8VA 4XDDA 1MROB 4Z7YA 3CJ4A 4C3KA 4ANEA 4OX9J 5EUHA 4C11A 1JLQA 4G1QB 1KOHA 3W3SA 3MECA 2Z8QA 1FFWB 1VGYA 3NGUA 3PFEA 2EKYA 2MYFA 3L4BC 1KLMA 1OY9A 3K5OA 1KWMA 2QLJB 3PYEA 2ZH4A 4ZP8A 4C0HA 1FHTA 4M5NA 2OEMA 1IKYA 4K4SA 1U2FA 2EK1A 2MDAA 5I3PA 4B3SF 1RAFB 4UZBA 2DBBA 3TOQA 4YOEA 4EGLA 3Q2TC 4DLEA 5KFUA 2C2RA 2XMUA 3H5XA 3QMQA 4RL1A 2XYPB 1U09A 4DR6J 1CBKA 3LP1A 1MWZA 4ECTA 4AT1B 3J7ZT 2IYIA 3JS9A 3KWMA 2M5YA 2MEWA 3GSIA 3GE9A 3DGPA 1FESA 1S1VA 1JXVA 5IV4A 2I5JB 1S4EA 1XWLA 4PYAA 5IV3A 2CIMA 2FZCB 2C3YA 5D0HA 3CPWR 2HQ3A 5D0RA 4CZCA 1UZDA 4PG6A 2MLYA 3M8PB 5LJ3Y 4ED4A 2OPSB 2FGCA 4JBCA 2VD3A 4LIRA 5CAAA 4ETXA 4RW4A 3KK3B 2BM0A 2G0CA 1UKUA 2IAJB 2F65A 4NLOA 5KG5A 4RLEA 5CD4H 4N7TA 2QYCA 1HNIB 4L6V3 1MMLA 4X4VA 8RUCA 1F5AA 2SXLA 1VQNS 2YKAA 3R97A 2G4BA 5IS2A 4NLRA 4O4RA 2PDAA 3MM5A 4CYUA 3DRRB 2CKWA 3G82B 3K5MA 3MPVA 3PW2A 4U7CA 2YY3A 2CQ4A 2LFVA 1JWWA 4HT7A 3C6TA 1LXNA 3MCSA 2M7SA 3BZQA 4MK8A 4ES3A 2K06A 4ZPBA 3EE3A 4ZVFA 4CDIA 4IG0B 1V5VA 1OQ3A 2MZRA 2GCFA 2YWKA 1FRXA 3KLIB 2AW0A 3PX0A 3G4SS 1I94F 4QW9A 3MMCB 2UUWA 3JSRA 4WP8A 4XPCA 2HVZA 1UWBB 3R5AA 1W2BR 1RBLA 2ZVSA 3DRSB 4YFUA 4DUYJ 1JNRB 2Q3PA 4ZVSB 3KDNA 1NK6A 5EN1A 3BF4A 4DLGA 2JC1A 2UU9J 2Z4PA 1S9GA 1JJHA 1Y9OA 4QQBA 1VBXA 4DFKA 1R6VA 4C6AA 3QZ7A 2CQDA 4F0HA 3GJQB 1CQNA 3HM9A 2D3UA 1L3SA 3TA1A 1PAEX 3I4PA 4N47A 5FDLB 2VBYA 4ECXA 3QJLA 5IOLA 4ER8A 3D6TB 3D3CJ 3CJKB 1U49A 1DBDA 1R8BA 4CNZA 2ALZA 5J2MB 2ZBPA 4GVBB 2LXUA 4PYDA 4F3MA 2VQEJ 1S79A 1YJ9S 4EFAC 2PEHA 1SKWA 2CRLA 2WBRA 1ROFA 2BANA 2GAHC 3PXGa 3BM7A 4LRFA 2BOPA 5BR8F 1WKKA 2Y1JA 1UEKA 3K8WA 3Q8SB 3OR2A 2MSSA 4OZ0A 4F4YA 4FYXB 5KFVA 4DS4A 2OELA 3KXDA 2JC0A 3WIVA 2XMAA 4DS5A 1LW2A 1R89A 2RH3A 4WP3A 5DQHA 4NLPA 3NMRA 2OPQB 1O0PA 1LW0B 2IBOA 5ETPA 3PX4A 2XSFA 3IP0A 5AJ3F 1N5QA 3DU5A 4J9RA 3N79A 2HVHA 3ZNUA 4QWBA 4JB8B 2RS2A 1GK8A 2ABYA 4NWBA 1R0AB 1NPRA 2HGMA 3ZTPA 3OUYB 1WEYA 4PG8A 2IC3A 4M5IA 3TZXA 3JTOA 1PAUB 4ZLPA 1R27B 3DHXA 1J27A 1PSDA 1YZ6A 4OHWA 4PQUA 1T95A 3R27A 3UDCA 1XMQJ 1K0VA 1UA0A 5C24B 1N56A 2NYHA 3WX4A 1QSYA 2EI5A 4A8SA 1VRUA 3KUGA 4C8MA 2LYVA 2MKHA 4X65J 2VICA 1AUSL 2F63A 2CZ9A 2JDJA 4CP5A 2CG4A 4F7VA 3FGVA 2OD6A 1VR6A 2YWHA 2AJ4A 5IM0A 3BH6B 1HNXJ 4X66J 5F3ZA 2GHVC 4DHVA 2M52A 4RX6A 1M5KC 1RWMB 4F4AA 1HQEB 1WOSA 1MW7A 3CNQP 1KFDA 1CJTB 3RBZA 4WU3A 5CA5A 2ZD1B 2M70A 1YRUA 2XMJA 1XNQF 4ES1A 5K8PA 2E1AA 3A13A 2A0FB 5L38A 3O6QA 2HQGA 2R7WA 2MQ8A 3CMES 3PIPQ 2XZDB 2HRYA 1WEZA 3RR8A 1H98A 2M8HA 1TR0A 5B0AA 5CCMA 3I4HX 3R7NB 3MEEB 1X9MA 3K89A 3PJ9A 2R3VA 2E7WA 3DLEA 2VODA 3G71S 2YH0A 2BBEA 4ZP7A 3R3TA 3W9IA 5GMKa 4JI3F 1WF1A 2XO6A 3N4WA 3I9V9 1RHRB 3DU6A 1N6QB 1YJRA 4OZ5A 3CCJS 2P2CB 2I9SA 2JJ4D 3M1VB 2RE1A 3UQSA 1VMBA 2PD1A 3VAFA 2ZOMA 3KLHA 1IBLF 3OSNA 4NLXA 5D15A 1ZM4A 2JRSA 3J7AN 4MFBA 3VAMA 5GMDA 1QM9A 4YDDB 3LGHA 3B4DA 3G8SA 1FWPA 5F0WA 3OFFA 2HSEB 3BR9A 2MQPA 2Y1LB 4NYZA 1REGX 5D0EA 2BQUA 1LV5A 5EWEA 1WC3A 2VASA 4ED6A 1WTBA 3M9MB 1LEOA 4H4MB 1ZPWX 1JLCB 3ZFVA 4WIQA 2YNIB 4G3IA 1IBMF 4ECUA 1S6QA 5KT5A 3HLUA 1N33F 4K4TA 1CEZA 1T3NA 4F2SA 3GILA 4DL0C 4I6AA 1FJGF 1RU1A 2AEMA 2V94A 2ILYA 4PAAA 2V4JA 1WC6A 2AX0A 1AYEA 1HQUA 2DKOB 2V8VA 2N3OA 1DTTB 4DCOB 2XMKA 1HHSA 1KONA 3K57A 3CIMA 3MM8A 4IOAQ 3FSIA 4JI6J 2OLWA 3HD2A 1RTIA 3IA0A 1KHWA 2VU5A 3BKUA 4C3LA 2DNQA 2A1BA 3M8ZA 1MSWD 3PYDA 5E5NA 2PGCA 2IHR1 3NCRA 2W9CB 3KK1A 1IJFB 4EBCA 5AXLA 2V50A 3TJAA 3LP0B 2XWXA 2WONB 3ITHA 2DGQA 4HT5A 1WDTA 2GC8A 4OI4A 3J81j 2BJDA 3BBCA 2JEFA 2VPZB 1VQOS 5C42B 4TKTA 1U0SA 2XLIA 1IWGA 2BE2A 4B9LA 1S99A 4OYMA 2CJXB 4EK2A 4KHPJ 2V8PA 3EDQB 1RHKB 4C7QA 2W8LA 1HBOB 3DMJA 1B0PA 3MD1A 3EYZA 4A8OA 4JI4J 1XNRF 2EVZA 4QR2A 1M5PC 2AGQA 3G6ES 2GQCA 4DR7J 3UR3C 3CJ8A 3Q24A 3AT1B 1WJ9A 4KJIA 3VQTA 1MN7A 5DO2A 5A2QY 3Q8RB 1I51B 1URRA 4I6YA 1CSJA 4DQRA 5JVGQ 4ED7A 4G65A 2C2KB 1D8ZA 4TY8A 3TI0A 3TYTA 3FQKA 2GJFA 5KT3A 2CPFA 3OBIA 4HTIA 4LRAA 2FVSA 1SUQA 4N41A 3Q0AA 3UNYA 3KHRA 3HHNB 4AL5A 4IQXA 3MF5A 3ILOA 1FXDA 2W7AA 3MURP 5IXUA 5LMNJ 4CO0A 2F8MA 5H9EJ 2MJNA 4NASA 3FBEA 3K5LA 1T05B 2DNZA 2X1FA 2PI4A 3ZZUA 2H65B 4DX7A 2RQKA 4NLVA 3MFIA 2HYIB 2W8KA 4ERDA 1UEUA 3MM9A 2UUBF 3DOKB 2HRTA 1YJNS 1P1LA 3MEGA 4LT6A 4USKA 2CDQA 1Z4UA 2KXNB 5EX0A 4NZ0A 1WACA 3SV3A 3AOAA 2DNHA 2RRNA 2LDYA 4IDKB 3TR5A 4DV3F 2FJWA 2O3DA 1ZH5A 3TEGA 3W63A 3TUIC 2BMBA 4KSEB 5ADZA 1ZBTA 3OHAA 2WVBA 4IFVA 1GXTA 3HSDA 4DV7F 3CJRA 1RYSA 2DIUA 3PYGA 4CWBA 1GQEA 3DXSX 2AJ2A 1N0UA 4K0KJ 2MKSA 3KLEA 1U4BA 3DNCA 1LFWA 1PIEA 4ZJLA 2AMCB 1KFSA 3PHTA 4QR0A 2HBRB 3RRKA 1S6PA 1QAYA 1IVZA 2HNDA 1K73T 3MD3A 2V9WA 2DR9A 3PY8A 1PC5A 4K50A 4X64F 3DRPB 1WC4A 2IM2A 2A2DA 3AFGA 5J2PA 3T6JA 5HMWA 1M1HA 2MZQA 1EKRA 4J9UE 1YBUA 3H25A 1TVRB 3OXLA 2PA8D 2R7SA 2ZJRQ 1FF2A 1VBKA 2GIRA 3C6UA 2DEIA 2HIQA 2B4PA 4JI1F 4DPXA 2DHAA 1JIHA 3EUNA 4RPFA 1BE4A 2QO3A 4NCAA 2ZE2A 1Q16B 5CZXA 4ICLB 1UTAA 1TELA 3GYNA 2RIJA 1D9DA 2VFTA 2YWWA 4C4WA 4UOFA 2ASYA 4ZDNA 4DDFA 3T1HF 2V2QA 1K1SA 3JXOA 3PX6A 1VQ5S 3G2XA 3IGVA 4UF4A 1FNOA 4K4WA 4HR2A 4WFBQ 3LP2B 2L41A 2HS0A 2EXUA 3GJSB 2JH3A 3PIOQ 2C3PA 2Y1IA 4M95A 2CWXA 1F9FA 1GMUA 5HVGA 5FLXU 3LOUA 3SQOP 4P2XA 5L1KA 5I3UB 2B8QA 3OTOJ 3TA0A 3M32B 4AXIA 2QLXA 3PRDA 4G1QA 4X4SA 2G0JA 4P73A 2R2TA 2ZNZA 2EPIA 1YSJA 3ZTOA 2MKKA 1CC7A 4Y2AA 4ZPDA 3P4UB 1TFWA 1SCJB 2X3DA 1ZOTA 2POKA 4PKDB 4HACB 5KFTA 2B51A 4KPCA 5KG0A 3NOGA 1SB6A 4KT0C 1QAIA 4A47A 3D68A 1M5VC 2GHWA 2ZZTA 4ZP9A 4WYLA 3O5TB 3PG9A 4U7UK 4JI0F 1PKUA 4LSZB 4RW6A 1RBAA 1VC6A 4EMDA 4F4ZA 3MM7B 3QAUA 1L3KA 2W7OA 2I5JA 5GAGI 4ZOSA 3EZ5A 2F40A 1U1KA 4RU9A 4Z7CA 4CT8A 1WF0A 3SFGA 3M8PA 3BGRB 1Q5VA 2DXEA 3HP6A 3D9BA 2VA2A 3KK3A 1JK9B 1Y4ZB 1DQAA 4ZIVA 4F4KA 2NUHA 3MMJA 4DI6A 1HNIA 1M5HA 5MAOA 2DB1A 2EEYA 2N3LA 4FXVA 4WKYA 3HKWA 2EKNA 2NPIA 2BRLA 5KFAA 1VISA 2ZOGA 3R5BA 2V34A 2L9DA 3DRRA 4AXJA 1GXLA 5F8IA 2K8GA 3G82A 1IWAA 4F26A 1V3SA 5BR8J 4B9UA 1RT2A 3Q8VA 3D67A 2NUUG 1S4FA 4WKRA 1YIJS 4C8NA 3P96A 2KN4A 1O51A 4ZVTB 1I1GA 2CPHA 1RKIA 4DR2J 2KHDA 3MEDA 3AD8C 2DNPA 3AQPA 3T5KA 3MR3A 4FYWB 3KLIA 3OLAA 3HF5A 4UOCA 2HHUA 1SH0A 1YZ7A 1NKEA 1HA1A 1SVDA 3MMCA 4EU0A 3HO1A 4KGMA 2VKZG 3R2CJ 3SQGB 3CDUA 4B3MF 4EI2A 4J9QA 2JWNA 1J5OB 3DRSA 2GS8A 3T5LA 3PYFA 1NK7A 2FPHX 1HKAA 2DTJA 2G2OA 3E51A 4O0IA 5AJ3J 2XZWA 4HL9A 1F6TA 1XR6A 5F41A 4ZVRB 1IR0A 4OYWA 2LA6A 2O01C 1VQ8S 1S0MA 4IRDA 3V2UC 4ILMA 5D4OA 3C16A 3SSSA 5HJXA 2CG8A 4B9SA 2DYAA 3CJKA 5F8MA 4PABA 4ZS6A 4FZVA 3UD5A 2DGTA 2AWZA 3KLFA 2NXJA 4Y2MA 1GMVA 3CMQA 3PJXA 2J7KA 5DETA 2O67A 4UOGA 2KT2A 2M9KA 3G87A 4NZ6A 1NAQA 2DO0A 2FLNA 3BPDA 1WG4A 1G3OA 4UQTA 3QGIA 2N4DA 3DXBA 3RAQA 4ANDA 2MMYA 3UCGA 1C4CA 1OO0B 5IC4B 4ILRA 4GO7X 5E33A 3CO0P 4TLQA 1HMVB 3NXZA 5KFOA 1VQSA 4FF1A 2ZFHA 5LMUF 4J37A 1I5OB 3GG0A 2V5HG 4CLFA 2ZUAA 3TARA 4F25A 1DFDA 4DL6A 4ED8A 4LVOP 5HLFA 2BJ3A 3N5BA 2RJZA 1FJEB 3D2WA 2H9ZA 3BEGB 3QT5A 2OPQA 1LW0A 5KT6A 2AYGA 1F3VA 3HSJA 3V81B 2VFUA 2UXDF 3RU0A 5ETKA 3D0HE 4KR0B 3OL7A 1WC0A 2WTFA 4DSKA 2VBZA 4A8YA 1VC0A 2YQ3A 1R0AA 5EWGA 3L09A 3CF5Q 2N7CA 4DCJB 1S1XA 5I3QA 4JI3J 2LEAA 3OUYA 1FK9B 4Y2CA 1VJWA 4CLKA 1DLOB 3Q86A 4IOBA 2R2SA 4NI2A 4UZCA 3MFHA 3POTB 1I3OB 1RWNB 3LPYA 2FLOA 3LUYA 1HLWA 4IG3B 1HHTP 3I6PA 2OEJA 3NGKA 1PGZA 4JV5F 1T94A 1M5SA 1OWXA 2KT5A 5M2PA 1X4AA 1O8BA 1IBLJ 5C24A 7AT1B 2FDNA 4NA3A 4FPRA 1YRTA 5E3CA 1EX8A 3PR5B 4USVA 3ZO7A 2ZM6J 1XEZA 5HN0A 2XNQA 3L7UA 5KT4A 4OV6A 1WHYA 2AYMA 2ZH3A 2A2CA 1EZZB 3EWGA 4LF7F 4DSLA 3GB0A 1U02A 1HQEA 1VOMA 3OL8A 4LF8F 5EX3A 1CJTA 3GIMA 4PPDA 1M1GA 2HWIA 2ZD1A 3BYRA 1FKOB 6AT1B 1G1XA 1FJGJ 2J76E 3CJ0A 2VG6A 1WI6A 2XLKA 2ZBIA 5M2UA 1WSVA 5D4NA 3H5UA 2FJVA 3FBCA 2R7RA 1Q8KA 1TKDA 4X4OA 4OL8A 4P75A 4KBIA 2OPRB 4NXNF 3PDNA 3TNVA 2VPYB 5KFLA 4PWDB 3NNAA 1Y3JA 1S1WB 1T9VA 4LFAJ 2Z57B 1N6QA 2I1RA 3C8YA 3QATA 2G2YA 2XEXA 3M1VA 1AUDA 3J81U 4GMKA 1FJCA 1SQEA 4C8YA 2W4PA 2PE8A 3LTOA 2CJBA 2VOOA 4NLYA 4OZ1A 3M8RA 2GNKA 2FLPA 4O3QA 1RT1B 5A8RA 4ZCLA 4MJKA 2FJAB 1FFGB 4AUKA 4YB1P 1UVKA 3CGIA 4Y34A 4ZCMA 3TUJC 4X4QA 5C25B 2HMIA 2WCXA 1FO1A 2XYHB 1BQMB 4JV1A 4YR3A 4H4MA 2R7VA 2FC8A 4J91A 1R0CB 1UJ4A 5AE3A 1HYSB 4DL3A 2YNIA 3J7YU 4DV5F 1SC4B 2Z2YB 4CO4A 4ZLNA 2MSTA 1OS5A 3GCWP 1KR4A 1WG5A 4RZRA 2IM0A 4ZP6A 3R2DJ 4URSA 1HI1A 1AA1B 1TU0B 3PM9A 3PW0A 3GIJA 1JJCB 2O1PA 2N82B 4B3OB 3AA8A 1NSAA 2OPPA 1NBEB 4OQJA 1SJQA 1KDNA 3HHLB 3VGTA 3K8VA 1MLAA 1LKZA 1U6BA 5KG7A 4L74A 1SKRA 1VHFA 1GTEA 3M4XA 2W9CA 1KHVA 4FNIA 2MLZA 2C3MA 4QZVB 4PXEA 1R7IA 3QGPA 4CH7A 1FEHA 3LP0A 2UUBJ 1ZM2A 1J2VA 4YY3F 2WONA 2OUGA 4Q45A 4ZVGA 2HEKA 5H9EK 2YNFB 1JXEA 2RU3A 2F4VF 5C42A 2LXIA 1UAWA 2FYXA 1Q7YT 1DHMA 2IRXA 3RYLA 3HVWA 4DV3J 3I0RB 3QBCA 2LQ9A 1HBOA 5CYQB 4GO5X 4JOUA 3OVBA 1WF2A 3BSOA 2M3DA 2VQFF 3D28A 4DFPA 4ALZA 1ZETA 1YJWS 2AYBA 3HCXA 3LA0A 2E1MC 4DV7J 1E6VB 4B9NA 5DRKA 1FRMA 5DG8A 4IRCA 2PMWA 2WRMA 4WYWA 4M5DB 4C8OA 3OTEA 1HBMB 1G4CA 3FFIA 1UVNA 2K3KA 4TQSA 3VZHA 4DR6F 1A6LA 4PRFA 2PA3A 3Q8YA 4M1KA 4EO8A 4X64J 2PSZA 5L1LA 2D9OA 4L76A 2CQGA 3L7PA 3D0IE 5F9LA 1PBAA 2Y3YA 3H4DA 3BQ2A 1EQMA 5MLCV 1T05A 4F2RA 3CIZA 3P49B 2WK4A 3O8WA 4NYPA 4KO0B 3MPDA 1UWAA 4DPYA 3M9NB 5DJBA 2V8DA 3IR7B 4DQPA 1W25A 2KTQA 4XAKA 4OHZA 4IKAA 4J9LA 4HHUA 3DOKA 4Q7AA 2GJ2A 2VZ9A 3QQCD 4Q0BB 2BE9B 2YX1A 2R2RA 2VBXA 2DNLA 3TZYA 5AXNA 3C15B 1NSPA 5JUMA 5HP1A 2J6TA 2AZ3A 5LXYA 4OZ2A 2XCAA 5K8OA 2BM1A 3EXCX 3HD1A 3SDEB 1WSRA 5KFEA 1C0UB 2WB4A 3N6NA 4ETZA 5ETTA 3G6XA 3P5TL 4M63A 2HW3A 4MIWA 2IYGA 4DV1J 1VQKS 5HANA 4NLDA 4UW2A 4IH7A 4YB6A 1ZPVA 5KFGA 2R8HA 1EP4B 2YVSA 5KFHA 3EVWA 3RZAA 4C48A 2JEGA 2DEJA 4DUYF 3N5FA 4L72B 3ZZRA 5HQ8A 2BRKA 2B0GA 1TAUA 2XYGB 3DRPA 2LQ5A 3MWBA 1U8SA 3OW2R 2BKOA 1TTHB 4Q8EA 3CEDA 1B7YB 4FVCA 3D1OA 3TUPA 2WBMA 4Y6IA 2GMLA 1CG2A 2V6AA 3SFUA 1TVRA 1BD6A 1TUVA 4JI0J 4PXBA 4N77A 1TL3B 3ISZA 3PRVA 1KRPA 2P6TA 3C14B 1F1BB 2KRRA 1JKHB 5D77A 4NLGA 1X4HA 4BWJA 3A8KA 3L95X 3RRGA 4K4ZA 3PEJA 2OMOA 1RI7A 4DOZA 3VTIA 2YKNB 3T1YF 3HVTA 2AEJA 4BDPA 2BE7D 2W2PP 2KDOA 5GAEU 1ZA2B 1YX2A 1SQFA 5A0YA 2MXYA 3M2UB 3DDNA 2CYYA 3LP2A 1PJ6A 3D3BJ 2GQQA 3CD5A 5F8JA 4DUTA 5M2RA 4ZVUB 2RUGA 2Y1RI 2XM3A 5IT0A 3H2VE 4G1PA 3GCXP 1RA7A 2WVFA 3SIPB 2FY8A 1HWIA 3GR0A 2VHGA 4K7QA 5I3UA 2WSFC 1R8CA 2XY7A 3W65A 4LR8A 2IBKA 2RU9A 3ILIA 2XS5A 3H59A 1RACB 1OY8A 2MQNA 4M5HA 5E7OB 2UUCF 1U0HB 4YN3B 4R25A 2YH1A 4P72A 1C0TB 4HACA 2HS3A 4IO1A 4P71A 4PXDA 2HBQB 3AD9C 3NAHA 1NK0A 4C8KA 2CPYA 2W9BB 1GMWA 3R5GA 5ETSA 4B3MJ 3ENAA 2DHGA 4WU2A 4G6VB 1FD2A 2B4OA 1BMQB 2KM8B 3ZC4A 3MM7A 4ZITA 3UN5A 1HFEL 1N54B 4HYKA 2BVZA 1YBTA 1HR0F 4OX6A 3HVAA 5GADU 3ZZYA 3JYTB 3G8QA 1VLYA 4IR1A 3DOMB 1DZ5A 5HQMA 3FCVA 4X65F 2BR0A 3Q2SC 2C42A 4URGA 2DCUB 4GC6A 2DNNA 1HNXF 4X66F 2DH9A 2R8GA 2GVZA 3OVAA 4WP9A 3OTDA 1A0OB 5HROB 3IBFB 1UFKA 3C19A 2XS2A 4NLSA 3HJFA 3LALA 1T9UA 3D1QA 4ZVHA 1Q86T 1FKPA 3T3FA 4RUCA 3NY0A 5FLXY 3W1YC 2DR8A 3B6BA 3BYPA 2AX1A 2QG9B 4LBHA 4NXMF 5A2QU 5IC6B 3DKDA 3MR7A 4URQU 3UI3A 2VFRA 2YNHB 3RGIA 4MK7A 5LMUJ 3W64A 4RU2A 1NSQA 1NEEA 5EHHA 1QE1B 3D7SB 4CLLA 4NMXA 1WORA 5K5MA 2VUGA 1FE0A 1KQSR 1LWCA 4U95A 1D8YA 4B9TA 4CM2A 2D3O1 2PFDA 2A10A 2JVRA 3OXGA 1JLBA 4RWXA 1J5OA 3DOLB 2K1RB 1Q0NA 1HBUB 1UZHA 2P6SA 1BQXA 1HWKA 3TZWA 4MAKA 2UXDJ 1T9YA 4OMFG 4O23A 1U7LA 3HZGA 3I56S 1RT3A 4R8UB 1AZSB 4DQQA 1REVB 3OFGA 2A6MA 3A12A 4KGVB 2WSCC 4KKOA 1CJUB 4LF2A 4ZHRB 4QIEA 2JX2A 4NA2A 1PBUA 2MZTA 4PWUA 2B43A 2HLUA 3GFHA 2QJ3A 4DV4F 2XTJP 2CNKB 3G8TA 1UP1A 3M8YA 2CNOB 5KFIA 1TFYA 3Q8PB 1RT5B 3TO8A 1IUJA 4B9VA 2N4CA 2CQHA 3W8GA 2DRDA 2NXEA 1LOUA 1HPZB 3K2YA 3CW2C 4KAIA 3IAS9 1L3VA 4J9MA 3NGTA 3U7JA 2B56A 3TJ8A 3FKBA 4V19X 1F2HA 1TL1A 3MM6B 3Q83A 1RTJB 2JLFA 2V9KA 5CABA 2AIRB 1TAQA 2DNRA 2ZHBA 2IFXA 4I56A 3MAHA 1HMVA 2DR5A 4LF7J 3WIUA 4KIAA 4RBVA 2IJNA 4AFFA 4ZLJA 1ELOA 5KFRA 1RWOB 1YJ7A 2MQOA 4LF8J 3TQ1A 1F60B 2XLJA 4W92B 5KG3A 1BXNA 1B3TA 4JI6F 4MYUA 4ID8A 6FD1A 2R4FA 1X4EA 4ZKAA 1S0OA 1NO8A 1XMBA 2RDDA 5BYSA 5HBMB 3V81A 2VF3A 3R6GB 2KXHA 4FF2A 1TL7B 1DQ9A 2HFSA 3HXMA 4I6WA 3P45B 3SMZA 3KLGB 4I7FA 2YTCA 2LMIA 4NXNJ 3JAMU 3J80U 4ELTA 2DNOA 2RUSA 1CJKB 1UVJA 1KD1T 1DLOA 2V69A 5B0GA 2W2NP 3MMBB 2BZ2A 1XJWB 3IRXB 2V0NA 4IG3A 2HQCA 4ANCA 1H72C 3VQSA 3CMAS 3M6VA 2AGPA 1IR2A 2Z56B 4X84A 5DDOC 3VR1A 3DLGB 3KHHA 4HLBA 4M5KA 3BBFA 5A6PA 1IM4A 2NYIA 2ZH1A 4I0WA 4JI4F 1VFJA 3CCES 2J9DA 2GJIA 4HH0A 2DD8S 1F9EB 3A8IA 3RG6A 1SL1A 3H42A 3R5DA 4NMLA 1R3NA 1NK9A 5L9XA 2HGLA 4KYZA 3AXKA 1Q82T 3UDVA 1TV6B 5E3RA 1SJFA 2BYCA 2P9GA 4J7CA 4RBUA 3TVKA 1FKOA 5KOWA 2JLEA 3V6DA 5IWAF 3KG4A 5CCLA 1XMOF 4EZ6A 1TK5A 2E9ZA 4O0NA 3NRBA 2IDLA 3MGJA 2RD5C 2XHCA 1OSCA 2PI5A 2HFVA 2ZITA 1PYOB 4HEA9 4PXCA 4F67A 1K44A 4WFXA 3RB4A 5FIIA 2ZHOA 1FT8A 2LECA 2BJ9A 1ZYQA 2XY6A 1QUPA 3CDWA 5A6WA 2OPRA 2HKEA 4CCHA 2AJ0A 3M6WA 4A8XA 2E7VA 4O4GB 5F9NA 2FVQA 4PWDA 2RHQB 1S1WA 2X1GA 2DH7A 2H54B 4DX5A 2YX7A 1S72S 4OZ3A 4KH1B 2W2QP 2GV1A 4DPWA 2WHOA 1U25A 3QFHA 3GV5B
chains in the Genus database with same CATH topology
3CNQP 3SQOP 2W2MP 1SPBP 1R6VA 4NMXA 3VHQA 3A3NB 3A3OB 3AFGA 3GCWP 4NE9C 4YN3B 2XTJP 3CO0P 3WIVA 2Z2ZA 2Z58B 2ZWPA 2QTWA 2Z56B 2E1PA 3WIUA 2W2PP 4JP8A 3A3PB 3GCXP 1SCJB 2W2QP 3VV2B 2ZWOA 2Z30B 2W2NP 2Z57B 3P5BP 2PMWA 4K8RA 3WHIA 3BPSP 3BGOP 1ITPA 1V5IB 3H42A 2W2OP 3QFHA 4OV6A 3T41A 2Z2YB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CNQ P;  3SQO P;  2W2M P;  1SPB P;  1R6V A;  4NMX A;  3VHQ A;  3A3N B;  3A3O B;  3AFG A;  3GCW P;  4NE9 C;  4YN3 B;  2XTJ P;  3CO0 P;  3WIV A;  2Z2Z A;  2Z58 B;  2ZWP A;  2QTW A;  2Z56 B;  2E1P A;  3WIU A;  2W2P P;  4JP8 A;  3A3P B;  3GCX P;  1SCJ B;  2W2Q P;  3VV2 B;  2ZWO A;  2Z30 B;  2W2N P;  2Z57 B;  3P5B P;  2PMW A;  4K8R A;  3WHI A;  3BPS P;  3BGO P;  1ITP A;  1V5I B;  3H42 A;  2W2O P;  3QFH A;  4OV6 A;  3T41 A;  2Z2Y B; 
#chains in the Genus database with same CATH topology
 2IRU A;  4YY3 J;  3QLH B;  5A8K B;  4X4T A;  4NEY A;  1UJ6 A;  2CVE A;  5K14 A;  4ZK7 M;  2O66 A;  2QA2 A;  1DQ8 A;  1HD1 A;  1WD6 A;  4JYA F;  2GA7 A;  1TKT B;  3NOC A;  2B4V A;  2VG5 A;  4NCG B;  1SH3 A;  1UFL A;  1NM2 A;  1YJV A;  2ZBC A;  3BPS P;  1M0S A;  5C25 A;  4K0K F;  2A3J A;  4C11 B;  2QC3 A;  1QVG R;  4BS2 A;  2VQF J;  2BKP A;  3BO3 A;  2H5J B;  1BQM A;  1RAJ A;  2XZT B;  2UVW A;  4OV1 A;  3IG1 B;  2KO1 A;  1KLM B;  1HYS A;  4ZVQ B;  5B0B A;  1S1U B;  3MHY A;  1RAA B;  3TAN A;  2DNG A;  3AOC A;  2ROG A;  1TKZ B;  4WZQ A;  5KT7 A;  4QR1 A;  3AOD A;  3OT9 A;  2DNM A;  4NLT A;  1ARO P;  1YWX A;  2WAQ D;  2COL A;  1GMW D;  2BKN A;  3HHL A;  4C97 A;  5F3T A;  3D6H B;  3PNI A;  1YG0 A;  3LP1 B;  2UXB J;  1N32 F;  1SJR A;  3UPF A;  2B5J A;  3VVT A;  1KVJ A;  2HHT A;  3U1L A;  3DLJ A;  4BWM A;  2CPJ A;  4WXO A;  1DJ0 A;  4NZ7 A;  5DM6 Q;  3ENW A;  3OJU A;  4DZD A;  4R5P B;  2YX4 A;  2QGF B;  4U96 A;  1BY9 A;  5B0E A;  1D3W A;  4EUV A;  4CLY A;  3CTR A;  2F8H A;  2Q43 A;  4TQR A;  3T1A A;  3CDA A;  4AD6 A;  3J81 Y;  1G6B A;  2YKP A;  3GTY X;  4A8W A;  1SJ4 P;  1BC6 A;  1XBW A;  4LF9 F;  2MZ1 A;  4I69 A;  4DJB A;  1YJU A;  3R5J B;  3KJQ B;  3OTO F;  1FDD A;  2R2U A;  4LVN P;  4X4R A;  4N8O A;  3MM5 B;  5CYQ A;  3BN7 A;  4HTJ A;  1YJT A;  2HWT A;  1C2P A;  2DNY A;  1CPZ A;  2ATL A;  4DF8 A;  3H7H B;  4QIW D;  1PO6 A;  5CH7 B;  3C6T B;  2P9C A;  5B09 A;  3QT7 A;  2E5J A;  3DI6 A;  3PCO B;  1TMM A;  4B3R J;  1BUX A;  1E6V A;  2NR0 A;  4OHY A;  1HWJ A;  1NDC A;  1RQ0 A;  2VFS A;  3FSX A;  5ITH A;  3G86 A;  1WKL A;  1RAI B;  2JOQ A;  3CCZ A;  2MLX A;  3S1T A;  2FUG 9;  2IJR A;  2ZH5 A;  2R7Q A;  2OGU A;  4KC5 A;  1NJX A;  3FRZ A;  2BA9 A;  2JLG A;  5HAT A;  4RW7 B;  1LWF B;  3EXY A;  5E2Q A;  3MR5 A;  1JLE A;  2HRU A;  2DGS A;  2GO8 A;  2J9D E;  1T3O A;  2EFG A;  1NND A;  2FLL A;  1VJQ A;  5DG7 A;  4U7U D;  4M5L A;  2WB1 D;  5DQG A;  3PKM A;  5ETL A;  2ROP A;  3ZZO A;  4JI7 J;  4KO0 A;  3OJS A;  1H7X A;  3VAJ A;  1NUE A;  1V6H A;  2OH2 A;  3H5S A;  4O44 B;  4Q0B A;  2G0I A;  3F41 A;  2DXF A;  1HD0 A;  4CO2 A;  2RKI B;  1S6O A;  5HL7 Q;  4Q8F A;  1BHN A;  2D1C A;  3W8P A;  5D8H B;  2EC0 A;  4WBF A;  4WTO B;  4DX8 H;  3T1Y J;  4EZ9 A;  2C3U A;  5KFP A;  1TUG B;  2HQI A;  2ZEJ A;  3C15 A;  2FVC A;  4PCQ A;  3JSM B;  4K4Y A;  3IR6 B;  1KQF B;  5L9N A;  3WHI A;  2NXN A;  2C2Z B;  5E0O A;  4KQZ A;  4LRD A;  5EDW A;  2QA4 G;  2Z2L A;  4FBT A;  3SDE A;  5HMX A;  2GQ2 A;  4CQ1 A;  3GPA A;  3HFZ B;  1T03 B;  4KE5 A;  1HWL A;  3J7A 1;  5HVF A;  4EYH B;  1VBZ A;  3M30 B;  3OR2 B;  4K8R A;  4ES2 A;  5KAK A;  1AFJ A;  2ZC4 A;  4RKU C;  4DR2 F;  1Q8I A;  2F1F A;  4YEA A;  2AJF E;  1U8W A;  4P2M A;  1NJI T;  1IKW B;  1IM6 A;  2JEJ A;  4O3O A;  4F0M A;  4WXW A;  1RAH B;  1EP4 A;  1LW2 B;  1T11 A;  4WFN Q;  1X4B A;  3M8Q B;  2E66 A;  2CA9 A;  1WUU A;  4MYT A;  3R1H A;  5AT1 B;  2DY1 A;  2UUC J;  2E9T A;  5CHC B;  1U1P A;  3I32 A;  1SJ3 P;  2AF6 A;  1XER A;  4CRJ A;  1U1N A;  4J9V A;  3H8Y A;  4IFY A;  2NSC A;  4MKY A;  3F0N A;  4LSL B;  4J9K A;  2OJ3 A;  2J0X A;  1H38 A;  2OEK A;  2FVP A;  1K47 A;  3E01 A;  1FFS B;  1NJY A;  2G2Z A;  2EFV A;  2E5L J;  2JFD A;  3C14 A;  1EET A;  3ULH A;  1JKH A;  2EW9 A;  5DLF A;  2JVO A;  3K58 A;  5KFZ A;  1Y11 A;  3W9H A;  2CQ1 A;  4M5M A;  3ENQ A;  3OSP A;  4ZPV R;  1IKX A;  1HR0 J;  4QWD A;  2Y8W A;  5JJB A;  3Q23 A;  1SXL A;  3L7O A;  2RS8 A;  3KK2 B;  3MUV P;  1FRI A;  2YKN A;  1RZM A;  1WHV A;  1S49 A;  3NS6 A;  3KJV B;  4A46 A;  5ETO A;  2XC9 A;  3I5C A;  1WHW A;  5IFM A;  2MB0 B;  2QEX S;  2HZA A;  3M2U A;  4X4P A;  4A8F A;  3MUT P;  1VRU B;  3I55 S;  2EFO A;  4TLR A;  2LA4 A;  3KHG A;  4QWE A;  1MMN A;  4CLT A;  3D0G E;  2ZBQ A;  1NPP A;  2HVE A;  4DPT A;  1R8P A;  3X1L B;  4ZMM A;  3HT0 A;  4UY8 5;  3D4J A;  4DR5 J;  3MCO A;  1NJW A;  2ZHA A;  2IM3 A;  4NXM J;  1YRX A;  2B4U A;  3QPI A;  3W2W B;  4TNO A;  2FD2 A;  1SI9 A;  4J9S A;  1RAG B;  3FBB A;  1H3D A;  5LSO A;  5CQG A;  2AT1 B;  2V8G A;  3HK2 A;  3H90 A;  4AE5 A;  1KLN A;  4CI0 B;  1RT6 B;  3HJV A;  2RIL A;  4DL7 A;  3FNN A;  5KFK A;  1C0T A;  3H4B A;  3IS9 B;  2L3M A;  1U1O A;  2HNZ B;  2MTL A;  2XMT A;  1HNW F;  1KP6 A;  4X4U A;  3N01 A;  2W9B A;  1NKB A;  3DLE B;  1RWW B;  1Z2L A;  1C1C B;  2PMH A;  2BAC A;  3H0P A;  2R9L A;  1X5T A;  2FQQ B;  4W4M A;  1N52 B;  1N5Y B;  4DXL A;  1VK8 A;  4D3G A;  2YXL A;  4DFJ A;  3FCH A;  2FHO B;  2KJV A;  5F8L A;  5KG2 A;  4DPO A;  3C3L A;  2XI2 A;  1T9T A;  2DHS A;  1RAB B;  3P3D A;  3IN5 A;  1IKV B;  4DR1 J;  4OZL A;  3CD6 S;  5LXR A;  4RW9 A;  4DSJ A;  1SJ1 A;  3CJQ A;  3JYT A;  1M5O C;  1NZ8 A;  4DU7 A;  5KFX A;  1KVK A;  4I2Q B;  2CQP A;  1AW0 A;  3OLB A;  3NNH A;  1NH7 A;  4DV4 J;  1DAR A;  1JJ2 R;  2ZM6 F;  4P7T A;  2UVR A;  3VAL A;  4Z2X A;  3KNG A;  1BGX T;  1ZZN A;  1NHU A;  5HRO A;  1N5T A;  4FXW A;  2KB2 A;  1BWV A;  4F04 B;  2WSE C;  3QIP B;  1S57 A;  3OTB A;  2YNG B;  3LWM A;  3BN4 A;  2QV6 A;  3EDR B;  1X0F A;  4ED5 A;  3UD4 P;  1C1B A;  3HVR A;  1SC3 B;  5C2G A;  4CTA A;  2V4J B;  2GW8 A;  1WDD A;  1APS A;  1IBK F;  3FRY A;  4RUB A;  2PN6 A;  1HQU B;  5I42 A;  5L8R C;  2CPI A;  1SC6 A;  4KFB B;  2AU0 A;  3VGU A;  3R1L A;  1YDL A;  1RB0 A;  2LCW A;  1RT4 B;  3MM8 B;  3F73 A;  4JV0 A;  3W60 A;  3DOL A;  2K1R A;  1RTI B;  1HBU A;  2FGO A;  2OML A;  2CZ4 A;  4FDF A;  2VB6 A;  4YUD A;  3HHL D;  1QTN B;  3GG1 A;  3IGN A;  1W7W A;  3TW0 A;  1FCA A;  2AGO A;  4LFA F;  2F9D A;  3MR6 A;  1X4C A;  4DCP B;  4K4V A;  3A1Y G;  4R8U A;  4P52 A;  3NS5 A;  1REV A;  2G1D A;  4H54 A;  4JUZ A;  5EWF A;  4LMZ A;  1CJU A;  3DHW C;  3M2R A;  2IJF A;  2OI2 A;  3CCS S;  4W98 A;  2P8I A;  3ICL A;  1OIA A;  4WK3 A;  1IN0 A;  5RUB A;  4TN2 A;  4TU8 A;  1DRZ A;  1N5S A;  4QU7 A;  2B6A B;  5ETV A;  3C66 A;  1VBY A;  4PR6 A;  2DK2 A;  2HQD A;  1RT5 A;  1X60 A;  3T19 A;  1TKX A;  4YB7 A;  2KJW A;  4RNN A;  2HK2 A;  2IMO A;  3UO0 A;  4YQW A;  1IQT A;  1S1T B;  3CJ3 A;  4MKV A;  3FCW A;  4LFC J;  2HHW A;  5SZT A;  4CLU A;  1HBN B;  3O1L A;  4I2P B;  4HHJ A;  1UCN A;  2X1A A;  4UOH A;  2KFN A;  4HVZ A;  1NPK A;  4DUZ F;  2L9W A;  1UVI A;  2NLW A;  2J9C A;  2ZH7 A;  2NXC A;  4Q5V A;  2HFZ A;  3DYA A;  3UVJ A;  3QO9 A;  1LWX A;  3KOA A;  3SSR A;  1UMJ A;  5IWA J;  5GAG U;  1AB8 A;  1M90 T;  4F36 A;  2LU1 A;  1XMO J;  4LBP A;  4OYZ A;  1EIY B;  3HHD A;  5HBM A;  4N5S A;  3AQO A;  2C3O A;  4DWI A;  2UV8 A;  4BHQ A;  4DL5 A;  1MNE A;  1R8A A;  2G1H A;  4CO1 A;  1R43 A;  4WE1 B;  2EBE A;  3AOB A;  3CCT A;  3UDL A;  3KUH A;  3KLG A;  3LPE A;  2YPZ A;  3FZ2 A;  3H98 A;  1RWP B;  4UST A;  1CC8 A;  5GME A;  3MM9 B;  3UE2 A;  2F5G A;  1JX4 A;  1NU4 A;  1CJK A;  5H1S V;  1UET A;  3DDK A;  2ZBR A;  5A8W B;  1H73 A;  1QDU B;  3ZZZ A;  2FIU A;  3MMB A;  3IRX A;  1FRJ A;  3C46 A;  2XWY A;  4UUW A;  1JLF B;  3ETM A;  3M2V A;  1TK8 A;  2X1B A;  4Y0F A;  1GX6 A;  1CJV B;  4D3H A;  2HAI A;  1HAR A;  1VQY A;  2NZ4 A;  2WVD A;  1SBR A;  4P2F A;  3JTN A;  5IT9 U;  4JYA J;  4JI2 J;  1SL2 A;  2B7C B;  2OSQ A;  2Y9H A;  1HNZ F;  1HNV B;  4EYI B;  4ECV A;  1KTV A;  3ADA C;  4RNO A;  3FUY A;  3GP9 A;  3LO3 A;  3NWG A;  4EWT A;  3BQ0 A;  3KLE B;  1TV6 A;  5ETN A;  3V4I A;  3FBF A;  2XGP A;  2XY5 A;  3LAN A;  4YR2 A;  3ET6 B;  3I0S A;  3UCU P;  3IC1 A;  4RJV A;  3W5Y A;  1KTQ A;  2KHC A;  5DGA A;  5CXT A;  4NX9 A;  5D3G A;  1S7I A;  1KBR A;  2CAD A;  1TP7 A;  1RDR A;  5J2P B;  4NEZ A;  2F9J A;  4F3Q A;  4OJH A;  2H5E A;  3RB0 A;  3PW7 A;  3AJD A;  3GV8 B;  3PAC A;  1OYD A;  4U8Y A;  2Q1L A;  2K3I A;  3G6Y A;  3C6U B;  2X51 A;  5CYJ A;  2H1Y A;  1RP5 A;  2A6O A;  1DTQ B;  3AHP A;  1N32 J;  4W90 B;  1RTD B;  4O4G A;  4DL2 A;  3CC2 S;  5K8N A;  4QCL A;  3M05 A;  2C2N A;  3JAM Y;  3IR5 B;  3J80 Y;  2E44 A;  2AKW B;  2LQB A;  3OL6 A;  4DN9 A;  2BUN A;  1LFP A;  2DIV A;  1PG5 B;  3RR7 A;  1R0B G;  3MPU B;  5GAH I;  4K2X A;  1SQG A;  3W2V B;  5KOX A;  5KFN A;  3NAI A;  2WW4 A;  4OHV A;  5DGB A;  4LF9 J;  2HBZ B;  1CLF A;  3GWC A;  5D6G A;  5AE1 A;  2E9R X;  1UA1 A;  4OJG A;  3TVZ A;  3AJ1 A;  3W9J A;  4DV1 F;  1MRO A;  2CPZ A;  5L39 A;  1NHK L;  2CJQ A;  1WKJ A;  2F8E X;  3RUB L;  4OYI A;  3EVM A;  3AH6 A;  5KFB A;  3KJF B;  1VYA A;  3CUN A;  3IG1 A;  1FTR A;  1S1U A;  4PEO A;  2V8H A;  3I87 A;  1PC4 A;  5J2Q B;  1Q81 T;  2V4Q A;  1JLG B;  2DIT A;  3DDI A;  2IRY A;  1P8G A;  1TKZ A;  4XTT A;  1AFI A;  2QA4 S;  1LK5 A;  2HFU A;  2NSB A;  2AZ1 A;  4OI6 A;  2KYZ A;  1NLK L;  2V4R A;  3JQM A;  1BQN B;  3GR1 A;  5B7W A;  4FNH A;  2XCP A;  2L08 A;  3CB4 A;  3I82 A;  2LU2 A;  4GKJ J;  2UP1 A;  4LRC A;  2VL1 A;  3U02 A;  2QN6 B;  1RCX B;  4RW6 B;  2CAJ A;  2Z58 B;  5D4L A;  3VAH A;  4B17 A;  2QMX A;  2CJK A;  1RK8 A;  2ILZ A;  4PG7 A;  3CCQ S;  3AJ2 A;  3QAE A;  1X4D A;  2E5I A;  1BLU A;  1JMT A;  1U45 A;  2D69 A;  2OPS A;  1NB7 A;  5GVQ A;  1KS2 A;  3PEH A;  4R5P A;  1MMD A;  2L48 A;  1GX5 A;  2B9W A;  4RNF A;  3JSY A;  3FSY A;  1CQM A;  2EG1 A;  2IAJ A;  2QA1 A;  1C4A A;  1FDB A;  3MTJ A;  4X62 F;  4O3R A;  3CJ2 A;  3QRQ A;  3CT9 A;  4USH A;  4LBI A;  1ZTW A;  2M2B A;  2FB0 A;  2XS7 A;  1NCL A;  2J7U A;  1Q78 A;  2NXU A;  3AA9 A;  5HO4 A;  1YTY A;  3VGS A;  1RT2 B;  1DY3 A;  1VHI A;  2AQ4 A;  4IQM A;  2I6W A;  4ELU A;  5I4M A;  2R7U A;  5DG9 A;  4IG0 A;  3M9O B;  3MAA B;  4XK8 C;  2XB2 D;  4TXS A;  3MED B;  3R5C A;  2W7P A;  3GZ7 A;  4FYV B;  2OFG X;  2ZH8 A;  3PO4 A;  2HNY B;  2QFJ A;  3PVX A;  2QL7 B;  1UWB A;  4P2S A;  1F5C A;  1U1L A;  4AYB D;  1WNE A;  4RW7 A;  1RU2 A;  1LWF A;  1H2V Z;  2H3E B;  5K9F A;  2W25 A;  4MK9 A;  2M88 A;  4NL5 A;  5DS7 A;  1H74 A;  4LRB A;  1P27 B;  5B0C A;  1HW8 A;  3BO4 A;  2J5A A;  1QTM A;  4QIF A;  3K5P A;  4WFY A;  1P9Q C;  2CUY A;  2BJ1 A;  2KFY A;  3QWU A;  1Q95 G;  5FDL A;  2CZV C;  4KGX B;  3EVO A;  2IVM A;  1K0T A;  1VI7 A;  4GC7 A;  4QIG A;  2DT9 A;  3C16 B;  4LFB F;  4BCA A;  1VLO A;  3NBP B;  4UUX A;  5J2M A;  2YWG A;  4GVB A;  5DLG A;  3PKY A;  2C2M B;  4O44 A;  4KHR A;  4DSE A;  2HHH F;  2B3T B;  2RKI A;  3R7B B;  4R0E A;  3KLF B;  3OFE A;  1VQM S;  1TQL A;  4PUO B;  1QLN A;  2K7J A;  3PHE A;  2MQQ A;  2XSJ B;  1JLA B;  1FA0 A;  3JSM A;  4CO5 A;  4AQY F;  2E1C A;  4YP3 A;  2LEP A;  4K5S A;  3MEK A;  2DO4 A;  1T03 A;  1WI8 A;  4F8R A;  3O3L A;  1BWE A;  2APO A;  3M30 A;  3UDE A;  1ULR A;  4DEZ A;  2YBV A;  5JMN A;  3I9Z A;  5LM7 E;  3CCU S;  1K1Q A;  1PJ7 A;  1F3F A;  2HLT A;  1F9H A;  1IKW A;  1VQ7 S;  3SXL A;  1OMS A;  5HLF B;  2D3O R;  1FTC A;  2CNL B;  1WWH A;  5HI7 A;  1V3R A;  1FWL A;  1S12 A;  1KKH A;  3M8Q A;  2ZZM A;  4NLU A;  4V19 J;  3US5 A;  2ATC B;  2QLW A;  5HQL A;  3CJS A;  2RQ4 A;  3SYZ A;  1FXR A;  1NME B;  2UUA J;  3AAW B;  3CDE A;  3CCR S;  2JNJ A;  4ECR A;  2FHJ A;  1YQH A;  3QID A;  4J90 A;  4DL4 A;  2GVD B;  1HNW J;  4LSL A;  2MJU A;  1EB0 A;  4IUF A;  3PO5 A;  2BW7 A;  1Z2Z A;  2I2Y A;  1S1X B;  3DRX A;  2UV8 G;  2BOA A;  3EGW B;  4WCE Q;  2BX6 A;  1R6Y A;  2W24 A;  1YHQ S;  3TA2 A;  3B78 A;  4A8M P;  3R6L B;  4NI2 B;  1UVL A;  5D0G A;  5KFQ A;  3CSK A;  4M8L A;  1LNQ A;  5F8G A;  2ZUG A;  2NCK L;  1SC1 B;  1Q79 A;  4F4X A;  1UVM A;  1VRQ C;  2FHM A;  1RAO A;  4B3T F;  3DCA A;  2CJA A;  3KK2 A;  1SH2 A;  2FC9 A;  3CO9 A;  2MGZ B;  4ELV A;  1G2E A;  4BLG A;  2GAG C;  3KJV A;  2ZDO A;  3U1M A;  1H2U X;  1ZAV A;  3W7B A;  1R31 A;  4DV6 J;  1P9Y A;  1B99 A;  3I31 A;  2I38 A;  3T5H A;  3G6V A;  5BJR A;  1QAJ A;  2RNE A;  3CVK A;  5E3P A;  2DR7 A;  4ATN A;  5FJ4 A;  3NGD A;  1UL3 A;  3MAQ A;  1FRH A;  1FNM A;  1RTZ A;  3U1N A;  2MKC A;  2ZOF A;  4HI1 A;  4M5G A;  3K7R A;  3IBC B;  3KKF A;  2HQF A;  4GKK J;  3LWL A;  1FVQ A;  2V63 A;  2HZV A;  4LQ9 A;  1NXI A;  2BEF A;  1EQ0 A;  4ECQ A;  1U48 A;  3W2W A;  4K2J A;  2XMW A;  5H9F J;  2F4F A;  4Z37 A;  1Q7L B;  1D0E A;  4LF5 J;  4I64 A;  1RT6 A;  2VG6 B;  2FJB B;  1Q8L A;  4B02 A;  1OY6 A;  1IBK J;  1G7C B;  3QSY B;  2VJV A;  3MEE A;  1N36 F;  3IS9 A;  4O3S A;  5F8N A;  2HNZ A;  4MH8 A;  2LQJ A;  3DLK B;  4NRU A;  2ZH2 A;  4ZN3 A;  3NG8 A;  1AT1 B;  1UJ5 A;  2OD4 A;  1XIQ A;  4RUH A;  1VRT B;  3RW7 A;  1C1C A;  2QL9 B;  2C2D A;  2RQC A;  4YHH F;  4DV0 F;  2F7V A;  3R7S B;  4OLP A;  1N5Y A;  3NMA A;  2WOM B;  2CQB A;  4NRT A;  3LF0 A;  2BQR A;  4TYA A;  5CD4 A;  3A4T A;  4LSN B;  1UEV A;  1TMJ A;  1IKV A;  1RWV B;  4FKX A;  1YIT S;  1S9E B;  1F2G A;  5K20 B;  4F0K A;  4PZV A;  1Z1Z A;  4I2Q A;  4FKY A;  1SPB P;  3WZ0 A;  3QZ8 A;  2J0W A;  4QJV A;  2M4M A;  4OYA A;  2CFX A;  3A3O B;  3BSA A;  5B0D A;  2MY8 A;  3DGV A;  5A8R B;  1ZA1 B;  3F44 A;  5DDP C;  4UTG A;  1YBA A;  1QAX A;  2N7Y A;  1UW9 A;  1CS4 B;  3GYX B;  4KB7 A;  3ISN C;  1NZA A;  1NK5 A;  3TQE A;  4L3K A;  4N8N A;  2DRA A;  2HMI B;  1U1Q A;  3QIP A;  2H48 B;  3RBX A;  2YKM B;  5AXK A;  1JLC A;  2E5H A;  4U6P A;  2YNG A;  4PWW A;  7FDR A;  4RNM A;  2ZKU A;  4DR3 J;  5T7L B;  3UWT A;  5G0R B;  1JB0 C;  3HHL C;  2W4C A;  3IWX A;  4DSF A;  1DTT A;  4DUZ J;  3O44 A;  4OI0 A;  3SCJ E;  3BGU A;  5ETR A;  4KFB A;  4A48 A;  1PYT A;  2OPP B;  2B7B B;  2LVW A;  2VJU A;  1RT4 A;  4CH1 A;  4IO9 Q;  1L3T A;  1NH8 A;  4RBT A;  4X4N A;  2ZWO A;  4S0M A;  2LXF A;  2MZS A;  2K2P A;  4RWW A;  3ILJ A;  3CCV S;  2MY7 A;  2UXC J;  2JEI A;  2HFN A;  2ZJP Q;  4KGK A;  3HHK A;  4DV2 J;  2AP6 A;  5KG6 A;  1GT8 A;  5DDQ C;  4EBE A;  3FJ2 A;  4RW8 B;  1RWU A;  1X8D A;  4LJM A;  2QIF A;  4M94 A;  2Y0S D;  2BV3 A;  3I96 A;  7FD1 A;  1RT7 B;  1WEX A;  1LK7 A;  4Y65 A;  2RHS B;  2HZC A;  3P6Y C;  1K9M T;  1J5E J;  3OL9 A;  1LQ9 A;  2ZH9 A;  5C5J A;  3UFC X;  2B6A A;  3OD2 A;  1U2C A;  4E8U A;  1RIS A;  3THV A;  4ECS A;  1U2R A;  1U6F A;  1URN A;  1DAX A;  2O5D A;  1S1T A;  4ZCI A;  3N9U C;  5KG4 A;  4OI2 A;  5HJY A;  1H2T Z;  3F56 A;  1RHJ B;  4DG1 B;  1NK8 A;  1FX2 A;  1HNZ J;  3EZO A;  2V2K A;  1HBN A;  2AYE A;  2YKQ A;  4I2P A;  5LOQ A;  1ZTT A;  3BH7 B;  1RGV A;  1E6Y B;  2QZ8 A;  2E1P A;  3LGN A;  3UNG C;  4QU6 A;  3FFI B;  1WOO A;  2KZM A;  5G4D A;  2GGP B;  4F50 A;  3GLJ A;  2DY9 A;  1P6T A;  2KG0 A;  4OZJ A;  1Q8B A;  2UXB F;  1VIO A;  3SCK E;  4FBU A;  4CH0 S;  2BAB A;  5L1J A;  3QT6 A;  3PW5 A;  3QSI A;  5LJ5 Y;  2HS4 A;  2VPX B;  1VIX A;  5LSR A;  4LF6 F;  4YDX A;  2GMH A;  2CJY B;  4WE1 A;  2IIH A;  3M7V A;  4C0B A;  4ED0 A;  5LL6 d;  2ZZN A;  2F3J A;  1OJ4 A;  3GJR B;  2W01 A;  2LEB A;  1FDA A;  3MPW A;  2HPU A;  3B82 A;  2QSF A;  1T8E A;  4ZLL A;  2JFK A;  3OTC A;  1TUW A;  4XIU A;  4MMO A;  2RQM A;  5A8W A;  1X5P A;  3QRP A;  2AD9 A;  3B54 A;  3JTP A;  2JSX A;  5KTQ A;  1JLF A;  3MOJ B;  4DSI A;  1WG1 A;  4O3N A;  3BKT A;  1CJV A;  4IDK A;  3AB2 B;  2VA3 A;  5HP1 B;  2WW8 A;  3MTK A;  2VON A;  2J8A A;  3HX9 A;  4ILL A;  5JXS A;  3K0J A;  1D09 B;  4ED2 A;  3EIC A;  2DHX A;  1N88 A;  3ZZ0 A;  5JVH Q;  2JZ5 A;  1EAR A;  4ZVO B;  4NLW A;  5IQQ A;  2J8S A;  2HIY A;  4B3R F;  5THW A;  3GV7 B;  2DGV A;  5IZH A;  4YME A;  4IH6 A;  5ETM A;  2YPY A;  1FJ7 A;  1VS3 A;  4Y3C A;  1HNV A;  3ZXW A;  5KT2 A;  4FF4 A;  2Q66 A;  2IPO B;  4H4O B;  2V67 A;  4P74 A;  5AXM A;  3BR8 A;  4DQI A;  3IMQ J;  3U27 A;  3B8H A;  2RDJ A;  4FP9 A;  3EJM A;  4ZJQ A;  3ET6 A;  2H4Y B;  4WTY A;  2EK6 A;  3PRB A;  3BGL A;  2RAQ A;  4FYY B;  4B3S J;  5T41 A;  1GTH A;  1X7V A;  2Z0G A;  4LQ3 A;  4JI7 F;  4QWA A;  2FHJ D;  2DPJ A;  4K59 A;  3V4M A;  3D5M A;  4A8K A;  2G13 A;  3MDF A;  1DTQ A;  1B7F A;  4DZ6 A;  1CUL B;  2I8E A;  5ETQ A;  3IBW A;  1ICE B;  5D78 A;  1RTD A;  4ICL A;  1U1M A;  4KRW A;  4OI1 A;  2ADB A;  2W2M P;  4E0D A;  1KOO A;  2J9E A;  1TK0 A;  1TL5 A;  3HVT B;  1IQZ A;  9RUB A;  2IA6 A;  1LXJ A;  1Q5Y A;  5KFM A;  1H7W A;  1RWK B;  1SIZ A;  2W2O P;  5A0Y B;  4Q2L A;  3W2V A;  4X62 J;  3KG0 A;  4U67 Q;  3FC9 A;  2E29 A;  3MZI A;  3NCQ A;  3MCN A;  4HHH A;  3T9N A;  4QW8 A;  5IT9 Y;  2OIH A;  4USM A;  8ATC B;  1RYR A;  3M32 A;  1YK9 A;  4NE9 C;  3D1H A;  2WZ1 A;  2MPU A;  4C3M A;  1L5U A;  3CE8 A;  3THT A;  2DPI A;  1RE1 B;  3CD0 A;  4J9O A;  3GQC A;  4C2M A;  1Y5L B;  3UCZ P;  3HFK A;  2HHQ A;  3RAX A;  2PFF B;  5J2Q A;  4IH5 A;  3VF0 B;  1JLG A;  3MMA B;  2RSQ A;  3DLL Q;  4XDC A;  3RAM A;  3HMJ G;  1XN9 A;  1XR5 A;  3IXQ A;  2QLB B;  4WWS A;  4CT9 A;  2FY1 A;  1W2I A;  2KM8 C;  5HVH A;  1I94 J;  1A7G E;  3GIK A;  2GZO A;  4CLW A;  2D3Z A;  3RB3 A;  1BQN A;  4OIX A;  3ENV A;  1RXO B;  2E5L F;  2W1B A;  2Q6B A;  4FPI A;  9ATC B;  3AY0 A;  1IBC B;  3GFZ A;  2RB7 A;  4NOH A;  5F8H A;  4ECZ A;  4P6Q A;  4WK1 A;  1QSL A;  3OQ2 A;  2PEB A;  2J0S D;  4DPU A;  2QFI A;  2E1R A;  4QOT A;  1NDK A;  3JB9 k;  3BGR A;  3G96 A;  4LFB J;  3A3N B;  4ZPT R;  2MHN A;  1SIW B;  1V3Z A;  2Q6C A;  1XK8 A;  4J5O A;  2XGQ A;  2HHH J;  1DUR A;  4XO0 A;  4JV2 A;  2KL8 A;  2KRB A;  1VQL S;  1ZS6 A;  3MCM A;  2EC2 A;  4KGZ B;  2GVZ B;  3FEY B;  3EM1 A;  3BV8 A;  4QYZ J;  2ASJ A;  2PC6 A;  4DR5 F;  4AQY J;  2CXE A;  3QGH A;  1RSC A;  2OFH X;  4LUB A;  3W5X A;  1FKP B;  3BGO P;  2EBG A;  4DBQ A;  1VC5 A;  2GHP A;  2C28 A;  3IRW P;  3QGG A;  1MU2 B;  2RF2 B;  1KC8 T;  1PYS B;  1PIL A;  3MXH P;  4N76 A;  5J2N B;  2MQL A;  4IR9 A;  3FK4 A;  3V6H A;  2EFP A;  1S7H A;  1RCO B;  3ONQ A;  2ZNY A;  3MAA A;  4Q44 A;  1LWE B;  5DDR C;  2HG4 A;  3W62 A;  4TVA B;  4KY3 A;  1FWK A;  3UN3 A;  1LWC B;  3B4M A;  3SQG A;  2HNY A;  1O5J A;  3VAK A;  4Y28 C;  4OZN A;  1X5O A;  4HDH A;  3ZNJ 1;  3IM8 A;  1JLB B;  3TZZ A;  5D4P A;  3LH2 S;  1RTH B;  3Q8Q B;  2VC1 A;  4GVL A;  1VDH A;  3QJP A;  2PII A;  3E8O A;  1U1R A;  1RT3 B;  5KG1 A;  4Q43 A;  5CZV A;  1W26 A;  1HHQ A;  4DF4 A;  2HGN A;  4MT1 A;  4J9N A;  1H6K X;  4USI A;  4DR1 F;  3DM2 B;  3KMQ A;  4MTP A;  3NKY A;  3NS7 B;  4K4U A;  4KKO B;  2CQ3 A;  3N0V A;  2G9O A;  3HI9 A;  2CVI A;  3NBP A;  2NS1 B;  2LDI A;  4H4K C;  3OHB A;  1QD1 A;  2HWH A;  3M6U A;  4B3T J;  2WVE A;  5A76 A;  3DFE A;  4PUO A;  1NKC A;  1Q53 A;  2GX8 A;  2XSJ A;  2P5V A;  1JLA A;  4Y00 A;  3NEK A;  4AL6 A;  1EKS A;  2D7S A;  3DRY A;  2EWH A;  2BJE A;  5DZ6 A;  3CC4 S;  4CO3 A;  3D54 A;  1UPM B;  1X9S A;  1VQ4 S;  1TL1 B;  2VOP A;  2D74 B;  4KTQ A;  4TU9 A;  3RB6 A;  4ENO A;  2KVI A;  4KV8 B;  3K59 A;  5HAO A;  3NGR A;  4IYQ A;  5IQ6 A;  3HHE A;  4QPX A;  5FD1 A;  3KG1 A;  5U47 A;  3TAM B;  3CCM S;  1ZAX A;  2YQ0 A;  3S8S A;  1XTZ A;  4L73 A;  3VAG A;  3PR4 A;  1XNQ J;  4QIV A;  3N28 A;  2R8K A;  1SKU B;  2BDP A;  1YLX A;  3H40 A;  2R7T A;  3H5Y A;  5L46 A;  3ELH A;  3BJY A;  1N36 J;  3WDO A;  1FKA F;  2QRR A;  5HMY A;  2GVD A;  1QJH A;  5F0U A;  1RAD B;  1RAE B;  3KFW X;  5K8M A;  3TAQ A;  5H9F K;  3WC0 A;  1UPP A;  4OFZ A;  1FK9 A;  4ID5 B;  4I7F B;  2ADC A;  3S01 A;  1T0T V;  4YHH J;  3V5R A;  4DV0 J;  3POT A;  1V5I B;  2C2E A;  1SV5 B;  2V2Z A;  4OLO A;  1D1U A;  3GU0 A;  3PFO A;  5CYM B;  1QY7 A;  4F4W A;  2EFQ A;  3QWP A;  2MGZ A;  2IA0 A;  3VVU A;  4FYD A;  4LR7 A;  2DR6 A;  1T9X A;  3W66 A;  3Q89 A;  4EBD A;  3N6L A;  4PQA A;  1Y3K A;  3L9Z A;  4LF4 F;  3A8E A;  3LAM A;  6FDR A;  1S0V A;  4RR5 A;  4LFC F;  3QRR A;  2IVF B;  2OTJ S;  3X3U A;  4AL7 A;  2IVY A;  1VCT A;  3T6B A;  2UVV A;  3ZTR A;  4C9D A;  3LAK A;  1N34 F;  3DC2 A;  1N48 A;  2ERR A;  2DHH A;  2VG7 B;  2QL5 B;  3EGN A;  2AJQ A;  4FF3 A;  4NLQ A;  4DR4 F;  4DU8 A;  2ZC3 A;  1MG7 A;  4ZVP B;  5L1I A;  1IBM J;  1B70 B;  1N33 J;  3T5J A;  4B08 A;  1NJZ A;  3V6D B;  4QBU A;  3CCL S;  1KQG B;  3K17 A;  3IWN C;  2IDE A;  3NP5 A;  2QYG A;  3BQ1 A;  2XUL A;  3CD7 A;  3DLK A;  4MKA A;  1CVJ A;  1RWX B;  1RLD A;  1VRT A;  1Y7P A;  3OR1 B;  4ED3 A;  3HKZ D;  1S10 A;  1B0V A;  3TX8 A;  3RW6 A;  2XBP A;  2RRA A;  4UT4 A;  2WOM A;  2Y0B B;  2B9E A;  3FZB A;  1NK4 A;  3NL0 A;  2FZG B;  1VQP S;  3SCI E;  4LSN A;  2ACY A;  2AEF A;  3P8B B;  1S9E A;  4QYR A;  1F0X A;  3ETO A;  2BW2 A;  1XR7 A;  2DNK A;  5J1E B;  2R8J A;  1U6Z A;  4ZN1 A;  1HIY A;  4DX6 A;  3FMB A;  1RT1 A;  5K14 B;  4JI2 F;  1S9F A;  1HI0 P;  5KFJ A;  1FNX H;  2JHE A;  3ZTQ A;  1TL4 A;  3RTV A;  4DN0 A;  4P9S A;  4PG4 A;  2VG5 B;  4ECY A;  1SL0 A;  3LGM A;  5J1P A;  2WVC A;  3KMS A;  2YQ1 A;  1CS4 A;  3HSG A;  1JLQ B;  3SCL E;  3JSB A;  3MEC B;  4N56 A;  2HVI A;  1T7P A;  3CWJ A;  1FER A;  2YKO A;  1KSP A;  2YKM A;  3GFY A;  1XNR J;  1L3U A;  2EFN A;  2OAU A;  1P1T A;  3M8S A;  1IKY B;  5T7L A;  5KFD A;  4F02 A;  4CLZ A;  2X3G A;  5G0R A;  3G9C A;  2XO7 A;  4ZJO A;  2NZC A;  2CQI A;  1QSS A;  1GH8 A;  2CPD A;  1N5V A;  4B3O A;  2DH8 A;  3BDE A;  4JI8 F;  2A18 A;  1JQG A;  4F3O A;  4JI5 F;  3HDS A;  4DMZ A;  2OKQ A;  3AXM A;  2QMU B;  2YWE A;  3BB5 A;  2B8P A;  3RRH A;  2NQP A;  1Y10 A;  2I0X A;  5DM7 Q;  1S0N A;  1B64 A;  3VV2 B;  3DGP B;  1ITP A;  1EAY C;  1S1V B;  2B5J B;  2FJD B;  3TEH B;  3VHQ A;  4ZVE A;  2JL9 A;  2RDI A;  2CQC A;  2V68 A;  3GMG A;  4LF6 J;  4RW8 A;  3E2E A;  4ZPW R;  3CDB A;  2MZJ A;  2AJ1 A;  4LRE A;  4RW4 B;  4OI3 A;  2KYX A;  4CNY A;  3LQV A;  1RT7 A;  4OX7 A;  2MQM A;  1HW9 A;  2YNF A;  1N4L A;  4G1I A;  2BJ8 A;  1D9F A;  3MUM P;  3OVS A;  2FJX A;  1X31 C;  4O3P A;  2RVJ A;  2DXD A;  3QJJ A;  4WF9 Q;  3CJ5 A;  1HI8 A;  3I0R A;  4WFZ A;  2B9Y A;  4CYU B;  1EHW A;  4EO6 A;  2ZWP A;  3O2I A;  4OX9 F;  1Y5N B;  1FRK A;  4MIA A;  2UUT A;  3TWZ A;  2CJ9 A;  3FQL A;  4A8Q A;  3SI8 A;  1RBO B;  2CQ2 A;  3T41 A;  2MHE A;  2KI2 A;  2OO4 A;  4KPY A;  3DI6 B;  4DG1 A;  3UR0 A;  4TY9 A;  4FN5 A;  1GAO A;  4FS2 A;  4M5D A;  1HBM A;  4E98 A;  5J1N A;  1E6Y A;  1Y5I B;  3CC7 S;  5IT4 A;  3UD3 P;  2GGP A;  2H5I B;  3IM9 A;  4GKJ F;  4A4J A;  2Z2M A;  1S9G B;  4I68 A;  5HSP A;  1JLE B;  1X5S A;  2PT0 A;  1RUS A;  2KKH A;  2VPW B;  3EGZ A;  4WPA A;  2CDR B;  2C2O B;  4ZPC A;  3EPG A;  3TX0 A;  2XMV A;  1UFW A;  3PW4 A;  2NRE A;  4JI1 J;  3KJN B;  5LT5 A;  3EMT A;  1FE4 A;  3TAP A;  1RLC L;  3JQJ A;  1S48 A;  2QE5 A;  3OPK A;  4P7V A;  1S6U A;  2BAN B;  3BRE A;  3ZZT A;  3AB4 B;  1D9A A;  2UZA A;  3RBD A;  3T1H J;  4OJ3 A;  1MN9 A;  3FEZ A;  3D66 A;  3NWR A;  3WQP A;  1ZZF A;  2HHP A;  4CLS A;  2ZH6 A;  2VIH A;  1IR1 A;  1C0U A;  2DIS A;  5T14 A;  2UVU A;  3FDS A;  3CCW A;  1S59 A;  3BDP A;  4RNH A;  3HFV A;  3PTW A;  1X4G A;  3H2U B;  5B08 A;  1YKW A;  1RHQ B;  3R8Y A;  3GFX A;  4H4O A;  2YWF A;  1FRL A;  2DGX A;  4ZPA A;  3HSZ A;  1QUV A;  3OXF A;  3I5B A;  2ASD A;  3PZP A;  3CXC R;  5DZ7 A;  2UU9 F;  2ROE A;  3BBB A;  1NSK L;  4Q2M A;  4NCB A;  3TVY A;  3J7Y I;  4B9M A;  3W5Z A;  3UN2 A;  4ITS A;  4HI2 A;  2VBW A;  4IFY B;  2RML A;  2KZZ A;  2CQ0 A;  8AT1 B;  1T02 A;  1WEL A;  3GII A;  4USJ C;  2C1E B;  3MOZ A;  3VAI A;  2RRB A;  1U47 A;  1RHU B;  2GMJ A;  3PV8 A;  2Z30 B;  1TL3 A;  3P5B P;  4L75 A;  2B9X A;  1O6X A;  3E01 B;  4EEY A;  4PG5 A;  2J7W A;  2IC3 B;  4X2B A;  2ACM A;  1EET B;  3D6M B;  4YB5 A;  1CUL A;  1KNZ A;  2P9E A;  2VQE F;  2E7X A;  3HPO A;  1GEH A;  1IKX B;  3RJM B;  2HAF A;  4PQU B;  3KLV A;  4FXD A;  4TU7 A;  5BYR A;  1B0T A;  3VZI A;  5E41 A;  1R8H A;  2BQ3 A;  1OYE A;  4P10 A;  5E3A A;  2E5G A;  2D41 A;  2LQ8 A;  5IM0 B;  2VDI A;  5EGY A;  3AD7 C;  4KH0 B;  2H4W B;  1FD8 A;  3S7R A;  1HWU A;  4OX8 A;  3VCD A;  3GJT B;  3E3X A;  2XG8 A;  2ALY B;  4OYP A;  3KUE A;  4HKQ A;  3ILL A;  2HHX A;  2XHW A;  2XNR A;  4DFM A;  4K4X A;  1U0H A;  3H20 A;  3GYG A;  4QYZ K;  4HH1 A;  3V6J A;  1ACM B;  3TRG A;  2UUA F;  3TP2 A;  3MMA A;  2HHS A;  1KEK A;  1YI2 S;  3H2L A;  5B0F A;  4PPZ A;  4U9R A;  2J0Q D;  1WOP A;  2QSW A;  4YR0 A;  3KHL A;  4V1A k;  3FVY A;  1N0V C;  4MIB A;  1PCA A;  3KYL A;  1T9W A;  2J6U A;  4ZA1 A;  4WII A;  1X0P A;  3BS9 A;  1S76 D;  2KFZ A;  4ZCK A;  3BSC A;  2QLF B;  3EGV A;  4MKB A;  4HDG A;  4C98 A;  1OPI A;  4FVM A;  1U24 A;  4C8Z A;  1WHX A;  3DLB A;  4NYO A;  3FEX B;  5C7P A;  2KT3 A;  5DQI A;  2MKY A;  1XMQ F;  3DOM A;  4RW9 B;  3KLH B;  4DV6 F;  3SEO A;  4OJ1 A;  1OPZ A;  2Z2Z A;  3Q22 A;  3IFE A;  4MFB B;  3FMW A;  1FDN A;  3LW5 C;  2QT7 A;  2L9N A;  1EJ7 L;  1A9N B;  3M6X A;  1Y00 A;  3W61 A;  4BBY A;  1TZ0 A;  2FZK B;  5E3Q A;  4GKK F;  3BSN A;  3NNC A;  2OHD A;  2OP5 A;  4K5R A;  4NA1 A;  3NCP A;  4WZM A;  1MU2 A;  2RF2 A;  3EPI A;  2V2V A;  5J2N A;  2YNH A;  1S6Q B;  2GIQ A;  4IRK A;  2VFV A;  1QE1 A;  1ZAW A;  4LF5 F;  1C1B B;  3ISN D;  5SUH A;  1H0H B;  1GXU A;  1LWE A;  4CTA B;  3KTQ A;  3MI7 X;  1FI4 A;  2FVR A;  2XQC A;  5I42 B;  4Y2I A;  3I5A A;  2DRB A;  2OSR A;  2IY5 B;  2CPE A;  4DQS A;  3WBZ A;  4FS1 A;  3CUL A;  1RTH A;  2QTW A;  2KG1 A;  2IMW P;  5BXI A;  4CM0 A;  3VGV A;  1XQI A;  2D9P A;  2HFO A;  1NRK A;  3KK1 B;  1AZS A;  2KVQ E;  2PO4 A;  4WFA Q;  1AXQ A;  2LKZ A;  3PJW A;  5GAH U;  4QPT A;  3DN9 A;  3QFW A;  1GNK A;  2GIF A;  2VDH A;  2VKR A;  1YVF A;  4ZIW A;  3J7Z 5;  2CWK A;  3DM2 A;  2VH7 A;  3QYY A;  3WC2 A;  3ITH B;  2NPF A;  4ZHR A;  4CLP A;  1OQ6 A;  4USW A;  5C2C A;  3M2R B;  4BC7 A;  1MWQ A;  1F5B A;  1SKS A;  1ZM3 A;  2U1A A;  2ZDP A;  1V9O A;  4XPE A;  5KFC A;  2BE2 B;  3N6M A;  2X7I A;  1S97 A;  1FEE A;  2RT3 A;  4H4K A;  4CIO A;  3KDO A;  4JV5 J;  3DMJ B;  2Y8Y A;  5KFF A;  2ZKT A;  1HPZ A;  1TKX B;  1WC1 A;  4C8L A;  3VWS A;  4WJB A;  4LF4 J;  1ZM9 A;  3NGS A;  3SBM A;  3MM6 A;  1RTJ A;  5GAE I;  2PMZ D;  3MPY A;  3GON A;  4DR3 F;  2DGU A;  1HQ2 A;  5KFS A;  1N34 J;  1KN6 A;  2LLZ A;  2DVI A;  4KV8 A;  2HHV A;  2KH9 A;  1GFW B;  3OV7 A;  4J9P A;  4TY8 B;  4DR4 J;  4RUA A;  3TAM A;  2QMW A;  3THP A;  2Q79 A;  1Y0H A;  1SUQ B;  3DYA B;  3UVJ B;  3A3P B;  3QO9 B;  2XI3 A;  2H51 B;  2DCL A;  1UW4 A;  2QX0 A;  1WC5 A;  4KHM A;  2UXC F;  5KFY A;  4OYO A;  3IAM 9;  1IJE B;  1HL6 A;  1YGY A;  2HK3 A;  1I6J A;  3HT3 A;  4DV2 F;  1TL7 A;  1NDL A;  3BGF A;  2C22 A;  5AE2 A;  3QNW B;  3ZZP A;  1NB2 A;  5HK4 A;  1JNZ B;  3SV4 A;  3T9Z A;  3BO2 A;  1Q1K A;  3C2P A;  1X4F A;  2FJE B;  3MEG B;  4ID5 A;  2BJ7 A;  4OHX A;  4UQG A;  2ZJQ Q;  2R7X A;  3IO1 A;  3V6K A;  2IM1 A;  1J5E F;  3RBE A;  1SV5 A;  1OSD A;  3GSD A;  2HUR A;  5BYQ A;  1RKJ A;  3M2V B;  1WTF A;  2GFF A;  1KVI A;  4KHP F;  3SZ2 A;  1MWY A;  3CJT A;  5CYM A;  3DLG A;  2R7O A;  3WX8 A;  1S77 D;  4GRS A;  4UY8 T;  5LSL A;  2GO9 A;  1PJ5 A;  3UW1 A;  1JXL A;  3HUL A;  2HVD A;  5GAD I;  3D6F B;  4IFV B;  1VQ9 S;  2XMM A;  4E2F B;  3M8W A;  4LF1 A;  4DR7 F;  2K7K A;  3EX7 B;  1JJ4 A;  4YS2 A;  1U26 A;  3R9L A;  2VC0 A;  4OYB A;  3KNA A;  4ED1 A;  2VG7 A;  4L3N A;  1KQK A;  3V4I B;  1K8A T;  1XC9 A;  4RO0 A;  1S6P B;  4TYB A;  3A8J A;  2HND B;  3I0S B;  4DV5 J;  2KU7 A;  3SSQ A;  2CNN B;  2ASL A;  2R42 A;  2M8D B;  4I4B A;  5D3G B;  5HMZ A;  4JP8 A;  2W9A A;  1VQ6 S;  4R0J A;  2ZVI A;  2LP4 A;  5LMN F;  3GIR A;  2M0G B;  2MKJ A;  4LIW A;  4C0O C;  1X9W A;  4ECW A;  3HZE A;  4JI8 J;  4JI5 J;  1FX4 A;  4OYX A;  2VV5 A;  1IXK A;  2CPX A;  2HBY B;  1FVS A;  2FTR A;  3EZU A;  4LR9 A;  3OR1 A;  2ZE2 B;  4QWC A;  3QT8 A;  4NPO A;  3OFH A;  1VK3 A;  4IOC Q;  3S6E A;  2DGW A;  2BXJ A;  4M5J A;  1Q4R A;  2FHK A;  1NDP A;  3DLH A;  1QVF R;  4BC9 A;  1FXL A;  2J6S A;  3JQK A;  2DJW A;  3IWL A;  2OTL S;  2MKI A;  1RHM B;  3MR2 A;  2W4D A;  2KXF A;  4I67 A;  2R8I A;  2AHO B;  3QLH A;  5A8K A;  3NLC A;  1RA6 A;  5KFW A;  4USU A;  3TUZ C;  5J1E A;  1M1K T;  1S5Z A;  2U2F A;  3TJ9 A;  4I1T A;  3L3C A;  4Y2K A;  2EG2 A;  1NHV A;  3K5N A;  3Q8U A;  1TKT A;  2DGO A;  1N8R T;  1B4S A;  4NCG A;  3ZTS A;  2F4V J;  2AV5 A;  3BKF A;  1RJJ A;  4U8V A;  4XDD A;  1MRO B;  4Z7Y A;  3CJ4 A;  4C3K A;  4ANE A;  4OX9 J;  5EUH A;  4C11 A;  1JLQ A;  4G1Q B;  1KOH A;  3W3S A;  3MEC A;  2Z8Q A;  1FFW B;  1VGY A;  3NGU A;  3PFE A;  2EKY A;  2MYF A;  3L4B C;  1KLM A;  1OY9 A;  3K5O A;  1KWM A;  2QLJ B;  3PYE A;  2ZH4 A;  4ZP8 A;  4C0H A;  1FHT A;  4M5N A;  2OEM A;  1IKY A;  4K4S A;  1U2F A;  2EK1 A;  2MDA A;  5I3P A;  4B3S F;  1RAF B;  4UZB A;  2DBB A;  3TOQ A;  4YOE A;  4EGL A;  3Q2T C;  4DLE A;  5KFU A;  2C2R A;  2XMU A;  3H5X A;  3QMQ A;  4RL1 A;  2XYP B;  1U09 A;  4DR6 J;  1CBK A;  3LP1 A;  1MWZ A;  4ECT A;  4AT1 B;  3J7Z T;  2IYI A;  3JS9 A;  3KWM A;  2M5Y A;  2MEW A;  3GSI A;  3GE9 A;  3DGP A;  1FES A;  1S1V A;  1JXV A;  5IV4 A;  2I5J B;  1S4E A;  1XWL A;  4PYA A;  5IV3 A;  2CIM A;  2FZC B;  2C3Y A;  5D0H A;  3CPW R;  2HQ3 A;  5D0R A;  4CZC A;  1UZD A;  4PG6 A;  2MLY A;  3M8P B;  5LJ3 Y;  4ED4 A;  2OPS B;  2FGC A;  4JBC A;  2VD3 A;  4LIR A;  5CAA A;  4ETX A;  4RW4 A;  3KK3 B;  2BM0 A;  2G0C A;  1UKU A;  2IAJ B;  2F65 A;  4NLO A;  5KG5 A;  4RLE A;  5CD4 H;  4N7T A;  2QYC A;  1HNI B;  4L6V 3;  1MML A;  4X4V A;  8RUC A;  1F5A A;  2SXL A;  1VQN S;  2YKA A;  3R97 A;  2G4B A;  5IS2 A;  4NLR A;  4O4R A;  2PDA A;  3MM5 A;  4CYU A;  3DRR B;  2CKW A;  3G82 B;  3K5M A;  3MPV A;  3PW2 A;  4U7C A;  2YY3 A;  2CQ4 A;  2LFV A;  1JWW A;  4HT7 A;  3C6T A;  1LXN A;  3MCS A;  2M7S A;  3BZQ A;  4MK8 A;  4ES3 A;  2K06 A;  4ZPB A;  3EE3 A;  4ZVF A;  4CDI A;  4IG0 B;  1V5V A;  1OQ3 A;  2MZR A;  2GCF A;  2YWK A;  1FRX A;  3KLI B;  2AW0 A;  3PX0 A;  3G4S S;  1I94 F;  4QW9 A;  3MMC B;  2UUW A;  3JSR A;  4WP8 A;  4XPC A;  2HVZ A;  1UWB B;  3R5A A;  1W2B R;  1RBL A;  2ZVS A;  3DRS B;  4YFU A;  4DUY J;  1JNR B;  2Q3P A;  4ZVS B;  3KDN A;  1NK6 A;  5EN1 A;  3BF4 A;  4DLG A;  2JC1 A;  2UU9 J;  2Z4P A;  1S9G A;  1JJH A;  1Y9O A;  4QQB A;  1VBX A;  4DFK A;  1R6V A;  4C6A A;  3QZ7 A;  2CQD A;  4F0H A;  3GJQ B;  1CQN A;  3HM9 A;  2D3U A;  1L3S A;  3TA1 A;  1PAE X;  3I4P A;  4N47 A;  5FDL B;  2VBY A;  4ECX A;  3QJL A;  5IOL A;  4ER8 A;  3D6T B;  3D3C J;  3CJK B;  1U49 A;  1DBD A;  1R8B A;  4CNZ A;  2ALZ A;  5J2M B;  2ZBP A;  4GVB B;  2LXU A;  4PYD A;  4F3M A;  2VQE J;  1S79 A;  1YJ9 S;  4EFA C;  2PEH A;  1SKW A;  2CRL A;  2WBR A;  1ROF A;  2BAN A;  2GAH C;  3PXG a;  3BM7 A;  4LRF A;  2BOP A;  5BR8 F;  1WKK A;  2Y1J A;  1UEK A;  3K8W A;  3Q8S B;  3OR2 A;  2MSS A;  4OZ0 A;  4F4Y A;  4FYX B;  5KFV A;  4DS4 A;  2OEL A;  3KXD A;  2JC0 A;  3WIV A;  2XMA A;  4DS5 A;  1LW2 A;  1R89 A;  2RH3 A;  4WP3 A;  5DQH A;  4NLP A;  3NMR A;  2OPQ B;  1O0P A;  1LW0 B;  2IBO A;  5ETP A;  3PX4 A;  2XSF A;  3IP0 A;  5AJ3 F;  1N5Q A;  3DU5 A;  4J9R A;  3N79 A;  2HVH A;  3ZNU A;  4QWB A;  4JB8 B;  2RS2 A;  1GK8 A;  2ABY A;  4NWB A;  1R0A B;  1NPR A;  2HGM A;  3ZTP A;  3OUY B;  1WEY A;  4PG8 A;  2IC3 A;  4M5I A;  3TZX A;  3JTO A;  1PAU B;  4ZLP A;  1R27 B;  3DHX A;  1J27 A;  1PSD A;  1YZ6 A;  4OHW A;  4PQU A;  1T95 A;  3R27 A;  3UDC A;  1XMQ J;  1K0V A;  1UA0 A;  5C24 B;  1N56 A;  2NYH A;  3WX4 A;  1QSY A;  2EI5 A;  4A8S A;  1VRU A;  3KUG A;  4C8M A;  2LYV A;  2MKH A;  4X65 J;  2VIC A;  1AUS L;  2F63 A;  2CZ9 A;  2JDJ A;  4CP5 A;  2CG4 A;  4F7V A;  3FGV A;  2OD6 A;  1VR6 A;  2YWH A;  2AJ4 A;  5IM0 A;  3BH6 B;  1HNX J;  4X66 J;  5F3Z A;  2GHV C;  4DHV A;  2M52 A;  4RX6 A;  1M5K C;  1RWM B;  4F4A A;  1HQE B;  1WOS A;  1MW7 A;  3CNQ P;  1KFD A;  1CJT B;  3RBZ A;  4WU3 A;  5CA5 A;  2ZD1 B;  2M70 A;  1YRU A;  2XMJ A;  1XNQ F;  4ES1 A;  5K8P A;  2E1A A;  3A13 A;  2A0F B;  5L38 A;  3O6Q A;  2HQG A;  2R7W A;  2MQ8 A;  3CME S;  3PIP Q;  2XZD B;  2HRY A;  1WEZ A;  3RR8 A;  1H98 A;  2M8H A;  1TR0 A;  5B0A A;  5CCM A;  3I4H X;  3R7N B;  3MEE B;  1X9M A;  3K89 A;  3PJ9 A;  2R3V A;  2E7W A;  3DLE A;  2VOD A;  3G71 S;  2YH0 A;  2BBE A;  4ZP7 A;  3R3T A;  3W9I A;  5GMK a;  4JI3 F;  1WF1 A;  2XO6 A;  3N4W A;  3I9V 9;  1RHR B;  3DU6 A;  1N6Q B;  1YJR A;  4OZ5 A;  3CCJ S;  2P2C B;  2I9S A;  2JJ4 D;  3M1V B;  2RE1 A;  3UQS A;  1VMB A;  2PD1 A;  3VAF A;  2ZOM A;  3KLH A;  1IBL F;  3OSN A;  4NLX A;  5D15 A;  1ZM4 A;  2JRS A;  3J7A N;  4MFB A;  3VAM A;  5GMD A;  1QM9 A;  4YDD B;  3LGH A;  3B4D A;  3G8S A;  1FWP A;  5F0W A;  3OFF A;  2HSE B;  3BR9 A;  2MQP A;  2Y1L B;  4NYZ A;  1REG X;  5D0E A;  2BQU A;  1LV5 A;  5EWE A;  1WC3 A;  2VAS A;  4ED6 A;  1WTB A;  3M9M B;  1LEO A;  4H4M B;  1ZPW X;  1JLC B;  3ZFV A;  4WIQ A;  2YNI B;  4G3I A;  1IBM F;  4ECU A;  1S6Q A;  5KT5 A;  3HLU A;  1N33 F;  4K4T A;  1CEZ A;  1T3N A;  4F2S A;  3GIL A;  4DL0 C;  4I6A A;  1FJG F;  1RU1 A;  2AEM A;  2V94 A;  2ILY A;  4PAA A;  2V4J A;  1WC6 A;  2AX0 A;  1AYE A;  1HQU A;  2DKO B;  2V8V A;  2N3O A;  1DTT B;  4DCO B;  2XMK A;  1HHS A;  1KON A;  3K57 A;  3CIM A;  3MM8 A;  4IOA Q;  3FSI A;  4JI6 J;  2OLW A;  3HD2 A;  1RTI A;  3IA0 A;  1KHW A;  2VU5 A;  3BKU A;  4C3L A;  2DNQ A;  2A1B A;  3M8Z A;  1MSW D;  3PYD A;  5E5N A;  2PGC A;  2IHR 1;  3NCR A;  2W9C B;  3KK1 A;  1IJF B;  4EBC A;  5AXL A;  2V50 A;  3TJA A;  3LP0 B;  2XWX A;  2WON B;  3ITH A;  2DGQ A;  4HT5 A;  1WDT A;  2GC8 A;  4OI4 A;  3J81 j;  2BJD A;  3BBC A;  2JEF A;  2VPZ B;  1VQO S;  5C42 B;  4TKT A;  1U0S A;  2XLI A;  1IWG A;  2BE2 A;  4B9L A;  1S99 A;  4OYM A;  2CJX B;  4EK2 A;  4KHP J;  2V8P A;  3EDQ B;  1RHK B;  4C7Q A;  2W8L A;  1HBO B;  3DMJ A;  1B0P A;  3MD1 A;  3EYZ A;  4A8O A;  4JI4 J;  1XNR F;  2EVZ A;  4QR2 A;  1M5P C;  2AGQ A;  3G6E S;  2GQC A;  4DR7 J;  3UR3 C;  3CJ8 A;  3Q24 A;  3AT1 B;  1WJ9 A;  4KJI A;  3VQT A;  1MN7 A;  5DO2 A;  5A2Q Y;  3Q8R B;  1I51 B;  1URR A;  4I6Y A;  1CSJ A;  4DQR A;  5JVG Q;  4ED7 A;  4G65 A;  2C2K B;  1D8Z A;  4TY8 A;  3TI0 A;  3TYT A;  3FQK A;  2GJF A;  5KT3 A;  2CPF A;  3OBI A;  4HTI A;  4LRA A;  2FVS A;  1SUQ A;  4N41 A;  3Q0A A;  3UNY A;  3KHR A;  3HHN B;  4AL5 A;  4IQX A;  3MF5 A;  3ILO A;  1FXD A;  2W7A A;  3MUR P;  5IXU A;  5LMN J;  4CO0 A;  2F8M A;  5H9E J;  2MJN A;  4NAS A;  3FBE A;  3K5L A;  1T05 B;  2DNZ A;  2X1F A;  2PI4 A;  3ZZU A;  2H65 B;  4DX7 A;  2RQK A;  4NLV A;  3MFI A;  2HYI B;  2W8K A;  4ERD A;  1UEU A;  3MM9 A;  2UUB F;  3DOK B;  2HRT A;  1YJN S;  1P1L A;  3MEG A;  4LT6 A;  4USK A;  2CDQ A;  1Z4U A;  2KXN B;  5EX0 A;  4NZ0 A;  1WAC A;  3SV3 A;  3AOA A;  2DNH A;  2RRN A;  2LDY A;  4IDK B;  3TR5 A;  4DV3 F;  2FJW A;  2O3D A;  1ZH5 A;  3TEG A;  3W63 A;  3TUI C;  2BMB A;  4KSE B;  5ADZ A;  1ZBT A;  3OHA A;  2WVB A;  4IFV A;  1GXT A;  3HSD A;  4DV7 F;  3CJR A;  1RYS A;  2DIU A;  3PYG A;  4CWB A;  1GQE A;  3DXS X;  2AJ2 A;  1N0U A;  4K0K J;  2MKS A;  3KLE A;  1U4B A;  3DNC A;  1LFW A;  1PIE A;  4ZJL A;  2AMC B;  1KFS A;  3PHT A;  4QR0 A;  2HBR B;  3RRK A;  1S6P A;  1QAY A;  1IVZ A;  2HND A;  1K73 T;  3MD3 A;  2V9W A;  2DR9 A;  3PY8 A;  1PC5 A;  4K50 A;  4X64 F;  3DRP B;  1WC4 A;  2IM2 A;  2A2D A;  3AFG A;  5J2P A;  3T6J A;  5HMW A;  1M1H A;  2MZQ A;  1EKR A;  4J9U E;  1YBU A;  3H25 A;  1TVR B;  3OXL A;  2PA8 D;  2R7S A;  2ZJR Q;  1FF2 A;  1VBK A;  2GIR A;  3C6U A;  2DEI A;  2HIQ A;  2B4P A;  4JI1 F;  4DPX A;  2DHA A;  1JIH A;  3EUN A;  4RPF A;  1BE4 A;  2QO3 A;  4NCA A;  2ZE2 A;  1Q16 B;  5CZX A;  4ICL B;  1UTA A;  1TEL A;  3GYN A;  2RIJ A;  1D9D A;  2VFT A;  2YWW A;  4C4W A;  4UOF A;  2ASY A;  4ZDN A;  4DDF A;  3T1H F;  2V2Q A;  1K1S A;  3JXO A;  3PX6 A;  1VQ5 S;  3G2X A;  3IGV A;  4UF4 A;  1FNO A;  4K4W A;  4HR2 A;  4WFB Q;  3LP2 B;  2L41 A;  2HS0 A;  2EXU A;  3GJS B;  2JH3 A;  3PIO Q;  2C3P A;  2Y1I A;  4M95 A;  2CWX A;  1F9F A;  1GMU A;  5HVG A;  5FLX U;  3LOU A;  3SQO P;  4P2X A;  5L1K A;  5I3U B;  2B8Q A;  3OTO J;  3TA0 A;  3M32 B;  4AXI A;  2QLX A;  3PRD A;  4G1Q A;  4X4S A;  2G0J A;  4P73 A;  2R2T A;  2ZNZ A;  2EPI A;  1YSJ A;  3ZTO A;  2MKK A;  1CC7 A;  4Y2A A;  4ZPD A;  3P4U B;  1TFW A;  1SCJ B;  2X3D A;  1ZOT A;  2POK A;  4PKD B;  4HAC B;  5KFT A;  2B51 A;  4KPC A;  5KG0 A;  3NOG A;  1SB6 A;  4KT0 C;  1QAI A;  4A47 A;  3D68 A;  1M5V C;  2GHW A;  2ZZT A;  4ZP9 A;  4WYL A;  3O5T B;  3PG9 A;  4U7U K;  4JI0 F;  1PKU A;  4LSZ B;  4RW6 A;  1RBA A;  1VC6 A;  4EMD A;  4F4Z A;  3MM7 B;  3QAU A;  1L3K A;  2W7O A;  2I5J A;  5GAG I;  4ZOS A;  3EZ5 A;  2F40 A;  1U1K A;  4RU9 A;  4Z7C A;  4CT8 A;  1WF0 A;  3SFG A;  3M8P A;  3BGR B;  1Q5V A;  2DXE A;  3HP6 A;  3D9B A;  2VA2 A;  3KK3 A;  1JK9 B;  1Y4Z B;  1DQA A;  4ZIV A;  4F4K A;  2NUH A;  3MMJ A;  4DI6 A;  1HNI A;  1M5H A;  5MAO A;  2DB1 A;  2EEY A;  2N3L A;  4FXV A;  4WKY A;  3HKW A;  2EKN A;  2NPI A;  2BRL A;  5KFA A;  1VIS A;  2ZOG A;  3R5B A;  2V34 A;  2L9D A;  3DRR A;  4AXJ A;  1GXL A;  5F8I A;  2K8G A;  3G82 A;  1IWA A;  4F26 A;  1V3S A;  5BR8 J;  4B9U A;  1RT2 A;  3Q8V A;  3D67 A;  2NUU G;  1S4F A;  4WKR A;  1YIJ S;  4C8N A;  3P96 A;  2KN4 A;  1O51 A;  4ZVT B;  1I1G A;  2CPH A;  1RKI A;  4DR2 J;  2KHD A;  3MED A;  3AD8 C;  2DNP A;  3AQP A;  3T5K A;  3MR3 A;  4FYW B;  3KLI A;  3OLA A;  3HF5 A;  4UOC A;  2HHU A;  1SH0 A;  1YZ7 A;  1NKE A;  1HA1 A;  1SVD A;  3MMC A;  4EU0 A;  3HO1 A;  4KGM A;  2VKZ G;  3R2C J;  3SQG B;  3CDU A;  4B3M F;  4EI2 A;  4J9Q A;  2JWN A;  1J5O B;  3DRS A;  2GS8 A;  3T5L A;  3PYF A;  1NK7 A;  2FPH X;  1HKA A;  2DTJ A;  2G2O A;  3E51 A;  4O0I A;  5AJ3 J;  2XZW A;  4HL9 A;  1F6T A;  1XR6 A;  5F41 A;  4ZVR B;  1IR0 A;  4OYW A;  2LA6 A;  2O01 C;  1VQ8 S;  1S0M A;  4IRD A;  3V2U C;  4ILM A;  5D4O A;  3C16 A;  3SSS A;  5HJX A;  2CG8 A;  4B9S A;  2DYA A;  3CJK A;  5F8M A;  4PAB A;  4ZS6 A;  4FZV A;  3UD5 A;  2DGT A;  2AWZ A;  3KLF A;  2NXJ A;  4Y2M A;  1GMV A;  3CMQ A;  3PJX A;  2J7K A;  5DET A;  2O67 A;  4UOG A;  2KT2 A;  2M9K A;  3G87 A;  4NZ6 A;  1NAQ A;  2DO0 A;  2FLN A;  3BPD A;  1WG4 A;  1G3O A;  4UQT A;  3QGI A;  2N4D A;  3DXB A;  3RAQ A;  4AND A;  2MMY A;  3UCG A;  1C4C A;  1OO0 B;  5IC4 B;  4ILR A;  4GO7 X;  5E33 A;  3CO0 P;  4TLQ A;  1HMV B;  3NXZ A;  5KFO A;  1VQS A;  4FF1 A;  2ZFH A;  5LMU F;  4J37 A;  1I5O B;  3GG0 A;  2V5H G;  4CLF A;  2ZUA A;  3TAR A;  4F25 A;  1DFD A;  4DL6 A;  4ED8 A;  4LVO P;  5HLF A;  2BJ3 A;  3N5B A;  2RJZ A;  1FJE B;  3D2W A;  2H9Z A;  3BEG B;  3QT5 A;  2OPQ A;  1LW0 A;  5KT6 A;  2AYG A;  1F3V A;  3HSJ A;  3V81 B;  2VFU A;  2UXD F;  3RU0 A;  5ETK A;  3D0H E;  4KR0 B;  3OL7 A;  1WC0 A;  2WTF A;  4DSK A;  2VBZ A;  4A8Y A;  1VC0 A;  2YQ3 A;  1R0A A;  5EWG A;  3L09 A;  3CF5 Q;  2N7C A;  4DCJ B;  1S1X A;  5I3Q A;  4JI3 J;  2LEA A;  3OUY A;  1FK9 B;  4Y2C A;  1VJW A;  4CLK A;  1DLO B;  3Q86 A;  4IOB A;  2R2S A;  4NI2 A;  4UZC A;  3MFH A;  3POT B;  1I3O B;  1RWN B;  3LPY A;  2FLO A;  3LUY A;  1HLW A;  4IG3 B;  1HHT P;  3I6P A;  2OEJ A;  3NGK A;  1PGZ A;  4JV5 F;  1T94 A;  1M5S A;  1OWX A;  2KT5 A;  5M2P A;  1X4A A;  1O8B A;  1IBL J;  5C24 A;  7AT1 B;  2FDN A;  4NA3 A;  4FPR A;  1YRT A;  5E3C A;  1EX8 A;  3PR5 B;  4USV A;  3ZO7 A;  2ZM6 J;  1XEZ A;  5HN0 A;  2XNQ A;  3L7U A;  5KT4 A;  4OV6 A;  1WHY A;  2AYM A;  2ZH3 A;  2A2C A;  1EZZ B;  3EWG A;  4LF7 F;  4DSL A;  3GB0 A;  1U02 A;  1HQE A;  1VOM A;  3OL8 A;  4LF8 F;  5EX3 A;  1CJT A;  3GIM A;  4PPD A;  1M1G A;  2HWI A;  2ZD1 A;  3BYR A;  1FKO B;  6AT1 B;  1G1X A;  1FJG J;  2J76 E;  3CJ0 A;  2VG6 A;  1WI6 A;  2XLK A;  2ZBI A;  5M2U A;  1WSV A;  5D4N A;  3H5U A;  2FJV A;  3FBC A;  2R7R A;  1Q8K A;  1TKD A;  4X4O A;  4OL8 A;  4P75 A;  4KBI A;  2OPR B;  4NXN F;  3PDN A;  3TNV A;  2VPY B;  5KFL A;  4PWD B;  3NNA A;  1Y3J A;  1S1W B;  1T9V A;  4LFA J;  2Z57 B;  1N6Q A;  2I1R A;  3C8Y A;  3QAT A;  2G2Y A;  2XEX A;  3M1V A;  1AUD A;  3J81 U;  4GMK A;  1FJC A;  1SQE A;  4C8Y A;  2W4P A;  2PE8 A;  3LTO A;  2CJB A;  2VOO A;  4NLY A;  4OZ1 A;  3M8R A;  2GNK A;  2FLP A;  4O3Q A;  1RT1 B;  5A8R A;  4ZCL A;  4MJK A;  2FJA B;  1FFG B;  4AUK A;  4YB1 P;  1UVK A;  3CGI A;  4Y34 A;  4ZCM A;  3TUJ C;  4X4Q A;  5C25 B;  2HMI A;  2WCX A;  1FO1 A;  2XYH B;  1BQM B;  4JV1 A;  4YR3 A;  4H4M A;  2R7V A;  2FC8 A;  4J91 A;  1R0C B;  1UJ4 A;  5AE3 A;  1HYS B;  4DL3 A;  2YNI A;  3J7Y U;  4DV5 F;  1SC4 B;  2Z2Y B;  4CO4 A;  4ZLN A;  2MST A;  1OS5 A;  3GCW P;  1KR4 A;  1WG5 A;  4RZR A;  2IM0 A;  4ZP6 A;  3R2D J;  4URS A;  1HI1 A;  1AA1 B;  1TU0 B;  3PM9 A;  3PW0 A;  3GIJ A;  1JJC B;  2O1P A;  2N82 B;  4B3O B;  3AA8 A;  1NSA A;  2OPP A;  1NBE B;  4OQJ A;  1SJQ A;  1KDN A;  3HHL B;  3VGT A;  3K8V A;  1MLA A;  1LKZ A;  1U6B A;  5KG7 A;  4L74 A;  1SKR A;  1VHF A;  1GTE A;  3M4X A;  2W9C A;  1KHV A;  4FNI A;  2MLZ A;  2C3M A;  4QZV B;  4PXE A;  1R7I A;  3QGP A;  4CH7 A;  1FEH A;  3LP0 A;  2UUB J;  1ZM2 A;  1J2V A;  4YY3 F;  2WON A;  2OUG A;  4Q45 A;  4ZVG A;  2HEK A;  5H9E K;  2YNF B;  1JXE A;  2RU3 A;  2F4V F;  5C42 A;  2LXI A;  1UAW A;  2FYX A;  1Q7Y T;  1DHM A;  2IRX A;  3RYL A;  3HVW A;  4DV3 J;  3I0R B;  3QBC A;  2LQ9 A;  1HBO A;  5CYQ B;  4GO5 X;  4JOU A;  3OVB A;  1WF2 A;  3BSO A;  2M3D A;  2VQF F;  3D28 A;  4DFP A;  4ALZ A;  1ZET A;  1YJW S;  2AYB A;  3HCX A;  3LA0 A;  2E1M C;  4DV7 J;  1E6V B;  4B9N A;  5DRK A;  1FRM A;  5DG8 A;  4IRC A;  2PMW A;  2WRM A;  4WYW A;  4M5D B;  4C8O A;  3OTE A;  1HBM B;  1G4C A;  3FFI A;  1UVN A;  2K3K A;  4TQS A;  3VZH A;  4DR6 F;  1A6L A;  4PRF A;  2PA3 A;  3Q8Y A;  4M1K A;  4EO8 A;  4X64 J;  2PSZ A;  5L1L A;  2D9O A;  4L76 A;  2CQG A;  3L7P A;  3D0I E;  5F9L A;  1PBA A;  2Y3Y A;  3H4D A;  3BQ2 A;  1EQM A;  5MLC V;  1T05 A;  4F2R A;  3CIZ A;  3P49 B;  2WK4 A;  3O8W A;  4NYP A;  4KO0 B;  3MPD A;  1UWA A;  4DPY A;  3M9N B;  5DJB A;  2V8D A;  3IR7 B;  4DQP A;  1W25 A;  2KTQ A;  4XAK A;  4OHZ A;  4IKA A;  4J9L A;  4HHU A;  3DOK A;  4Q7A A;  2GJ2 A;  2VZ9 A;  3QQC D;  4Q0B B;  2BE9 B;  2YX1 A;  2R2R A;  2VBX A;  2DNL A;  3TZY A;  5AXN A;  3C15 B;  1NSP A;  5JUM A;  5HP1 A;  2J6T A;  2AZ3 A;  5LXY A;  4OZ2 A;  2XCA A;  5K8O A;  2BM1 A;  3EXC X;  3HD1 A;  3SDE B;  1WSR A;  5KFE A;  1C0U B;  2WB4 A;  3N6N A;  4ETZ A;  5ETT A;  3G6X A;  3P5T L;  4M63 A;  2HW3 A;  4MIW A;  2IYG A;  4DV1 J;  1VQK S;  5HAN A;  4NLD A;  4UW2 A;  4IH7 A;  4YB6 A;  1ZPV A;  5KFG A;  2R8H A;  1EP4 B;  2YVS A;  5KFH A;  3EVW A;  3RZA A;  4C48 A;  2JEG A;  2DEJ A;  4DUY F;  3N5F A;  4L72 B;  3ZZR A;  5HQ8 A;  2BRK A;  2B0G A;  1TAU A;  2XYG B;  3DRP A;  2LQ5 A;  3MWB A;  1U8S A;  3OW2 R;  2BKO A;  1TTH B;  4Q8E A;  3CED A;  1B7Y B;  4FVC A;  3D1O A;  3TUP A;  2WBM A;  4Y6I A;  2GML A;  1CG2 A;  2V6A A;  3SFU A;  1TVR A;  1BD6 A;  1TUV A;  4JI0 J;  4PXB A;  4N77 A;  1TL3 B;  3ISZ A;  3PRV A;  1KRP A;  2P6T A;  3C14 B;  1F1B B;  2KRR A;  1JKH B;  5D77 A;  4NLG A;  1X4H A;  4BWJ A;  3A8K A;  3L95 X;  3RRG A;  4K4Z A;  3PEJ A;  2OMO A;  1RI7 A;  4DOZ A;  3VTI A;  2YKN B;  3T1Y F;  3HVT A;  2AEJ A;  4BDP A;  2BE7 D;  2W2P P;  2KDO A;  5GAE U;  1ZA2 B;  1YX2 A;  1SQF A;  5A0Y A;  2MXY A;  3M2U B;  3DDN A;  2CYY A;  3LP2 A;  1PJ6 A;  3D3B J;  2GQQ A;  3CD5 A;  5F8J A;  4DUT A;  5M2R A;  4ZVU B;  2RUG A;  2Y1R I;  2XM3 A;  5IT0 A;  3H2V E;  4G1P A;  3GCX P;  1RA7 A;  2WVF A;  3SIP B;  2FY8 A;  1HWI A;  3GR0 A;  2VHG A;  4K7Q A;  5I3U A;  2WSF C;  1R8C A;  2XY7 A;  3W65 A;  4LR8 A;  2IBK A;  2RU9 A;  3ILI A;  2XS5 A;  3H59 A;  1RAC B;  1OY8 A;  2MQN A;  4M5H A;  5E7O B;  2UUC F;  1U0H B;  4YN3 B;  4R25 A;  2YH1 A;  4P72 A;  1C0T B;  4HAC A;  2HS3 A;  4IO1 A;  4P71 A;  4PXD A;  2HBQ B;  3AD9 C;  3NAH A;  1NK0 A;  4C8K A;  2CPY A;  2W9B B;  1GMW A;  3R5G A;  5ETS A;  4B3M J;  3ENA A;  2DHG A;  4WU2 A;  4G6V B;  1FD2 A;  2B4O A;  1BMQ B;  2KM8 B;  3ZC4 A;  3MM7 A;  4ZIT A;  3UN5 A;  1HFE L;  1N54 B;  4HYK A;  2BVZ A;  1YBT A;  1HR0 F;  4OX6 A;  3HVA A;  5GAD U;  3ZZY A;  3JYT B;  3G8Q A;  1VLY A;  4IR1 A;  3DOM B;  1DZ5 A;  5HQM A;  3FCV A;  4X65 F;  2BR0 A;  3Q2S C;  2C42 A;  4URG A;  2DCU B;  4GC6 A;  2DNN A;  1HNX F;  4X66 F;  2DH9 A;  2R8G A;  2GVZ A;  3OVA A;  4WP9 A;  3OTD A;  1A0O B;  5HRO B;  3IBF B;  1UFK A;  3C19 A;  2XS2 A;  4NLS A;  3HJF A;  3LAL A;  1T9U A;  3D1Q A;  4ZVH A;  1Q86 T;  1FKP A;  3T3F A;  4RUC A;  3NY0 A;  5FLX Y;  3W1Y C;  2DR8 A;  3B6B A;  3BYP A;  2AX1 A;  2QG9 B;  4LBH A;  4NXM F;  5A2Q U;  5IC6 B;  3DKD A;  3MR7 A;  4URQ U;  3UI3 A;  2VFR A;  2YNH B;  3RGI A;  4MK7 A;  5LMU J;  3W64 A;  4RU2 A;  1NSQ A;  1NEE A;  5EHH A;  1QE1 B;  3D7S B;  4CLL A;  4NMX A;  1WOR A;  5K5M A;  2VUG A;  1FE0 A;  1KQS R;  1LWC A;  4U95 A;  1D8Y A;  4B9T A;  4CM2 A;  2D3O 1;  2PFD A;  2A10 A;  2JVR A;  3OXG A;  1JLB A;  4RWX A;  1J5O A;  3DOL B;  2K1R B;  1Q0N A;  1HBU B;  1UZH A;  2P6S A;  1BQX A;  1HWK A;  3TZW A;  4MAK A;  2UXD J;  1T9Y A;  4OMF G;  4O23 A;  1U7L A;  3HZG A;  3I56 S;  1RT3 A;  4R8U B;  1AZS B;  4DQQ A;  1REV B;  3OFG A;  2A6M A;  3A12 A;  4KGV B;  2WSC C;  4KKO A;  1CJU B;  4LF2 A;  4ZHR B;  4QIE A;  2JX2 A;  4NA2 A;  1PBU A;  2MZT A;  4PWU A;  2B43 A;  2HLU A;  3GFH A;  2QJ3 A;  4DV4 F;  2XTJ P;  2CNK B;  3G8T A;  1UP1 A;  3M8Y A;  2CNO B;  5KFI A;  1TFY A;  3Q8P B;  1RT5 B;  3TO8 A;  1IUJ A;  4B9V A;  2N4C A;  2CQH A;  3W8G A;  2DRD A;  2NXE A;  1LOU A;  1HPZ B;  3K2Y A;  3CW2 C;  4KAI A;  3IAS 9;  1L3V A;  4J9M A;  3NGT A;  3U7J A;  2B56 A;  3TJ8 A;  3FKB A;  4V19 X;  1F2H A;  1TL1 A;  3MM6 B;  3Q83 A;  1RTJ B;  2JLF A;  2V9K A;  5CAB A;  2AIR B;  1TAQ A;  2DNR A;  2ZHB A;  2IFX A;  4I56 A;  3MAH A;  1HMV A;  2DR5 A;  4LF7 J;  3WIU A;  4KIA A;  4RBV A;  2IJN A;  4AFF A;  4ZLJ A;  1ELO A;  5KFR A;  1RWO B;  1YJ7 A;  2MQO A;  4LF8 J;  3TQ1 A;  1F60 B;  2XLJ A;  4W92 B;  5KG3 A;  1BXN A;  1B3T A;  4JI6 F;  4MYU A;  4ID8 A;  6FD1 A;  2R4F A;  1X4E A;  4ZKA A;  1S0O A;  1NO8 A;  1XMB A;  2RDD A;  5BYS A;  5HBM B;  3V81 A;  2VF3 A;  3R6G B;  2KXH A;  4FF2 A;  1TL7 B;  1DQ9 A;  2HFS A;  3HXM A;  4I6W A;  3P45 B;  3SMZ A;  3KLG B;  4I7F A;  2YTC A;  2LMI A;  4NXN J;  3JAM U;  3J80 U;  4ELT A;  2DNO A;  2RUS A;  1CJK B;  1UVJ A;  1KD1 T;  1DLO A;  2V69 A;  5B0G A;  2W2N P;  3MMB B;  2BZ2 A;  1XJW B;  3IRX B;  2V0N A;  4IG3 A;  2HQC A;  4ANC A;  1H72 C;  3VQS A;  3CMA S;  3M6V A;  2AGP A;  1IR2 A;  2Z56 B;  4X84 A;  5DDO C;  3VR1 A;  3DLG B;  3KHH A;  4HLB A;  4M5K A;  3BBF A;  5A6P A;  1IM4 A;  2NYI A;  2ZH1 A;  4I0W A;  4JI4 F;  1VFJ A;  3CCE S;  2J9D A;  2GJI A;  4HH0 A;  2DD8 S;  1F9E B;  3A8I A;  3RG6 A;  1SL1 A;  3H42 A;  3R5D A;  4NML A;  1R3N A;  1NK9 A;  5L9X A;  2HGL A;  4KYZ A;  3AXK A;  1Q82 T;  3UDV A;  1TV6 B;  5E3R A;  1SJF A;  2BYC A;  2P9G A;  4J7C A;  4RBU A;  3TVK A;  1FKO A;  5KOW A;  2JLE A;  3V6D A;  5IWA F;  3KG4 A;  5CCL A;  1XMO F;  4EZ6 A;  1TK5 A;  2E9Z A;  4O0N A;  3NRB A;  2IDL A;  3MGJ A;  2RD5 C;  2XHC A;  1OSC A;  2PI5 A;  2HFV A;  2ZIT A;  1PYO B;  4HEA 9;  4PXC A;  4F67 A;  1K44 A;  4WFX A;  3RB4 A;  5FII A;  2ZHO A;  1FT8 A;  2LEC A;  2BJ9 A;  1ZYQ A;  2XY6 A;  1QUP A;  3CDW A;  5A6W A;  2OPR A;  2HKE A;  4CCH A;  2AJ0 A;  3M6W A;  4A8X A;  2E7V A;  4O4G B;  5F9N A;  2FVQ A;  4PWD A;  2RHQ B;  1S1W A;  2X1G A;  2DH7 A;  2H54 B;  4DX5 A;  2YX7 A;  1S72 S;  4OZ3 A;  4KH1 B;  2W2Q P;  2GV1 A;  4DPW A;  2WHO A;  1U25 A;  3QFH A;  3GV5 B; 
#chains in the Genus database with same CATH homology
 3CNQ P;  3SQO P;  2W2M P;  1SPB P;  1R6V A;  4NMX A;  3VHQ A;  3A3N B;  3A3O B;  3AFG A;  3GCW P;  4NE9 C;  4YN3 B;  2XTJ P;  3CO0 P;  3WIV A;  2Z2Z A;  2Z58 B;  2ZWP A;  2QTW A;  2Z56 B;  2E1P A;  3WIU A;  2W2P P;  4JP8 A;  3A3P B;  3GCX P;  1SCJ B;  2W2Q P;  3VV2 B;  2ZWO A;  2Z30 B;  2W2N P;  2Z57 B;  3P5B P;  2PMW A;  4K8R A;  3WHI A;  3BPS P;  3BGO P;  1ITP A;  1V5I B;  3H42 A;  2W2O P;  3QFH A;  4OV6 A;  3T41 A;  2Z2Y B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...