1SPJA

Structure of mature human tissue kallikrein (human kallikrein 1 or klk1) at 1.70 angstrom resolution with vacant active site
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
238
structure length
236
Chain Sequence
IVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWVLTAAHCISDNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENRQADEDYSHDLMLLRLTEPADTITDAVKVVELPTEEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKILPNDECKKAHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNKPSVAVRVLSYVKWIEDTIAENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.70 A X-ray structure of human apo kallikrein 1: Structural changes upon peptide inhibitor/substrate binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Kallikrein 1
total genus 59
structure length 236
sequence length 238
ec nomenclature ec 3.4.21.35: Tissue kallikrein.
pdb deposition date 2004-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1spjA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1spjA01
2Q1JA 4IGDA 3E3TA 2AYWA 1QIXB 3UNRA 1EP5A 4ZKNU 1EAIA 5DP8A 3EYDA 1WYKA 3RXDA 4Y8ZA 1GVZA 5JBBS 1A1RA 4YM9A 1DM4B 1VCQA 3MTYA 1NU9A 1G3DA 3HK6B 2V0BA 1H9HE 2A0QB 3FAOA 1S85A 3SV2H 2ESTE 5G4BA 1ZSKA 2CHAB 7LPRA 2W7UA 2G51A 9LPRA 5LPFA 2STAE 4ZXYH 1T4UH 1XKBC 4U30A 1F0UA 3L6PA 1WTGH 2ZDKA 2Y5FA 3FVFB 1D9IA 2WPLS 1V2ST 4ABJA 5FPTA 1EPTC 3P8NA 1QBVH 4FUEA 1G32B 5L2YH 1NM6A 1NZQH 1F92A 2IJOB 1BITA 2Z9LA 4NZLA 1O3HA 1RTFB 1MTVA 1ELAA 1TX8A 1YPGH 1C1NA 2WV4A 2GTBA 5CHAC 4THNH 1CBWC 2PV9B 4AG1A 2QN5T 4GCHF 1D3TB 4K8YA 1LMWB 5EW2H 1KLTA 4NIWA 1LHEH 1GI3A 5HMAA 3S9AA 1LHCH 2RA3A 3A8BA 2VIOA 5EU8A 3M35A 1MCVA 4XBCA 1MTNC 1A3BH 4X1RU 1UHBA 1GBFA 2B8OH 1SGPE 4KTSA 4MNWA 1JRTA 1GI7B 1AHTH 4B75A 3PLKA 1BB0B 1T31A 3KGPA 3MOCA 4GAWA 5B6OA 2RDLA 2XBYA 3RXOA 1LVMA 1EKBB 3F9EA 4GCHG 5I25A 1V2WT 1V3XA 5F03A 3PROA 3ZZ9A 2XBVA 2F83A 1BJVA 1AO5A 1HPGA 1YPKH 2H2ZA 2Y5GA 4ABDA 4DIHH 2SNWA 4ZH8A 1H1BA 1WQVH 2VJ1A 3KHVA 1FY5A 2G4TA 1SLVB 2Q6DA 2VH0A 1RRKA 1UCYH 5JYIA 1C5RA 1KY9A 1XUIA 2EA3A 1GBCA 4RKJB 2ULLA 5E2OA 1C2MA 1V2QT 1O2VA 1CU1A 3ZV9A 1IQFA 5F8ZA 4YTAA 3L33A 3A7XA 2OINA 2A4RA 2P59A 2WPKS 1IAUA 3SJOA 1LVYA 2BXUH 3M3VA 1O3JA 1KTSB 4GLYA 3RMNH 3GY8A 3T27A 3PMAB 1ESBA 1DFPA 1IOEA 2ZQ2A 5DKMA 4NIVA 1THRH 1O2TA 4DVAU 1CT0E 1O2WA 1MU6B 3GY5A 2QF3A 2BDYA 4GHTA 2GT8A 1O36A 1V2NT 3T25A 3VXFH 3STIA 5JBCS 1GMHG 1D3PB 1G9IE 1BDAA 1Y5BT 2BY6X 2ZU2A 1QGFA 1F0SA 1ZGVA 1EOJA 4X0WU 4Y0YE 1GBEA 3KQCA 3PWCA 2ZDAH 4CBNA 1UVOA 1HFDA 2QXHA 4RKOB 1FXYA 4ZAEA 3PM3A 2IOTA 3UTUH 1VGCB 3BG8A 2B5TB 3LGYA 1HYLA 5BRRE 1VCWA 5LH8A 1CBWB 1TA2A 2JKHA 1FZZA 1QR3E 1CHOG 1O3CA 3SW2B 4AGJA 2UWPA 4X8VH 4AB8A 1ZR0A 1Q3XA 3RDZA 3DD2H 5GIBA 2FYRA 4XSKU 2A5IA 1GJDB 2WUBA 3FZDA 5LGOA 3GOVB 5C1XA 1EPTB 1DY8A 4GSOA 2W3KA 4Q7YA 3RXKA 2P94A 3A88A 4B2CA 1UMAH 5DP7A 1C5LH 2BY8X 1MBQA 4A1VA 5CMXH 1QJ6B 3HATH 1UK2A 3TJNA 2HLCA 3CENA 2A5AA 4A5TS 4B2AA 3DA9B 1TBRH 1P10A 5JBAS 2BX4A 2XC4A 1SGRE 1C5UA 2QYIA 3SV9A 1MKXK 2CGAA 1D3DB 1Z8GA 4AYVB 2WUCA 2A31A 3K9XB 3LOXA 1S5SA 1E35B 1SBWA 1W3CA 2BXTH 2ZEBA 3CS0A 2Z9KA 4SGAE 1MTNB 3LGTA 1P9SA 3RC6A 1CE5A 1C4V2 1FN6A 3TITA 1UVPA 3CP7A 4CRDA 2BM2A 4K5ZA 2Z6BD 1NROH 3IG6B 2ZECA 2ALPA 2ASUB 1Y59T 3RXQA 3SJ9A 3VEQB 3BTWE 4WH8A 5C2ZA 4BOHA 3TH4H 1H4WA 5EPNA 1TABE 3QDZB 3QZRA 1GPZA 1VCPA 2FS9A 4KTCA 1SI5H 1C5SA 2GVFA 2P3TB 1SFQB 2BDBA 5FCKA 6CHAB 2H5DA 1MUEB 3K6ZA 2ANYA 1C5MD 4QT8C 2BZ6H 1DSUA 1HAIH 1QB9A 1W11U 3NK8A 2ZA5A 1EPTA 2UUJB 1UVSH 1GBLA 3H7TA 3P8FA 5SGAE 1GMHF 1SOZA 4ISLA 2ANMH 1V6DA 2RA0A 1TONA 2TGTA 4YT6H 1W7GH 3RXGA 1MQ5A 2H9TH 1SHYA 2WPJS 3K6YA 2FLRH 3EGKH 1YPHE 2OTVA 3E0PB 5AFZH 1NN6A 3S69A 3SUDA 1MH0A 1MBMA 2PSXA 4AB9A 3TH2H 4K2YA 1HJAC 2AGIX 1DE7H 3SNAA 3RXHA 3F1SB 3LDXH 3O8RA 2FXRA 3ZZ8A 4JK6A 2ZIQH 4JZDH 1UVTH 5IDKA 1PQ8A 3LGUA 2AIPA 4JYTA 3B8JA 4FU9A 1INCA 1SGDE 4IC5A 3ZZAA 1LDTT 1MKWK 3A86A 1P3EA 1TPOA 5T6DA 3BTDE 3MO9A 3TJVA 1IQEA 1YP9A 1FMGA 3RXRA 4PROA 1LHFH 1O39A 3GCTG 3U8RH 1MTUA 3D65E 1SLWB 3S9BA 1EB1H 2HPPH 2ILNA 5JB9S 4AORA 2BD5A 2GT7A 3A7YA 3M5NA 1NRNH 1ZMNA 2CF9H 4O9VA 4Y11E 3V7TA 1O2GH 2O8LA 3QK1A 1W0ZU 2B9LA 4FUFA 3MNXA 1HAHH 1XUGA 5GJ4B 2GGVB 2D8WA 5EW1H 1BTPA 4WH6A 1D6RA 1C5ZB 3IWMA 2ODPA 2R2WU 3BTTE 2BDCA 1O2IA 2GX4A 3PLPA 1LQEA 1O2RA 1MKXH 2BQWB 4LOYH 1BBRE 4CBOA 1WAYB 2ZHEH 1BZXE 1MAYA 1TBZH 1EZUC 2P93A 1L0ZA 2XRCA 3ZVFA 2FOEA 1T8OA 3VXEH 2GZ8A 2BD9A 1GJAB 3PMBB 1V2RT 3SJIA 4WXVA 2TPIZ 1OKXA 1FY4A 2FI5E 3MWIU 2FIRH 1EZSC 3O8CA 4CRCA 3MH7A 4JZ1A 4BTTB 2Z9JA 2THFB 3SO3A 3PMJA 1C5VA 4MPXA 3A81A 4Y8XA 1GI0A 1Q31A 2A4OA 2BQ7B 1O0DH 3SU0A 2K1QA 3MU5A 5GCHF 3Q77A 4ABBA 5A0CA 4NSVA 2BD7A 2EI6A 3SN8A 1C9TA 3M37A 1CO7E 1EOLA 2GMTB 1UTOA 3TIUA 2AERH 1HDTH 5DP5A 3DFJA 3SOSA 1J8AA 1BBRK 1DDJA 2NWNA 3RU4D 1DS2E 1FUJA 1DXWA 1DT2A 3RXSA 2Y82A 3GCHB 1D3QB 1C5YB 1TOCB 3DUXH 1SL3A 5A8ZA 3RC4A 5T3HA 2J4IA 4ZKOU 3AAVA 5A0BA 1GBJA 2ZHDA 1JIMA 2AIQA 1GBDA 1Y5AT 4E7RG 4IMZA 5E8EH 2NU1E 2ZCKP 3BTME 2ZHWH 1DOJA 4GVUA 1TGSZ 4Y71A 3S7HB 5A2MH 2C8ZB 4FU8A 2QAAA 5GXPA 1PYTC 1LO6A 2BTCE 1Y8TA 2FX4A 1WOFA 3A8CA 3SQHE 4BNRA 2OLGA 2ZZUH 1THPB 2OC0A 5BPEA 3ITIA 4A1TA 1QRWA 4SGBE 2VINA 5L30H 1AKSB 3VB6A 1GHBF 1WTHD 4NA9H 2PLXA 2PHBA 3LH1A 2G8TA 4ZXXH 4DG4A 3M7QA 1GBIA 2HPQH 1C5OH 2XYAA 1LPKB 4HTCH 5FX6A 4GUXA 1LKBA 4JMYA 1TALA 1ELCA 7GCHG 2BHGA 4UFEH 1SGYE 5C5NA 1K1JA 2ZDVH 1F2SE 1YM0A 2WPMS 4E05H 1BA8B 1HJAB 4MPVA 5J4QA 3NKKA 3P95A 1A0HB 1S83A 1GMCG 1PPFE 1AZ8A 1UTLM 3BN9A 3ENSB 3N7OA 4WMEA 1OP2A 1PQ5A 1C1VH 1A5IA 1O3AA 4X6NA 3GY3A 2AFQB 1BMLA 2PSYA 1O31A 4JZIA 4A7IB 2ZF0H 1ZSJA 1KXDA 3BIUH 2Z94A 3QN7A 1TRMA 4DW2U 4LZ1H 4O03A 1MCTA 2W5EA 2BD4A 1YPMH 2ZQ1A 3UWJH 5DO4H 1G36A 2I6QA 3HKIB 3MNCA 1C4Y2 3MNSA 9ESTA 4BAKB 2KAIB 4RN6A 1N6YA 1CA0B 1NFUA 1O2QA 2BLOA 4AX9H 3TU7H 2F91A 5F8TA 3KEEA 2O9QA 3A7VA 4HI3A 4NGAH 3T5FH 3SU6A 1JXPA 3SGAE 1K1PA 1V2TT 2STBE 3A8DA 3Q3KA 2ZGJA 4BAMB 2FLBH 1THSH 4MDSA 3E0NB 1H9LB 3ATIA 1FN8A 2SGEE 2FTMA 2DE9A 3M7UA 1O3KA 3A82A 2J38A 1O2OA 1W10U 4WWYA 3SI4H 1HV7A 2SGFE 1QL9A 2PW8H 2ZFQH 1A2CH 3E8LA 4ZROA 4BXWA 3UR9A 1F5LA 1XVMA 1EXFA 1GHXH 2PUQH 4I8KA 4INLA 1EP6A 3RXPA 2PWXA 1C5WB 2OP9A 3NCLA 2ZTYA 1K21H 2ZHQH 4XDEA 1PPGE 8LPRA 1ARCA 1AFQC 1GHAG 4NA7A 5AHGH 2G00A 1NRSH 3SU4A 4F4OC 3BSQA 4UFGH 2UWLA 2TRMA 2J94A 4ZHLU 4YESB 3LGVA 1SGQE 3H7OA 4J1YA 4FUJA 2AS9A 2ZGBH 4X2XA 1BTXA 1EB2A 1F0RA 1Q2WA 2FS8A 4Q7ZA 3SBKA 1WCZA 2GDDA 1ZMJA 3GICB 1TAWA 5GCHG 1HUTH 2FODA 2R2MB 2PKAB 3R0FA 5L6NH 1CGJE 1FIWA 2PUXB 1ZTLA 4IN2A 1ZHPA 1GHYH 2FOHA 1O5BB 1GL0E 1YPLH 4CRGA 1K9OE 4AFUA 3MMGA 1CGHA 1MTWA 3K65B 4ABAA 1DWCH 1A5HA 4KGAA 3RXFA 1NU7B 1ZRKA 1GDNA 1AUTC 3DHKH 2O8WA 3RXTA 4ISNA 3TLOA 3W95A 2ZDMA 4NFEA 1BTYA 2C4FH 3NUMA 4NZQA 3SZNA 2UUKB 3ZZ7A 4Q7XA 5A0AE 1LPZB 1T8LA 2FOCA 3HPTB 1IQJA 3TNTA 3I77A 2VWOA 3LKWA 1WSSH 5E0JA 1A7SA 1PJPA 1G3EA 1C2HA 4KTUA 1P2NA 1Z71A 3EE0B 1GBAA 4IBLH 3ZZ6A 3ZVBA 1IQKA 4CR5A 1C1UH 4AN7A 2AMPA 3ZZ4A 5EOKA 1QRZA 2JH6D 1HIAB 4I8LA 1QQUA 3SI3H 4BANB 1B0EA 1OWEA 1RIWB 2A7HA 1HCGA 3RUOA 1YBWA 3A87A 1GDQA 3A85A 2Y7XA 2VH6A 2ZDLA 1TNLA 1O2XA 1V2UT 1AFEH 1GI1A 1OWKA 3BV9B 2VVVA 4M7GA 4XBDA 3OU0A 3T2NA 2CF8H 1ANCA 1Y3VA 5HXFA 1XXFA 2G52A 4MNVA 2GZ7A 2SGAA 3ELAH 3F9FA 2FWWA 3A8AA 4B76A 3GDSA 1GCDA 2OBOA 1IQLA 2NU4E 2FESH 1AY6H 2JH5D 1EATA 1WV7H 1O3FA 2FDAA 4CRFA 1ZPCA 2A4GA 1N1LA 2YOLA 2ZU1A 3O8DA 4AZ2B 3MH4A 1P2MA 1O32A 2ODYB 1IQHA 1EAUA 3MYWA 3VB3A 7ESTE 1DLEA 4NWLA 3M36A 1AZZA 1FQ3A 1ZRBA 1QL7A 1SQOA 3V12A 2FEQH 1GI6A 1KLJH 2QXGA 1A3EH 2ZGHA 3TK9A 5F8XA 5GPIB 3SORA 3AVZA 4Y76A 4OS4A 3EA7A 2BVSH 4BTUB 1AVGH 1J15A 1QTFA 1ZOMA 2NU2E 1XUKA 1AFQB 1O37A 1TMTH 4K60A 3MH6A 3DT0H 1HNEE 1LPGB 1QB1A 2ZNKH 3HKJB 2GP9B 4ISOA 1UTQA 2HVXA 1T8NA 1O2SA 3RXEA 3URDA 1SOTA 5DPAA 4TWWA 1O2HA 1WQSA 1S0QA 4R8TB 3RLWH 2ZU5A 4B1TA 3EQ0H 1DITH 2XBXA 1GJ4H 2FTLE 3ATMA 4FU7A 1V2KT 2Y80A 3PO1C 1O3BA 4JK5A 3GCTF 5FX5A 1O5GH 2V35A 4CR9A 5JDUB 4U01A 1TGCA 1JOUB 4XFQA 4HFPB 5DP3A 1UJ1A 2A7CA 3A84A 1YGCH 2C93B 1AE8H 4OGYA 2FOBA 2BVRH 3SU3A 2H9EH 1UK4A 2D26C 1GMDG 1FPCH 1ZLRA 3QTOH 4ZKSU 1SGEE 3OYPA 1AVWA 2BLVA 1P04A 8KME2 1SGNE 4K3JA 2VU8E 7GCHF 1V2MT 2OXSA 2ZKSA 5T6FA 2GMTC 2VNTA 3P8OA 3SUEA 1W7XH 3D23A 1S6HA 2EC9H 1Z7KA 3U8OH 3SNEA 1FV9A 2QY0B 1BIOA 3HK3B 2W7SA 3TGIE 1ELFA 1IQNA 4I8HA 1S0RA 2ZPRA 2H1UA 5DP9A 1HJ8A 4K1TA 3SNDA 1DLKB 1BT7A 1QURH 1Y5UT 1NPMA 3AW0A 2ZGCA 3SJ8A 1P2QA 3MFJA 4B71A 1Z6EA 1OPHB 4AFSA 1A61H 1RIWC 2EI8A 1QBOA 2QC2A 4Y8YA 3PO1B 2P3UB 2A32A 4X6PA 5C67A 2FO9A 2ANKH 2XCNA 3U9AH 3RXCA 1OYTH 1P11E 1C2DA 2FOAA 2GCTC 1LCYA 5TCCA 1TGBA 4LXBH 5L2ZH 1AN1E 1PQAA 1CHGA 5C3NA 1HAYB 3AW1A 4YT7H 2H9HA 3OY6U 4F49A 2BVXH 3KL6A 5JPMH 1LQDB 4MNYA 1ZJDA 3LT3A 1PFXC 1FDPA 4HGCA 2J9NA 5F6MA 2SGPE 1SHHB 3VB7A 3TVJB 3LC5A 3NXPA 5EXMA 3RXLA 3BTKE 4UE7H 4OS1A 1TIOA 1ARBA 1S81A 5A8YA 2CXVA 1DICA 5AF9H 1BHXF 5EXLA 1EJAA 1FAKH 1F7ZA 4BAQB 1FI8A 1TRYA 1IHSH 2YNBA 1XUHA 3ZZBA 1O38A 1B5GH 3LJOA 4UD9H 1C2GA 4NG9H 3P17H 1ZMLA 1HXEH 2ZCHP 3U1IB 1QL8A 2BDGA 4WXIA 1EJNA 1OS8A 1BTWA 1D4PB 1C2FA 3RLYH 1TA6A 4KELA 2F3CE 1AUJA 4CREA 1ANEA 1C5NH 3RXMA 3E6PH 5J4SA 2ZPSA 4ISIH 5H4IB 1PPHE 5EODA 1C5XB 2EEKA 1C1OA 1QB6A 3UNSA 4CH8B 1QHRB 1CA0C 2QGRA 3PV4A 1O2JA 1YLCA 1P2KA 4ESTE 3E1XB 5DG6A 2ZTZA 1SPJA 3VGCB 1G2LA 1RTKA 2A7JA 4I7YH 3EA9A 4XOJA 2XC0A 1W0YH 2AMDA 2R3YA 4O3UA 1GHWH 2UWOA 2JETC 2BLQA 1L4DA 1QNJA 6GCHF 1V2JT 3KN2A 2ZFSA 3ZZ5A 1GVKB 4Y7AA 1HXFH 4D7FA 1ZGIA 5ESBA 2XTTB 2Z3EA 2DE8A 2SGDE 4WY3A 1FNIA 2F9VA 1MZAA 4FUHA 1K1OA 1CVWH 4DCDA 4MNXA 5FAHA 1GI9B 1XUJA 3MH5A 1GJBB 1PPZA 4YOGA 1XKAC 2P3FH 1C1RA 4YO9A 1C5PA 1TMBH 4VGCB 3GY6A 1C1PA 1GCTC 6CHAC 1GI5A 3ZZCA 1GL1A 3EA8A 1H8DH 3G01A 1C5TA 3RXUA 3KF2A 1KTTB 1HJ9A 2A5KA 3BF6H 4ISHH 1DWDH 3EAJA 1UTMA 1DUEA 1YCPK 3F68H 3ZVEA 4E7NA 2XWBI 2XNIA 3BG4B 2AH4X 2TBSA 1P06A 1W2KH 3SNBA 3D62A 3QGJA 5DGJA 2OQUA 2HNTE 2Z9IA 5DP6A 3HGNA 4NIYA 2CN0H 2PGBB 2A1DB 3Q3YA 5LPRA 1N6XA 1SGFA 3KNXA 1U6QA 1SLUB 3RMLH 1WBGB 2ZTXA 2ZU4A 1PPBH 1Z8JB 3C1KA 3FP8E 4XBBA 2WINI 3QUMP 3MO6A 8GCHF 1BUIA 1V2VT 1GHZA 2HWLB 4X1QU 3H5CB 1OSSA 3QLPH 2Q6GA 5DJ7A 2QV1A 4K8BA 1AB9C 3TJOA 1C2JA 4BTIB 1O2YA 1P09A 2A45B 2PTCE 2HGTH 4X8UH 1EJMA 4A6LA 2BYAX 1GMCF 1TPSA 2R9PA 1RXPA 1SG8B 1MMJN 1RGQA 1S6FA 2VIQA 4ABIA 3UWIA 1KXEA 1Z8IB 3ZVAA 4CHAC 3OSYA 1L1GA 1MAXA 3JZ1B 1C9PA 4NCYA 1O2LA 3AASA 2ZG0H 1SGTA 3QWCH 5K7RA 3FP7E 4UFFH 4YOIA 1UCYE 1ETTH 1OX1A 3RC5A 1TLDA 1C2LA 1LVOA 1W14U 1NT1A 1O3DA 2I6SA 3PTNA 2GCTB 4TPYA 1FY3A 1K2I1 5LPEA 3TGJE 1Z6JH 4WMDA 2ZC9H 2FZZA 4OS7A 3LH3A 1XX9A 5K0HA 2G4UA 3M5MA 3V0XA 3SNCA 1LTOA 3LGIA 3U69H 1F5KU 2ZCLP 3M5LA 1CSOE 2WYGA 1SMFE 1QFKH 2OUAA 2BD3A 1GMDF 4DURA 3KQDA 1PQ7A 3LGWA 1TWXB 2Y7ZA 4INKA 3K2UA 1OYQA 3VPKA 1EAXA 2G55A 5E0HA 2G5NA 3SV6A 5A09A 3Q3XA 4X2VA 1TMUH 2C3SA 1LVBA 1OWDA 1B7XB 2GDEH 2WYJA 3WY8A 1ZPBA 5HGGA 3ATLA 3RP2A 4YLQH 4MTBA 1ELVA 1E36B 1C4U2 1JIRA 5EQSA 3UREA 3VFEA 2ZO3H 5HM9A 1PYTD 2Z3CA 4O97A 1O3NA 1P03A 2VVUA 2SNVA 1UCYK 1EAWA 3B23B 4NFFA 1UTPA 4X1NU 1X7AC 4J2YB 3KQEA 4X6MA 8GCHG 2ZU3A 2HNTF 1C1SA 3MHWU 2G5VA 2XBWA 5CHAB 4IS5A 2CV3A 3TH3H 3P70B 4TWYA 5EGMA 1ESAA 1KDQA 2XC5A 1O3MA 1O35A 4HZHA 2TGDA 4ZHAA 2FOGA 1CA8B 3ZZ3A 1C1MA 1S82A 2PKSC 4FVDA 1G2MA 4D9QA 1ESTA 5EQRA 5PTPA 2O8UA 3PMHB 4BAHB 3UPEA 1DANH 1O5EH 1GWAA 3SV7A 1A5GH 1BTZA 1A0LA 1QA0A 1UO6A 2LPRA 4YLUA 1WUNH 1SFIA 3ODDA 4OS6A 2BQ6B 1ACBE 2F9NA 4MPWA 1SLXB 2VWNA 1GDUA 5EG4A 1O34A 3T26A 1O3IA 1DPOA 1RS0A 1G37A 5FHTA 1T4VH 4KP0A 2A2QH 4K1SA 3Q76A 1KDQB 1YCPM 1Z8RA 3M7TA 4NA8A 1FIZA 4X8TH 5FPSA 4ABHA 4A92A 3BTEE 3UIRA 1L2EA 4E06H 2QIQA 4I33A 1NC6A 1QJ1B 2XCFA 2BDHA 1N8OC 1PPCE 1O33A 1TFXA 3UR6A 4D7GA 1BRCE 1VJ9U 3ZZDA 1LKAA 5T6GA 2O8MA 2IN2A 3ESTA 1IQGA 3M3TA 4ZHMU 3BG4C 2C90B 2BDIA 4AFQA 2BX3A 3E91A 1TQ0B 4XE4A 2XW9A 2VGCC 1GI8B 4DIIH 3TGKE 3RU4T 1F0TA 3BIVH 1J9CH 4UDWH 1ORFA 2ZHFH 1NY22 3RXVA 3LC3A 1HAGE 1XM1A 2HALA 4JZEH 2VVCA 3TK6A 3LU9B 1O5AB 2P8OB 4OGXA 5HM2A 1TQ7B 3LIWA 1NFXA 1TOMH 1Y3XA 1TE0A 1JWTA 1MQ6A 2F9UA 2QXIA 3PB1E 4CRBA 4UEHH 1OP8A 1AWHB 3TPIZ 1EASA 3SJKA 1AKSA 2VIWA 2Y6TA 4DT7B 2OCVB 1DSTA 3KQBA 2VIPA 2RG3A 2VIDA 1GBHA 3UFAA 1Y3WA 4Y6DA 1HGTH 3BEFB 1NO9H 4X6OA 1BMAA 4FUDA 5FBEA 4CHAB 2A2XH 2ODQA 1WU1A 3QX5H 4OS2A 3LONA 1AE5A 1QJ7B 1FONA 2M5TA 2CJIA 1CQQA 3GISB 5JBTA 3B9FH 2NU3E 1E37B 4UFDH 3TNSA 1TX6A 1L1JA 2OC8A 4GPGA 1RJXB 4O3TA 2WPHS 1UK3A 2ZFRH 2QCYA 2GV7A 1TX7A 1O2ZA 4IN1A 3C27B 3OTJE 4X1SU 4MG3A 2CMYA 3QZQA 1BQYA 4LK4A 4FXGH 2C8WB 4VGCC 1KSNA 3BTGE 1B0FA 5C20A 1IQIA 1BTUA 1DY9A 1UTKA 1YC0A 1ETSH 3I78A 4Y0ZE 1N8OB 1MTSA 1BBRH 1ZHRA 1ABIH 2RCEA 2AGEX 1GGDC 3UNQA 1FPHH 1O30A 1XVOA 5E2PA 5FBIA 1AWFH 1VR1H 2BY9X 2Y81A 2J95A 1GI4A 1SSXA 1MD7A 5EXNA 1UHBB 3Q00A 1P12E 1YPEH 1SB1H 1SQTA 1P2JA 5C1UA 2F9PA 2UUYA 1L1NA 5C1YA 1K1IA 4D76A 1V2OT 2SFAA 1G30B 2VWMA 4YZUA 2PTNA 2BLWA 6LPRA 2FPZA 4WVPE 1P57B 3S7KB 3OY5U 1O3OA 2ZI2H 3P92A 4D8NA 1O2PA 2WV5A 2VIVA 3NPSA 1YYY1 1O2KA 1ABJH 1YPJH 2XXLA 3O8BA 2Y5HA 3F9HA 4JCNA 1C2KA 2KAIA 4RSPA 2OQ5A 1QBNA 2AEIH 1C1TA 1VGCC 3ZVGA 4UONA 1FY8E 4BAOB 1KXAA 1O2NA 2J34A 3V3MA 2CHAC 3LJJA 2BZAA 1AQ7A 1NS3A 1C5QA 1TNKA 1DX5M 1OWHA 2V3OH 4TPIZ 1P05A 3A80A 2BY5X 3GDUA 2GKVE 3CS7A 1KYNA 3A7TA 2FOFA 2B0FA 2TGAA 1YKTA 1ELBA 2OBQA 1VITH 1EZQA 1HLTH 3SV8A 4I32A 2BOHB 4WF8A 2GD4B 2W3IA 2FYQA 4X2WA 2ZWLH 2R0LA 5FXLA 4FUIA 3SQEE 1FJSA 1BHXB 1KXFA 2FOMB 4H4FA 1IQMA 5TJXA 3A7ZA 1NFYA 5ESTE 2FX6A 2TGPZ 3STJA 1KIGH 2C8YB 3NZIA 1GHAF 1ANDA 2ANWA 4K1EA 3PLBA 2ZP0H 3TJUA 1GJ6A 3SU1A 1C1QA 1F5RA 3S0NA 4FUBA 3M3SA 2BD2A 1XXDA 1SC8U 1DWEH 1NFWA 4CH2B 2V3HH 4B73A 4D9RA 1T32A 4WMFA 2TIOA 4B74A 1JRSA 1JMOH 1PPEE 4A1XA 1YPHC 3MU4A 4AFZA 1K1LA 1LHDH 3GCOA 3UUZA 2D2DA 1TYNA 2BD8A 4I31A 5E0GA 2VWLA 1W13U 1EX3A 1SQAA 1UVUH 3PWBA 2ALVA 2H5CA 1TNHA 3SHCH 1UTNA 1GCTB 1K1MA 2JH0D 3RXAA 3TK5A 1DWBH 2GCHG 1Z1JA 3RMOH 4TY7A 2BMGB 1S84A 1VITF 1EUFA 1MKWH 3RXBA 4MQAA 1GJ8B 1FAXA 3KCGH 2D1JA 1BMNH 4ABFA 5GDSH 1AB9B 3V13A 3URCA 1G3BA 3E16B 2WPIS 4X8SH 3PYHA 1EQ9A 1HB0B 5HYOA 1E0FD 4MLFB 2QA9E 1LHGH 4AOQA 3MU0A 1FY1A 4WJG2 3RU4E 3ZVCA 3S9CA 1TPAE 1SGIB 3ATWA 1GI2A 3R3GB 1P2IA 1C2EA 3SU5A 1AI8H 1GG6B 1P8VC 5C5OA 1TNIA 1P2OA 1W12U 1P01A 3P8GA 2AGGX 2FMJA 4Y79A 3RXJA 3A89A 1TNGA 3T28A 2F9BH 3MU1A 4Y7BA 3SGQE 2ZFPH 4U32A 4ABGA 1HAOH 3F6UH 2Z3DA 3P6ZB 1VJAU 1QQ4A 5IYTA 4FUCA 2C8XB 2J92A 1AU8A 2J2UA 1K22H 1TGNA 3BTHE 3RM2H 1XMNB 5EPYA 1NTPA 1EZXC 1L4ZA 4ZMAH 4TY6A 5CE1A 1BRBE 5ETXA 1QRXA 2OC1A 1E34B 2IPHA 1O2UA 3VB5A 3ODFA 4ASHA 3NWUA 6ESTA 3DFLA 1HAVB 2ZFFH 1KLIH 2Z9GA 4Z0KA 2PKAA 1CHOF 2LNCA 3U1JB 4JZFH 4JYVH 1P9UA 4NIXA 3QTVH 2PKSB 3FP6E 1Z1IA 4AGKA 1BRAA 4Q80A 1P02A 4H42U 1DUAA 2PGQB 3F9GA 1CGIE 1J17T 1RTLA 3JZ2B 1ELGA 1MU8B 4Q2KA 3A83A 5TCAA 1GBTA 4Z6AH 4KKDA 3UOUA 2DUCA 5FPYA 2QF0A 1SGCA 2OD3B 3ZYDA 3QO6A 1UTJA 4OS5A 1AD8H 1AMHA 1O5CB 3FZZA 1DXPA 2SGQE 5JB8S 1O2MA 1C2IA 1A46H 1V2LT 2GV6A 3KIDU 3T62A 2AMQA 3RXIA 3UY9A 1YF4A 1W8BH 4B2BA 3BTFE 1GBMA 2PFEA 2G81E 1ZYOA 1V2PT 2FI3E 1ELDE 4BXSA 4X2YA 1J16A 1VITG 2BOKA 2R0KA 1TPPA 3UOPA 4GHQA 1JBUH 1AVXA 1TGTA 2GCHF 3L3TA 1GHVH 2HOBA 1NRRH 1OOKB 1ZPZA 1GBKA 3VB4A 3GDVA 4YOJA 4DGJA 2HNTC 4DJZB 4IC6A 2H6MA 3VGCC 4IMQA 1TNJA 1O5DH 1ZHMA 4DOQA 1BMMH 1KXCA 2ZFTA 2YNAA 2FM2A 1QCPA 2P16A 2V6NA 2R3UA 1GHBG 1ZZZA 1H9IE 3GYLB 4FVBA 1MZDA 1OXGA 3M5OA 3EDXB 1HAXB 2PR3A 1HAVA 3HGPA 4I8JA 3RMMH 5DK1A 1ZJKA 4JYUH 1A4WH 1QA7A 1RD3B 1OWIA 1P3CA 3MO3A 4K69A 1SR5C 1H8IH 3MU8A 1CT2E 1ETRH 1RFNA 2ZDNA 1HBTH 1D6WA 1NRQH 1YCPH 1GJ7B 3A7WA 3GY4A 3SUGA 1XUFA 5FCRA 3GYMA 1ID5H 1DVAH 1OP0A 1O5FH 1OWJA 2ZGXH 3ZVDA 2BY7X 3SHAH 5GWZA 1GJCB 3GCHC 2O8TA 6GCHG 3IITA 3T29A 3ATKA 1TB6H 3UQVA 1CT4E 1TRNA 1ELEE 4NSYA 2P95A 2VGCB 4CRAA 5A8XA 4IW4E 2FP7B 2W26A 1BJUA 1Y3YA 2B7DH 1QY6A 1HIAA 1AGJA 1Y3UA 4NWKA 1ZTKA 3GY7A 4FUGA 5DP4A 3ZYEA 4Y10E 5I46H 2JETB 3W94A 2EI7A 1P0SH 1GG6C 3GY2A 3GCNA 3BEIB 1NESE 1FLEE 1NRPH 2BB4A 2P8OC 3PTBA 1C1WH 3FFGA 5AVDA 7KMEH 3SUFA 3BTQE 3OX7U 4TYDA 2F9OA 3SU2A 4ZKRU 4R0IA 1BOQA 2Q6FA 2XWAA 3MI4A 4AG2A 3LPRA 2FI4E 3M61U 1VZQH 4INHA 4MPUA 1ANBA 2A4QA 1HAZB 1O3LA 2GZ9A 1TBQH 4H6TA 1K28D 1J14A 1ELTA 1BRUP 4MVNA 1HAPH 4ZUHA 4X1PU 4DY7B 1ZTJA 2VB0A 1IHTH 1GJ5H 1T8MA 1M9UA 1GBBA 3U98H 3U8TH 2OC7A 2NU0E 5AFYH 3BEUA 1BTHH 1GGDB 3AAUA 3SGBE 3MNBA 1T7CA 8ESTE 2QXJA 3QGNB 4U2WA 1GJ9B 4LZ4B 4AYYB 4ABEA 1O3PB 1A0JA 1G3CA 2Z7FE 3E90B 2UUFB 4H6SB 1E38B 1YLDA 1O3GA 1BCUH 2HRVA 1SGFG 1O3EA 3I29A 1KXBA 5EQQA 4I8GA 1AIXH 3FANA 1MD8A 5ABWA 3RM0H 3UQOA 3D49H 1HRTH 2ZPQA 1ZSLA 3ZV8A 1K1NA 2BDAA 1GVLA 1SVPA
chains in the Genus database with same CATH superfamily
2Q1JA 4YXWD 4IGDA 3E3TA 2AYWA 1QIXB 3UNRA 1EP5A 4ZKNU 1EAIA 5DP8A 3EYDA 1WYKA 3RXDA 4ACBA 4Y8ZA 1GVZA 5JBBS 1A1RA 4YM9A 1DM4B 1VCQA 3MTYA 1NU9A 1G3DA 3HK6B 2V0BA 1H9HE 2A0QB 3FAOA 1S85A 3SV2H 2ESTE 5G4BA 1ZSKA 2CHAB 7LPRA 2W7UA 2G51A 9LPRA 5LPFA 2STAE 4ZXYH 1T4UH 1KMHB 1XKBC 4U30A 1F0UA 3L6PA 1WTGH 2ZDKA 2Y5FA 3FVFB 1D9IA 2WPLS 1V2ST 4ABJA 5FPTA 1EPTC 4FOUC 3P8NA 1QBVH 4FUEA 1G32B 5L2YH 1NM6A 1NZQH 1F92A 3SZEA 2IJOB 1BITA 2Z9LA 4NZLA 1O3HA 1RTFB 1MTVA 1ELAA 1TX8A 1YPGH 4TT3D 1C1NA 2WV4A 2GTBA 5CHAC 4THNH 1CBWC 2PV9B 4AG1A 2QN5T 2IPQX 4GCHF 1D3TB 4K8YA 1LMWB 5EW2H 1KLTA 4NIWA 3DSOA 1LHEH 1GI3A 5HMAA 3S9AA 1LHCH 2RA3A 3A8BA 2VIOA 5EU8A 3M35A 1MCVA 4XBCA 1MTNC 1A3BH 4X1RU 1UHBA 1GBFA 2B8OH 1SGPE 4KTSA 4MNWA 1JRTA 1NBMD 1GI7B 1AHTH 4B75A 3PLKA 1BB0B 1T31A 3KGPA 3MOCA 4GAWA 5B6OA 2RDLA 2XBYA 3RXOA 1LVMA 4ACAA 1EKBB 3F9EA 4GCHG 5I25A 1V2WT 1V3XA 5F03A 3PROA 2HLDD 3ZZ9A 2F83A 1BJVA 1AO5A 1HPGA 1YPKH 2XBVA 2H2ZA 2Y5GA 4ABDA 4DIHH 2SNWA 4ZH8A 1H1BA 1WQVH 2VJ1A 3KHVA 1FY5A 2G4TA 1SLVB 2Q6DA 2VH0A 2PP6A 1RRKA 1UCYH 3KQ5A 5JYIA 1K0HA 1C5RA 1KY9A 1XUIA 5C0TA 2EA3A 1GBCA 4RKJB 3F2FA 2ULLA 5E2OA 1C2MA 1V2QT 1O2VA 1CU1A 3ZV9A 1IQFA 5F8ZA 4YTAA 3L33A 3A7XA 2OINA 2A4RA 2P59A 2WPKS 1IAUA 3SJOA 1LVYA 2BXUH 3M3VA 1O3JA 1KTSB 2KCYA 4GLYA 3RMNH 2JJ1D 3GY8A 3PMAB 3T27A 1ESBA 1DFPA 1IOEA 2ZQ2A 3F2GA 4NIVA 5DKMA 1THRH 1O2TA 4DVAU 1CT0E 1O2WA 1MU6B 3GY5A 2QF3A 3OAAD 2BDYA 4GHTA 2GT8A 1O36A 1V2NT 3T25A 3VXFH 3STIA 5JBCS 1GMHG 1D3PB 1G9IE 1BDAA 1Y5BT 2BY6X 2K0QA 2ZU2A 1QGFA 1F0SA 1ZGVA 1EOJA 4X0WU 4Y0YE 1H8ED 1GBEA 3KQCA 3PWCA 2ZDAH 4CBNA 1UVOA 1HFDA 2QXHA 4RKOB 3U28C 1FXYA 4ZAEA 3PM3A 2IOTA 3UTUH 1VGCB 3BG8A 2B5TB 3LGYA 1HYLA 5BRRE 1VCWA 5LH8A 1CBWB 3OEHD 1TA2A 2JKHA 1FZZA 1QR3E 1CHOG 1O3CA 3SW2B 4AGJA 2UWPA 4X8VH 4AB8A 1ZR0A 1E1RD 1Q3XA 3RDZA 3DD2H 2KM0A 5GIBA 2FYRA 4XSKU 2A5IA 1GJDB 2WUBA 3FZDA 5LGOA 3GOVB 5C1XA 1EPTB 1DY8A 4GSOA 2W3KA 4Q7YA 3RXKA 2P94A 3A88A 4B2CA 3N7DA 1UMAH 5DP7A 1C5LH 2BY8X 1MBQA 4A1VA 5CMXH 1QJ6B 3HATH 1UK2A 3GS9A 3TJNA 2HLCA 3CENA 2A5AA 4A5TS 5B6LA 4B2AA 3DA9B 5KECA 1TBRH 1P10A 5JBAS 2BX4A 2XC4A 1SGRE 1C5UA 2QYIA 3SV9A 1MKXK 2CGAA 1D3DB 1Z8GA 4AYVB 2WUCA 2A31A 3K9XB 3LOXA 1S5SA 1E35B 1SBWA 1W3CA 2BXTH 2ZEBA 3CS0A 2Z9KA 4SGAE 1MTNB 3LGTA 1P9SA 3RC6A 1VKYA 1CE5A 1C4V2 1FN6A 3TITA 1UVPA 3CP7A 1QZ8A 4CRDA 2BM2A 4K5ZA 2Z6BD 1NROH 3IG6B 2ZECA 2ALPA 2ASUB 1Y59T 3RXQA 3SJ9A 1WXRA 3VEQB 3BTWE 4WH8A 5C2ZA 4BOHA 3TH4H 1H4WA 5EPNA 1TABE 3QDZB 3QZRA 1GPZA 1VCPA 2FS9A 4KTCA 1SI5H 1C5SA 2GVFA 2P3TB 1SFQB 2BDBA 5FCKA 6CHAB 2H5DA 1MUEB 3K6ZA 2ANYA 1C5MD 4QT8C 2BZ6H 1DSUA 1HAIH 1QB9A 1W11U 3NK8A 2ZA5A 1EPTA 2UUJB 1UVSH 1GBLA 3H7TA 3P8FA 5SGAE 1GMHF 1SOZA 4ISLA 2ANMH 1V6DA 2RA0A 1TONA 2TGTA 4YT6H 1W7GH 2XNDD 1MQ5A 2H9TH 3RXGA 1SHYA 2LELA 2WPJS 3K6YA 3AK5A 2FLRH 2EY4C 3EGKH 1YPHE 2OTVA 3E0PB 5AFZH 2KCPA 1NN6A 3S69A 3SUDA 1MH0A 1MBMA 5IK2D 2PSXA 4AB9A 3TH2H 4K2YA 1HJAC 2AGIX 1DE7H 3SNAA 3RXHA 3F1SB 3LDXH 3O8RA 2FXRA 3ZZ8A 4JK6A 2ZIQH 4JZDH 2RDEA 1UVTH 5IDKA 2WPDD 1PQ8A 3LGUA 2AIPA 4JYTA 3B8JA 4FU9A 1INCA 1SGDE 4IC5A 2WZQA 3EE7A 3ZZAA 1LDTT 1MKWK 3A86A 1P3EA 1UW7A 1TPOA 1W0JD 5T6DA 3BTDE 3MO9A 3TJVA 1IQEA 1YP9A 1FMGA 3RXRA 4PROA 5T1VA 1LHFH 1O39A 3GCTG 3U8RH 1MTUA 3D65E 1SLWB 3S9BA 4B6EA 1EB1H 2HPPH 2ILNA 5JB9S 2KZ4A 4AORA 2BD5A 2GT7A 3A7YA 3M5NA 4XRNA 1E79D 1NRNH 1ZMNA 2CF9H 4O9VA 2WV9A 4Y11E 3V7TA 1O2GH 2O8LA 3QK1A 1W0ZU 2B9LA 4FUFA 3MNXA 3CNRA 1HAHH 1XUGA 5GJ4B 2GGVB 2D8WA 5EW1H 1BTPA 3F0OA 4WH6A 1D6RA 1C5ZB 3IWMA 2ODPA 2R2WU 3BTTE 2BDCA 1O2IA 2GX4A 3PLPA 1LQEA 1O2RA 1MKXH 2BQWB 4LOYH 1BBRE 4CBOA 1WAYB 2ZHEH 1BZXE 1MAYA 1TBZH 1EZUC 2P93A 1L0ZA 2XRCA 3N99A 3ZVFA 2FOEA 1T8OA 3VXEH 2GZ8A 2BD9A 1GJAB 3PMBB 1V2RT 3SJIA 4WXVA 2TPIZ 1OKXA 1FY4A 2FI5E 3MWIU 2FIRH 1EZSC 3O8CA 4CRCA 3MH7A 4JZ1A 4BTTB 2Z9JA 2THFB 3SO3A 3F0PA 3PMJA 1C5VA 4MPXA 3A81A 4Y8XA 1GI0A 1Q31A 2A4OA 2BQ7B 1O0DH 3SU0A 2K1QA 3MU5A 5GCHF 3Q77A 4F48B 3OTPA 4ABBA 5A0CA 4NSVA 2BD7A 2EI6A 3SN8A 1C9TA 3M37A 4Z1MD 1CO7E 1EOLA 2GMTB 1UTOA 3TIUA 2AERH 1HDTH 5DP5A 3DFJA 3SOSA 1J8AA 5EJ1A 3WW7A 1BBRK 1DDJA 2NWNA 3RU4D 1DS2E 1FUJA 1DXWA 1DT2A 4HG6A 3RXSA 2Y82A 3GCHB 1D3QB 4OM9A 1C5YB 1TOCB 3DUXH 1SL3A 5A8ZA 3RC4A 5T3HA 2J4IA 4ZKOU 3AAVA 5A0BA 1GBJA 2ZHDA 1JIMA 2AIQA 1GBDA 1Y5AT 4E7RG 4IMZA 5E8EH 2NU1E 2ZCKP 1BMFD 3BTME 2ZHWH 1DOJA 4GVUA 1TGSZ 4Y71A 3S7HB 5A2MH 2C8ZB 4FU8A 2QAAA 5GXPA 1PYTC 1LO6A 2BTCE 1Y8TA 2FX4A 1WOFA 3A8CA 3SQHE 4BNRA 2OLGA 2ZZUH 1THPB 2OC0A 5BPEA 3FKSD 3ITIA 4A1TA 1QRWA 4SGBE 2VINA 5L30H 1AKSB 3VB6A 1GHBF 1WTHD 4NA9H 2PLXA 2PHBA 3LH1A 2G8TA 4ZXXH 4DG4A 3M7QA 1GBIA 2HPQH 1C5OH 2XYAA 1LPKB 4HTCH 5FX6A 4GUXA 1LKBA 4JMYA 1TALA 1ELCA 7GCHG 2BHGA 4UFEH 1SGYE 5C5NA 1K1JA 2ZDVH 1F2SE 1YM0A 2WPMS 4E05H 1BA8B 1HJAB 4MPVA 5J4QA 3NKKA 3P95A 1A0HB 1S83A 1GMCG 1PPFE 1AZ8A 1UTLM 3BN9A 3ENSB 3N7OA 4WMEA 5EJLA 1OP2A 1PQ5A 1C1VH 1A5IA 1O3AA 4X6NA 3GY3A 2AFQB 1BMLA 2PSYA 1O31A 4JZIA 4A7IB 2ZF0H 1ZSJA 4RT1A 1KXDA 3BIUH 2Z94A 3QN7A 1TRMA 4DW2U 4LZ1H 4O03A 1MCTA 1YWUA 2W5EA 2BD4A 1YPMH 2ZQ1A 1SQRA 3UWJH 5DO4H 1G36A 2I6QA 3HKIB 3MNCA 1C4Y2 3MNSA 9ESTA 4BAKB 2KAIB 4RN6A 1N6YA 1CA0B 1NFUA 1O2QA 2BLOA 4AX9H 3TU7H 2F91A 5F8TA 3KEEA 2O9QA 3A7VA 4HI3A 4NGAH 3T5FH 3SU6A 1JXPA 1E1QD 1K1PA 1V2TT 3SGAE 2STBE 2F4LA 3A8DA 3Q3KA 2ZGJA 4BAMB 2FLBH 1THSH 4MDSA 3E0NB 1H9LB 3ATIA 1FN8A 2SGEE 2FTMA 2DE9A 3M7UA 3FN8A 1O3KA 3A82A 2J38A 1O2OA 1W10U 4WWYA 3SI4H 1HV7A 2SGFE 1QL9A 3OFND 2PW8H 2ZFQH 1A2CH 3E8LA 4ZROA 4BXWA 3UR9A 1F5LA 1XVMA 1EXFA 1GHXH 2PUQH 2J5UA 4I8KA 4INLA 1EP6A 3RXPA 2PWXA 1C5WB 2OP9A 3NCLA 2ZTYA 1K21H 2ZHQH 4XDEA 1PPGE 8LPRA 1ARCA 1AFQC 1GHAG 4NA7A 5AHGH 2G00A 1NRSH 3SU4A 4F4OC 3BSQA 4UFGH 2UWLA 2TRMA 2J94A 4ZHLU 4YESB 3LGVA 1SGQE 3H7OA 4J1YA 4FUJA 2AS9A 2ZGBH 4X2XA 1BTXA 1EB2A 1F0RA 1Q2WA 2FS8A 4Q7ZA 3SBKA 1WCZA 2GDDA 1ZMJA 3GICB 1TAWA 5GCHG 1HUTH 2FODA 2R2MB 2PKAB 3R0FA 5L6NH 1CGJE 1FIWA 3WWBA 2PUXB 1ZTLA 4IN2A 1ZHPA 1GHYH 2FOHA 1O5BB 1GL0E 1YPLH 4CRGA 1K9OE 4AFUA 3MMGA 1CGHA 2J98A 1MTWA 3K65B 4ABAA 1DWCH 1A5HA 4KGAA 3RXFA 1NU7B 1ZRKA 1GDNA 2J98B 1AUTC 3DHKH 2O8WA 3RXTA 4ISNA 3TLOA 3W95A 2ZDMA 4NFEA 1BTYA 2C4FH 3NUMA 4NZQA 3SZNA 2UUKB 3ZZ7A 3FO8D 4Q7XA 5A0AE 1LPZB 1T8LA 2FOCA 3HPTB 1IQJA 3TNTA 3I77A 3H09A 2VWOA 3LKWA 1WSSH 5E0JA 1A7SA 1PJPA 1G3EA 1C2HA 4KTUA 1P2NA 1Z71A 3EE0B 1GBAA 4IBLH 3ZZ6A 2YMSB 3ZVBA 1IQKA 3ZIAD 1C1UH 4CR5A 4AN7A 3MQKC 2AMPA 3ZZ4A 5EOKA 1QRZA 2JH6D 1HIAB 4I8LA 1QQUA 3SI3H 4BANB 1B0EA 1OWEA 1RIWB 2A7HA 1HCGA 3RUOA 1YBWA 3A87A 1GDQA 3A85A 2Y7XA 2VH6A 2ZDLA 1TNLA 1O2XA 1V2UT 1AFEH 1GI1A 1OWKA 3BV9B 2VVVA 4M7GA 5KGOA 4XBDA 3OU0A 3T2NA 2CF8H 1ANCA 1Y3VA 2HVYB 5HXFA 1XXFA 2G52A 5F53A 4MNVA 2GZ7A 2SGAA 3ELAH 3F9FA 2FWWA 3A8AA 4B76A 3GDSA 4ASUD 1GCDA 2OBOA 1IQLA 2NU4E 2FESH 1AY6H 2JH5D 1EATA 1WV7H 1O3FA 2FDAA 4CRFA 1ZPCA 2A4GA 1N1LA 2YOLA 2ZU1A 3O8DA 4AZ2B 3MH4A 1P2MA 2W6JD 1O32A 2ODYB 1IQHA 1EAUA 3MYWA 3VB3A 7ESTE 1DLEA 4NWLA 3M36A 1AZZA 3F3BA 1FQ3A 1ZRBA 1QL7A 1SQOA 3V12A 2FEQH 1GI6A 1KLJH 2QXGA 1A3EH 2ZGHA 1NBME 3TK9A 5F8XA 5GPIB 3SORA 3AVZA 4Y76A 4OS4A 3EA7A 2BVSH 4BTUB 1AVGH 1J15A 1QTFA 1ZOMA 1WDIA 2NU2E 1XUKA 1AFQB 1O37A 1TMTH 4K60A 3MH6A 3DT0H 1HNEE 1LPGB 1QB1A 2ZNKH 3HKJB 2GP9B 4ISOA 1UTQA 2HVXA 1T8NA 1O2SA 3RXEA 3URDA 1SOTA 5DPAA 4TWWA 1O2HA 1WQSA 1S0QA 4R8TB 3RLWH 2ZU5A 4B1TA 3EQ0H 1DITH 1GJ4H 2XBXA 2AHME 2FTLE 3ATMA 4FU7A 1V2KT 2Y80A 3PO1C 1O3BA 4JK5A 3GCTF 5FX5A 1O5GH 2V35A 4CR9A 5JDUB 4U01A 1TGCA 1JOUB 4XFQA 5HKKD 4HFPB 5DP3A 3PRBA 1UJ1A 2A7CA 3A84A 1YGCH 2C93B 1AE8H 4OGYA 2FOBA 2BVRH 3SU3A 2H9EH 1UK4A 2D26C 1GMDG 1FPCH 1ZLRA 3QTOH 5CHBA 4ZKSU 1SGEE 3OYPA 5C17A 1AVWA 2BLVA 4DT4A 1P04A 8KME2 1SGNE 4K3JA 2VU8E 7GCHF 1V2MT 2OXSA 2ZKSA 5T6FA 4F55A 2GMTC 2VNTA 3P8OA 3SUEA 1W7XH 3D23A 1S6HA 2EC9H 1Z7KA 3U8OH 3SNEA 1FV9A 2QY0B 1BIOA 3HK3B 2W7SA 3TGIE 1ELFA 1IQNA 4I8HA 3UB0A 1S0RA 2ZPRA 2H1UA 5DP9A 1HJ8A 4K1TA 3SNDA 2QF5A 1DLKB 1BT7A 1QURH 1Y5UT 1NPMA 3AW0A 2ZGCA 3SJ8A 1P2QA 3MFJA 4B71A 1Z6EA 1OPHB 4AFSA 1A61H 1RIWC 2EI8A 1QBOA 2QC2A 4Y8YA 3PO1B 2P3UB 2A32A 2L6OA 4X6PA 5C67A 2FO9A 2ANKH 2XCNA 3U9AH 3RXCA 1OYTH 4XD7D 1P11E 1C2DA 2FOAA 2GCTC 1LCYA 5TCCA 1TGBA 4LXBH 5L2ZH 1AN1E 1PQAA 1CHGA 5C3NA 1HAYB 3AW1A 2KCOA 4YT7H 2H9HA 3OY6U 4F49A 2BVXH 3KL6A 5JPMH 1LQDB 4MNYA 1ZJDA 3LT3A 1PFXC 1FDPA 4HGCA 2J9NA 5F6MA 2SGPE 1SHHB 3VB7A 3TVJB 3LC5A 3NXPA 2QF4A 5EXMA 3RXLA 3BTKE 4UE7H 4OS1A 1TIOA 1ARBA 1S81A 5A8YA 2CXVA 1DICA 5AF9H 1BHXF 5EXLA 1EJAA 1FAKH 1F7ZA 4BAQB 1FI8A 1TRYA 1IHSH 2YNBA 1XUHA 3ZZBA 1O38A 1B5GH 3LJOA 4UD9H 1C2GA 4NG9H 3P17H 1ZMLA 1HXEH 2ZCHP 3U1IB 1QL8A 2BDGA 4WXIA 1EJNA 1OS8A 1BTWA 1D4PB 1C2FA 3RLYH 1TA6A 4KELA 2F3CE 1AUJA 4CREA 1ANEA 1C5NH 3RXMA 3E6PH 5J4SA 2ZPSA 4ISIH 5H4IB 1PPHE 5EODA 1C5XB 2EEKA 1C1OA 1QB6A 3UNSA 4CH8B 1QHRB 1CA0C 2QGRA 3PV4A 1O2JA 1YLCA 5KEDA 1P2KA 4ESTE 3E1XB 5DG6A 2ZTZA 1SPJA 3VGCB 1G2LA 1RTKA 2A7JA 4I7YH 3EA9A 4XOJA 2XC0A 1W0YH 2AMDA 2R3YA 4O3UA 1GHWH 2UWOA 2JETC 2BLQA 1L4DA 1QNJA 6GCHF 1V2JT 3KN2A 2ZFSA 3ZZ5A 1GVKB 4Y7AA 1HXFH 4D7FA 1ZGIA 5ESBA 2XTTB 2Z3EA 2DE8A 2SGDE 4WY3A 1FNIA 2F9VA 1MZAA 4FUHA 1K1OA 1CVWH 4DCDA 4MNXA 5FAHA 1GI9B 1XUJA 3MH5A 1GJBB 1PPZA 3DCLA 4YOGA 4TSFD 5EIYA 1XKAC 2P3FH 3W1EA 1C1RA 4YO9A 1C5PA 1TMBH 4VGCB 3GY6A 1C1PA 1GCTC 6CHAC 1GI5A 3ZZCA 1GL1A 3EA8A 1H8DH 3G01A 1C5TA 3PRDA 3RXUA 3KF2A 1KTTB 1HJ9A 2A5KA 3BF6H 4ISHH 1DWDH 3EAJA 1UTMA 1DUEA 1YCPK 3F68H 3ZVEA 4E7NA 2XWBI 2XNIA 3BG4B 2AH4X 2TBSA 1P06A 2V3MA 1W2KH 3SNBA 3D62A 2KR7A 3QGJA 5DGJA 2V7QD 2OQUA 2HNTE 2Z9IA 5DP6A 3HGNA 4NIYA 2CN0H 2PGBB 2A1DB 3Q3YA 5LPRA 1N6XA 1SGFA 3KNXA 1U6QA 1SLUB 3RMLH 1WBGB 2ZTXA 2ZU4A 1PPBH 1Z8JB 3C1KA 3FP8E 4XBBA 2WINI 3QUMP 3MO6A 8GCHF 1BUIA 1V2VT 1GHZA 2HWLB 4X1QU 3H5CB 1OSSA 3QLPH 2Q6GA 5DJ7A 2QV1A 4K8BA 1AB9C 3TJOA 1C2JA 4BTIB 1O2YA 1P09A 2A45B 2PTCE 2HGTH 4X8UH 1EJMA 2CK3D 4A6LA 2BYAX 1GMCF 2KX4A 1TPSA 2R9PA 1RXPA 1SG8B 1MMJN 1RGQA 1S6FA 2VIQA 4ABIA 3UWIA 1KXEA 1Z8IB 3ZVAA 4CHAC 2J97A 3OSYA 1L1GA 1MAXA 3JZ1B 1C9PA 4NCYA 1O2LA 3AASA 2ZG0H 1SGTA 3QWCH 5K7RA 3FP7E 4UFFH 4YOIA 1UCYE 1ETTH 1OX1A 3RC5A 1TLDA 1C2LA 1LVOA 1W14U 1NT1A 1O3DA 2I6SA 3PTNA 2GCTB 4TPYA 1FY3A 1K2I1 5LPEA 3TGJE 1Z6JH 4WMDA 2ZC9H 2FZZA 4OS7A 3LH3A 3OEED 1XX9A 5K0HA 2G4UA 3M5MA 3V0XA 3SNCA 1LTOA 3LGIA 3U69H 1F5KU 2ZCLP 3M5LA 1CSOE 2WYGA 1SMFE 1QFKH 2F43B 2OUAA 2BD3A 1GMDF 4DURA 3KQDA 1PQ7A 3LGWA 1TWXB 2Y7ZA 4INKA 3K2UA 1OYQA 3VPKA 1EAXA 2JJ2D 2G55A 5E0HA 2G5NA 3SV6A 5A09A 3Q3XA 4X2VA 1TMUH 2C3SA 1LVBA 1OWDA 1B7XB 2GDEH 2WYJA 3WY8A 1ZPBA 5HGGA 3ATLA 3RP2A 4YLQH 4MTBA 1ELVA 1E36B 1C4U2 1JIRA 2VBCA 5EQSA 3UREA 2ZO3H 3VFEA 5HM9A 1PYTD 2Z3CA 4O97A 1O3NA 1P03A 2VVUA 2SNVA 3NRLA 1UCYK 1EAWA 3B23B 4NFFA 1UTPA 4X1NU 1X7AC 5FL7D 4J2YB 3KQEA 4X6MA 8GCHG 2ZU3A 2HNTF 4P00A 1C1SA 3MHWU 2G5VA 2JDID 2XBWA 5CHAB 4IS5A 2CV3A 3TH3H 3P70B 4TWYA 5EGMA 1ESAA 1KDQA 2XC5A 1O3MA 1O35A 4HZHA 2TGDA 4ZHAA 2FOGA 1CA8B 3ZZ3A 1C1MA 1S82A 2PKSC 4FVDA 1G2MA 4Q4LA 4D9QA 1ESTA 5EQRA 4P02A 5PTPA 2O8UA 3PMHB 4BAHB 3UPEA 1DANH 3PV5A 1O5EH 1GWAA 3SV7A 1A5GH 1BTZA 1A0LA 1QA0A 1UO6A 2LPRA 4YLUA 1WUNH 1SFIA 3ODDA 4OS6A 2BQ6B 1S6LA 1ACBE 2F9NA 4MPWA 3PV2A 1SLXB 2VWNA 1GDUA 5EG4A 1O34A 2OK5A 3T26A 1O3IA 1DPOA 1RS0A 1G37A 5FHTA 1T4VH 4KP0A 2A2QH 4K1SA 3Q76A 1KDQB 1YCPM 1Z8RA 3M7TA 4NA8A 1FIZA 4X8TH 5FPSA 4ABHA 4A92A 3BTEE 3UIRA 1L2EA 4E06H 2QIQA 4I33A 1NC6A 1QJ1B 2XCFA 2BDHA 1N8OC 1PPCE 1O33A 1TFXA 3F2HA 3UR6A 4D7GA 1BRCE 1VJ9U 3ZZDA 1LKAA 5T6GA 2O8MA 2IN2A 3ESTA 1IQGA 3M3TA 4ZHMU 3BG4C 2C90B 2BDIA 4AFQA 2BX3A 3E91A 1TQ0B 4XE4A 1GI8B 2VGCC 2XW9A 4DIIH 3TGKE 3RU4T 1F0TA 3BIVH 1J9CH 4UDWH 1ORFA 2ZHFH 1NY22 3RXVA 3LC3A 1HAGE 1XM1A 2HALA 4JZEH 5EJZA 2VVCA 3VG8A 3TK6A 3LU9B 1O5AB 3N7EA 2JIZD 2P8OB 4OGXA 5HM2A 4Q63A 1TQ7B 3LIWA 1NFXA 1TOMH 1Y3XA 1TE0A 1JWTA 3WWFA 1MQ6A 2F9UA 2QXIA 3PB1E 5C94A 4CRBA 4UEHH 1OP8A 1AWHB 3DSGA 3TPIZ 1EASA 3SJKA 1AKSA 2VIWA 2Y6TA 4DT7B 2OCVB 1DSTA 3KQBA 2VIPA 2RG3A 2VIDA 1GBHA 3UFAA 1Y3WA 4Y6DA 1HGTH 2YMSD 3BEFB 4AC9A 1NO9H 4X6OA 1BMAA 4FUDA 5FBEA 4CHAB 2A2XH 2ODQA 1WU1A 3QX5H 4OS2A 3LONA 1AE5A 1QJ7B 1FONA 2M5TA 2CJIA 2WSSD 1CQQA 3GISB 5JBTA 3B9FH 2NU3E 1E37B 4UFDH 3TNSA 1TX6A 1L1JA 2OC8A 4GPGA 1RJXB 4O3TA 2WPHS 1UK3A 2ZFRH 2QCYA 2GV7A 1TX7A 1O2ZA 4IN1A 3C27B 3OTJE 4X1SU 4MG3A 2M2AA 2CMYA 3QZQA 1BQYA 4LK4A 4FXGH 2C8WB 4VGCC 1KSNA 3BTGE 1B0FA 5C20A 1IQIA 1BTUA 1DY9A 1UTKA 1YC0A 1ETSH 3I78A 4Y0ZE 2QE7D 1N8OB 1MTSA 1BBRH 1ZHRA 1ABIH 2RCEA 2AGEX 1GGDC 3UNQA 1FPHH 1O30A 1XVOA 5E2PA 5FBIA 1AWFH 1VR1H 2BY9X 2Y81A 2J95A 1GI4A 1SSXA 1MD7A 5EXNA 1UHBB 3Q00A 4B6FA 1P12E 1YPEH 1SB1H 1SQTA 1P2JA 5C1UA 2F9PA 2UUYA 3KYGA 2XOKD 1L1NA 5C1YA 1K1IA 4D76A 1V2OT 2SFAA 1G30B 2VWMA 4YZUA 2PTNA 2BLWA 6LPRA 2FPZA 4WVPE 1P57B 3S7KB 3OY5U 1O3OA 2ZI2H 3P92A 4D8NA 5DN6D 1O2PA 2WV5A 2VIVA 3NPSA 1YYY1 1O2KA 1ABJH 1YPJH 2XXLA 3O8BA 2Y5HA 3F9HA 5HIZA 1H8HD 4JCNA 1C2KA 2KAIA 4RSPA 2K8IA 2OQ5A 1QBNA 2AEIH 1C1TA 1VGCC 3ZVGA 4UONA 1FY8E 4BAOB 1KXAA 1O2NA 2J34A 3V3MA 2CHAC 3LJJA 3FOAA 2BZAA 1AQ7A 1NS3A 1C5QA 1TNKA 1DX5M 1OWHA 2V3OH 4TPIZ 1P05A 3A80A 1SKYE 2BY5X 2GKVE 3CS7A 1KYNA 3GDUA 3A7TA 2FOFA 2B0FA 2TGAA 1YKTA 1ELBA 2OBQA 1VITH 1EZQA 1HLTH 3SV8A 4I32A 2BOHB 4WF8A 2GD4B 2W3IA 2FYQA 4X2WA 2YMSC 2ZWLH 2R0LA 5FXLA 4FUIA 3SQEE 1FJSA 1BHXB 1KXFA 2FOMB 4H4FA 1IQMA 5TJXA 3A7ZA 1NFYA 5ESTE 2FX6A 2TGPZ 3STJA 1KIGH 2C8YB 3NZIA 3UAIC 1GHAF 1ANDA 2ANWA 4K1EA 3PLBA 2ZP0H 3TJUA 1GJ6A 3SU1A 1C1QA 1F5RA 3S0NA 4FUBA 3M3SA 2BD2A 1XXDA 3SYJA 1SC8U 1DWEH 1NFWA 4CH2B 4RT0A 2V3HH 2KCAA 4B73A 4D9RA 4I86A 1T32A 4WMFA 2TIOA 4B74A 1JRSA 1JMOH 1PPEE 4A1XA 1YPHC 4RI0A 5C0UA 3MU4A 4AFZA 1K1LA 1LHDH 3GCOA 3UUZA 2D2DA 1TYNA 5HIYA 2BD8A 4I31A 5E0GA 2VWLA 1W13U 1EX3A 1SQAA 1UVUH 3PWBA 2ALVA 2H5CA 1TNHA 3SHCH 1UTNA 1GCTB 1K1MA 2JH0D 3RXAA 3TK5A 1DWBH 2GCHG 1Z1JA 3DSPA 3RMOH 4TY7A 2BMGB 1MABB 1S84A 1VITF 1EUFA 1MKWH 3RXBA 4MQAA 1FAXA 1GJ8B 3KCGH 2D1JA 1BMNH 4ABFA 5GDSH 1AB9B 3V13A 3URCA 1G3BA 3E16B 2WPIS 4X8SH 3PYHA 1EQ9A 1HB0B 5HYOA 1E0FD 4MLFB 2QA9E 1LHGH 4AOQA 3MU0A 1FY1A 4WJG2 3RU4E 3ZVCA 3S9CA 1TPAE 3KYFA 1SGIB 3ATWA 1GI2A 3R3GB 1P2IA 1C2EA 2WHXA 1AI8H 1GG6B 3SU5A 1P8VC 5C5OA 1TNIA 1P2OA 1W12U 1P01A 3P8GA 2AGGX 2FMJA 4Y79A 3RXJA 3A89A 5DSFA 1TNGA 3T28A 2F9BH 3MU1A 4Y7BA 3SGQE 2ZFPH 4U32A 4ABGA 1HAOH 3F6UH 2Z3DA 3P6ZB 1VJAU 4M9FA 1QQ4A 5IYTA 4FUCA 2C8XB 2J92A 1AU8A 2J2UA 1K22H 1TGNA 3BTHE 3RM2H 1XMNB 5EPYA 1NTPA 1EZXC 1L4ZA 4ZMAH 4TY6A 5CE1A 1BRBE 5ETXA 1QRXA 2OC1A 1E34B 2IPHA 1O2UA 3VB5A 3ODFA 4ASHA 3NWUA 4FETA 6ESTA 3DFLA 1HAVB 2ZFFH 1KLIH 2Z9GA 4Z0KA 2PKAA 1CHOF 2LNCA 3U1JB 4JZFH 4JYVH 1P9UA 1EFRD 4NIXA 3QTVH 2PKSB 4ZCNA 3FP6E 1Z1IA 4AGKA 1BRAA 4Q80A 1P02A 4H42U 1DUAA 2PGQB 3F9GA 1CGIE 1J17T 1RTLA 3JZ2B 1ELGA 1MU8B 4Q2KA 3A83A 5TCAA 1GBTA 4Z6AH 4KKDA 3UOUA 2DUCA 5FPYA 2QF0A 1SGCA 2OD3B 3ZYDA 3QO6A 1UTJA 4OS5A 1AD8H 1AMHA 1O5CB 3FZZA 2RFKC 5CDFE 1DXPA 2SGQE 5JB8S 1O2MA 1C2IA 1A46H 1V2LT 2GV6A 3KIDU 3T62A 2AMQA 3RXIA 3UY9A 1YF4A 1W8BH 4B2BA 2KFWA 3BTFE 1GBMA 2PFEA 2G81E 1ZYOA 1V2PT 2FI3E 1ELDE 4BXSA 4X2YA 1J16A 1VITG 2BOKA 2R0KA 1TPPA 3UOPA 4GHQA 1JBUH 1AVXA 1TGTA 2GCHF 3L3TA 1GHVH 2HOBA 1NRRH 1OOKB 1ZPZA 1GBKA 3VB4A 2EQNA 3GDVA 4YOJA 4DGJA 2HNTC 4DJZB 4IC6A 2H6MA 3VGCC 4IMQA 1TNJA 1O5DH 1ZHMA 4DOQA 1BMMH 1KXCA 2ZFTA 2YNAA 2FM2A 1QCPA 2P16A 2V6NA 2R3UA 1GHBG 1ZZZA 1H9IE 3GYLB 4FVBA 1MZDA 1OXGA 3M5OA 3EDXB 1HAXB 2PR3A 1HAVA 3HGPA 4I8JA 3RMMH 5DK1A 1ZJKA 4JYUH 1A4WH 1QA7A 1RD3B 1OWIA 1P3CA 3MO3A 4K69A 1SR5C 1H8IH 3MU8A 1CT2E 1ETRH 1RFNA 2ZDNA 1HBTH 1D6WA 1NRQH 1YCPH 1GJ7B 3A7WA 3GY4A 3SUGA 1XUFA 5FCRA 3GYMA 1ID5H 1DVAH 1OP0A 1O5FH 1OWJA 2ZGXH 3ZVDA 2BY7X 3SHAH 5GWZA 1GJCB 3GCHC 2O8TA 6GCHG 3IITA 3T29A 3ATKA 1TB6H 3UQVA 1CT4E 1TRNA 1ELEE 4NSYA 2P95A 2VGCB 4CRAA 5A8XA 4IW4E 2FP7B 2W26A 1BJUA 1Y3YA 2B7DH 1QY6A 1HIAA 1AGJA 1Y3UA 4NWKA 1ZTKA 3GY7A 4FUGA 5DP4A 3ZYEA 4Y10E 5I46H 2JETB 3W94A 2EI7A 1P0SH 2LP6A 1GG6C 3GY2A 3GCNA 3BEIB 1YLNA 1NESE 1FLEE 1NRPH 2BB4A 2P8OC 3PTBA 1C1WH 3FFGA 5AVDA 7KMEH 2IJD1 3SUFA 3BTQE 3OX7U 4TYDA 2F9OA 3SU2A 1OHHD 4ZKRU 4R0IA 1BOQA 2Q6FA 2XWAA 3MI4A 4AG2A 3LPRA 2FI4E 3M61U 1VZQH 4INHA 4MPUA 1ANBA 2A4QA 1HAZB 1O3LA 2GZ9A 1TBQH 4H6TA 1K28D 1J14A 1ELTA 1BRUP 4MVNA 2GJGA 1HAPH 4ZUHA 4X1PU 4DY7B 1ZTJA 2VB0A 1IHTH 1GJ5H 1T8MA 1M9UA 1GBBA 3U98H 3U8TH 2OC7A 2NU0E 5AFYH 3BEUA 1BTHH 1GGDB 3AAUA 1W0KD 3SGBE 3MNBA 1T7CA 8ESTE 1FX0B 2QXJA 5GNDA 3QGNB 4U2WA 1GJ9B 4LZ4B 4AYYB 4ABEA 1O3PB 1A0JA 1G3CA 2Z7FE 3E90B 2UUFB 4H6SB 1E38B 1YLDA 1O3GA 1BCUH 2HRVA 1SGFG 1O3EA 1COWD 3I29A 1KXBA 5EQQA 1YY3A 4I8GA 2W6ID 1AIXH 3FANA 1MD8A 3OE7D 5ABWA 3RM0H 3UQOA 3D49H 2L74A 1HRTH 2ZPQA 1ZSLA 3ZV8A 1K1NA 2BDAA 1GVLA 1SVPA
chains in the Genus database with same CATH topology
2Q1JA 4IGDA 3E3TA 2AYWA 1QIXB 3UNRA 1EP5A 4ZKNU 1EAIA 5DP8A 3EYDA 1WYKA 3RXDA 4Y8ZA 1GVZA 5JBBS 1A1RA 4YM9A 1DM4B 1VCQA 3MTYA 1NU9A 1G3DA 3HK6B 2V0BA 1H9HE 2A0QB 3FAOA 1S85A 3SV2H 2ESTE 5G4BA 1ZSKA 2CHAB 7LPRA 2W7UA 2G51A 9LPRA 5LPFA 2STAE 4ZXYH 1T4UH 1XKBC 4U30A 1F0UA 3L6PA 1WTGH 2ZDKA 2Y5FA 3FVFB 1D9IA 2WPLS 1V2ST 4ABJA 5FPTA 1EPTC 3P8NA 1QBVH 4FUEA 1G32B 5L2YH 1NM6A 1NZQH 1F92A 2IJOB 1BITA 2Z9LA 4NZLA 1O3HA 1RTFB 1MTVA 1ELAA 1TX8A 1YPGH 1C1NA 2WV4A 2GTBA 5CHAC 4THNH 1CBWC 2PV9B 4AG1A 2QN5T 4GCHF 1D3TB 4K8YA 1LMWB 5EW2H 1KLTA 4NIWA 1LHEH 1GI3A 5HMAA 3S9AA 1LHCH 2RA3A 3A8BA 2VIOA 5EU8A 3M35A 1MCVA 4XBCA 1MTNC 1A3BH 4X1RU 1UHBA 1GBFA 2B8OH 1SGPE 4KTSA 4MNWA 1JRTA 1GI7B 1AHTH 4B75A 3PLKA 1BB0B 1T31A 3KGPA 3MOCA 4GAWA 5B6OA 2RDLA 2XBYA 3RXOA 1LVMA 1EKBB 3F9EA 4GCHG 5I25A 1V2WT 1V3XA 5F03A 3PROA 3ZZ9A 2XBVA 2F83A 1BJVA 1AO5A 1HPGA 1YPKH 2H2ZA 2Y5GA 4ABDA 4DIHH 2SNWA 4ZH8A 1H1BA 1WQVH 2VJ1A 3KHVA 1FY5A 2G4TA 1SLVB 2Q6DA 2VH0A 1RRKA 1UCYH 5JYIA 1C5RA 1KY9A 1XUIA 2EA3A 1GBCA 4RKJB 2ULLA 5E2OA 1C2MA 1V2QT 1O2VA 1CU1A 3ZV9A 1IQFA 5F8ZA 4YTAA 3L33A 3A7XA 2OINA 2A4RA 2P59A 2WPKS 1IAUA 3SJOA 1LVYA 2BXUH 3M3VA 1O3JA 1KTSB 4GLYA 3RMNH 3GY8A 3T27A 3PMAB 1ESBA 1DFPA 1IOEA 2ZQ2A 5DKMA 4NIVA 1THRH 1O2TA 4DVAU 1CT0E 1O2WA 1MU6B 3GY5A 2QF3A 2BDYA 4GHTA 2GT8A 1O36A 1V2NT 3T25A 3VXFH 3STIA 5JBCS 1GMHG 1D3PB 1G9IE 1BDAA 1Y5BT 2BY6X 2ZU2A 1QGFA 1F0SA 1ZGVA 1EOJA 4X0WU 4Y0YE 1GBEA 3KQCA 3PWCA 2ZDAH 4CBNA 1UVOA 1HFDA 2QXHA 4RKOB 1FXYA 4ZAEA 3PM3A 2IOTA 3UTUH 1VGCB 3BG8A 2B5TB 3LGYA 1HYLA 5BRRE 1VCWA 5LH8A 1CBWB 1TA2A 2JKHA 1FZZA 1QR3E 1CHOG 1O3CA 3SW2B 4AGJA 2UWPA 4X8VH 4AB8A 1ZR0A 1Q3XA 3RDZA 3DD2H 5GIBA 2FYRA 4XSKU 2A5IA 1GJDB 2WUBA 3FZDA 5LGOA 3GOVB 5C1XA 1EPTB 1DY8A 4GSOA 2W3KA 4Q7YA 3RXKA 2P94A 3A88A 4B2CA 1UMAH 5DP7A 1C5LH 2BY8X 1MBQA 4A1VA 5CMXH 1QJ6B 3HATH 1UK2A 3TJNA 2HLCA 3CENA 2A5AA 4A5TS 4B2AA 3DA9B 1TBRH 1P10A 5JBAS 2BX4A 2XC4A 1SGRE 1C5UA 2QYIA 3SV9A 1MKXK 2CGAA 1D3DB 1Z8GA 4AYVB 2WUCA 2A31A 3K9XB 3LOXA 1S5SA 1E35B 1SBWA 1W3CA 2BXTH 2ZEBA 3CS0A 2Z9KA 4SGAE 1MTNB 3LGTA 1P9SA 3RC6A 1CE5A 1C4V2 1FN6A 3TITA 1UVPA 3CP7A 4CRDA 2BM2A 4K5ZA 2Z6BD 1NROH 3IG6B 2ZECA 2ALPA 2ASUB 1Y59T 3RXQA 3SJ9A 3VEQB 3BTWE 4WH8A 5C2ZA 4BOHA 3TH4H 1H4WA 5EPNA 1TABE 3QDZB 3QZRA 1GPZA 1VCPA 2FS9A 4KTCA 1SI5H 1C5SA 2GVFA 2P3TB 1SFQB 2BDBA 5FCKA 6CHAB 2H5DA 1MUEB 3K6ZA 2ANYA 1C5MD 4QT8C 2BZ6H 1DSUA 1HAIH 1QB9A 1W11U 3NK8A 2ZA5A 1EPTA 2UUJB 1UVSH 1GBLA 3H7TA 3P8FA 5SGAE 1GMHF 1SOZA 4ISLA 2ANMH 1V6DA 2RA0A 1TONA 2TGTA 4YT6H 1W7GH 3RXGA 1MQ5A 2H9TH 1SHYA 2WPJS 3K6YA 2FLRH 3EGKH 1YPHE 2OTVA 3E0PB 5AFZH 1NN6A 3S69A 3SUDA 1MH0A 1MBMA 2PSXA 4AB9A 3TH2H 4K2YA 1HJAC 2AGIX 1DE7H 3SNAA 3RXHA 3F1SB 3LDXH 3O8RA 2FXRA 3ZZ8A 4JK6A 2ZIQH 4JZDH 1UVTH 5IDKA 1PQ8A 3LGUA 2AIPA 4JYTA 3B8JA 4FU9A 1INCA 1SGDE 4IC5A 3ZZAA 1LDTT 1MKWK 3A86A 1P3EA 1TPOA 5T6DA 3BTDE 3MO9A 3TJVA 1IQEA 1YP9A 1FMGA 3RXRA 4PROA 1LHFH 1O39A 3GCTG 3U8RH 1MTUA 3D65E 1SLWB 3S9BA 1EB1H 2HPPH 2ILNA 5JB9S 4AORA 2BD5A 2GT7A 3A7YA 3M5NA 1NRNH 1ZMNA 2CF9H 4O9VA 4Y11E 3V7TA 1O2GH 2O8LA 3QK1A 1W0ZU 2B9LA 4FUFA 3MNXA 1HAHH 1XUGA 5GJ4B 2GGVB 2D8WA 5EW1H 1BTPA 4WH6A 1D6RA 1C5ZB 3IWMA 2ODPA 2R2WU 3BTTE 2BDCA 1O2IA 2GX4A 3PLPA 1LQEA 1O2RA 1MKXH 2BQWB 4LOYH 1BBRE 4CBOA 1WAYB 2ZHEH 1BZXE 1MAYA 1TBZH 1EZUC 2P93A 1L0ZA 2XRCA 3ZVFA 2FOEA 1T8OA 3VXEH 2GZ8A 2BD9A 1GJAB 3PMBB 1V2RT 3SJIA 4WXVA 2TPIZ 1OKXA 1FY4A 2FI5E 3MWIU 2FIRH 1EZSC 3O8CA 4CRCA 3MH7A 4JZ1A 4BTTB 2Z9JA 2THFB 3SO3A 3PMJA 1C5VA 4MPXA 3A81A 4Y8XA 1GI0A 1Q31A 2A4OA 2BQ7B 1O0DH 3SU0A 2K1QA 3MU5A 5GCHF 3Q77A 4ABBA 5A0CA 4NSVA 2BD7A 2EI6A 3SN8A 1C9TA 3M37A 1CO7E 1EOLA 2GMTB 1UTOA 3TIUA 2AERH 1HDTH 5DP5A 3DFJA 3SOSA 1J8AA 1BBRK 1DDJA 2NWNA 3RU4D 1DS2E 1FUJA 1DXWA 1DT2A 3RXSA 2Y82A 3GCHB 1D3QB 1C5YB 1TOCB 3DUXH 1SL3A 5A8ZA 3RC4A 5T3HA 2J4IA 4ZKOU 3AAVA 5A0BA 1GBJA 2ZHDA 1JIMA 2AIQA 1GBDA 1Y5AT 4E7RG 4IMZA 5E8EH 2NU1E 2ZCKP 3BTME 2ZHWH 1DOJA 4GVUA 1TGSZ 4Y71A 3S7HB 5A2MH 2C8ZB 4FU8A 2QAAA 5GXPA 1PYTC 1LO6A 2BTCE 1Y8TA 2FX4A 1WOFA 3A8CA 3SQHE 4BNRA 2OLGA 2ZZUH 1THPB 2OC0A 5BPEA 3ITIA 4A1TA 1QRWA 4SGBE 2VINA 5L30H 1AKSB 3VB6A 1GHBF 1WTHD 4NA9H 2PLXA 2PHBA 3LH1A 2G8TA 4ZXXH 4DG4A 3M7QA 1GBIA 2HPQH 1C5OH 2XYAA 1LPKB 4HTCH 5FX6A 4GUXA 1LKBA 4JMYA 1TALA 1ELCA 7GCHG 2BHGA 4UFEH 1SGYE 5C5NA 1K1JA 2ZDVH 1F2SE 1YM0A 2WPMS 4E05H 1BA8B 1HJAB 4MPVA 5J4QA 3NKKA 3P95A 1A0HB 1S83A 1GMCG 1PPFE 1AZ8A 1UTLM 3BN9A 3ENSB 3N7OA 4WMEA 1OP2A 1PQ5A 1C1VH 1A5IA 1O3AA 4X6NA 3GY3A 2AFQB 1BMLA 2PSYA 1O31A 4JZIA 4A7IB 2ZF0H 1ZSJA 1KXDA 3BIUH 2Z94A 3QN7A 1TRMA 4DW2U 4LZ1H 4O03A 1MCTA 2W5EA 2BD4A 1YPMH 2ZQ1A 3UWJH 5DO4H 1G36A 2I6QA 3HKIB 3MNCA 1C4Y2 3MNSA 9ESTA 4BAKB 2KAIB 4RN6A 1N6YA 1CA0B 1NFUA 1O2QA 2BLOA 4AX9H 3TU7H 2F91A 5F8TA 3KEEA 2O9QA 3A7VA 4HI3A 4NGAH 3T5FH 3SU6A 1JXPA 3SGAE 1K1PA 1V2TT 2STBE 3A8DA 3Q3KA 2ZGJA 4BAMB 2FLBH 1THSH 4MDSA 3E0NB 1H9LB 3ATIA 1FN8A 2SGEE 2FTMA 2DE9A 3M7UA 1O3KA 3A82A 2J38A 1O2OA 1W10U 4WWYA 3SI4H 1HV7A 2SGFE 1QL9A 2PW8H 2ZFQH 1A2CH 3E8LA 4ZROA 4BXWA 3UR9A 1F5LA 1XVMA 1EXFA 1GHXH 2PUQH 4I8KA 4INLA 1EP6A 3RXPA 2PWXA 1C5WB 2OP9A 3NCLA 2ZTYA 1K21H 2ZHQH 4XDEA 1PPGE 8LPRA 1ARCA 1AFQC 1GHAG 4NA7A 5AHGH 2G00A 1NRSH 3SU4A 4F4OC 3BSQA 4UFGH 2UWLA 2TRMA 2J94A 4ZHLU 4YESB 3LGVA 1SGQE 3H7OA 4J1YA 4FUJA 2AS9A 2ZGBH 4X2XA 1BTXA 1EB2A 1F0RA 1Q2WA 2FS8A 4Q7ZA 3SBKA 1WCZA 2GDDA 1ZMJA 3GICB 1TAWA 5GCHG 1HUTH 2FODA 2R2MB 2PKAB 3R0FA 5L6NH 1CGJE 1FIWA 2PUXB 1ZTLA 4IN2A 1ZHPA 1GHYH 2FOHA 1O5BB 1GL0E 1YPLH 4CRGA 1K9OE 4AFUA 3MMGA 1CGHA 1MTWA 3K65B 4ABAA 1DWCH 1A5HA 4KGAA 3RXFA 1NU7B 1ZRKA 1GDNA 1AUTC 3DHKH 2O8WA 3RXTA 4ISNA 3TLOA 3W95A 2ZDMA 4NFEA 1BTYA 2C4FH 3NUMA 4NZQA 3SZNA 2UUKB 3ZZ7A 4Q7XA 5A0AE 1LPZB 1T8LA 2FOCA 3HPTB 1IQJA 3TNTA 3I77A 2VWOA 3LKWA 1WSSH 5E0JA 1A7SA 1PJPA 1G3EA 1C2HA 4KTUA 1P2NA 1Z71A 3EE0B 1GBAA 4IBLH 3ZZ6A 3ZVBA 1IQKA 4CR5A 1C1UH 4AN7A 2AMPA 3ZZ4A 5EOKA 1QRZA 2JH6D 1HIAB 4I8LA 1QQUA 3SI3H 4BANB 1B0EA 1OWEA 1RIWB 2A7HA 1HCGA 3RUOA 1YBWA 3A87A 1GDQA 3A85A 2Y7XA 2VH6A 2ZDLA 1TNLA 1O2XA 1V2UT 1AFEH 1GI1A 1OWKA 3BV9B 2VVVA 4M7GA 4XBDA 3OU0A 3T2NA 2CF8H 1ANCA 1Y3VA 5HXFA 1XXFA 2G52A 4MNVA 2GZ7A 2SGAA 3ELAH 3F9FA 2FWWA 3A8AA 4B76A 3GDSA 1GCDA 2OBOA 1IQLA 2NU4E 2FESH 1AY6H 2JH5D 1EATA 1WV7H 1O3FA 2FDAA 4CRFA 1ZPCA 2A4GA 1N1LA 2YOLA 2ZU1A 3O8DA 4AZ2B 3MH4A 1P2MA 1O32A 2ODYB 1IQHA 1EAUA 3MYWA 3VB3A 7ESTE 1DLEA 4NWLA 3M36A 1AZZA 1FQ3A 1ZRBA 1QL7A 1SQOA 3V12A 2FEQH 1GI6A 1KLJH 2QXGA 1A3EH 2ZGHA 3TK9A 5F8XA 5GPIB 3SORA 3AVZA 4Y76A 4OS4A 3EA7A 2BVSH 4BTUB 1AVGH 1J15A 1QTFA 1ZOMA 2NU2E 1XUKA 1AFQB 1O37A 1TMTH 4K60A 3MH6A 3DT0H 1HNEE 1LPGB 1QB1A 2ZNKH 3HKJB 2GP9B 4ISOA 1UTQA 2HVXA 1T8NA 1O2SA 3RXEA 3URDA 1SOTA 5DPAA 4TWWA 1O2HA 1WQSA 1S0QA 4R8TB 3RLWH 2ZU5A 4B1TA 3EQ0H 1DITH 2XBXA 1GJ4H 2FTLE 3ATMA 4FU7A 1V2KT 2Y80A 3PO1C 1O3BA 4JK5A 3GCTF 5FX5A 1O5GH 2V35A 4CR9A 5JDUB 4U01A 1TGCA 1JOUB 4XFQA 4HFPB 5DP3A 1UJ1A 2A7CA 3A84A 1YGCH 2C93B 1AE8H 4OGYA 2FOBA 2BVRH 3SU3A 2H9EH 1UK4A 2D26C 1GMDG 1FPCH 1ZLRA 3QTOH 4ZKSU 1SGEE 3OYPA 1AVWA 2BLVA 1P04A 8KME2 1SGNE 4K3JA 2VU8E 7GCHF 1V2MT 2OXSA 2ZKSA 5T6FA 2GMTC 2VNTA 3P8OA 3SUEA 1W7XH 3D23A 1S6HA 2EC9H 1Z7KA 3U8OH 3SNEA 1FV9A 2QY0B 1BIOA 3HK3B 2W7SA 3TGIE 1ELFA 1IQNA 4I8HA 1S0RA 2ZPRA 2H1UA 5DP9A 1HJ8A 4K1TA 3SNDA 1DLKB 1BT7A 1QURH 1Y5UT 1NPMA 3AW0A 2ZGCA 3SJ8A 1P2QA 3MFJA 4B71A 1Z6EA 1OPHB 4AFSA 1A61H 1RIWC 2EI8A 1QBOA 2QC2A 4Y8YA 3PO1B 2P3UB 2A32A 4X6PA 5C67A 2FO9A 2ANKH 2XCNA 3U9AH 3RXCA 1OYTH 1P11E 1C2DA 2FOAA 2GCTC 1LCYA 5TCCA 1TGBA 4LXBH 5L2ZH 1AN1E 1PQAA 1CHGA 5C3NA 1HAYB 3AW1A 4YT7H 2H9HA 3OY6U 4F49A 2BVXH 3KL6A 5JPMH 1LQDB 4MNYA 1ZJDA 3LT3A 1PFXC 1FDPA 4HGCA 2J9NA 5F6MA 2SGPE 1SHHB 3VB7A 3TVJB 3LC5A 3NXPA 5EXMA 3RXLA 3BTKE 4UE7H 4OS1A 1TIOA 1ARBA 1S81A 5A8YA 2CXVA 1DICA 5AF9H 1BHXF 5EXLA 1EJAA 1FAKH 1F7ZA 4BAQB 1FI8A 1TRYA 1IHSH 2YNBA 1XUHA 3ZZBA 1O38A 1B5GH 3LJOA