1SPVA

Crystal structure of the putative phosphatase of escherichia coli, northeast structural genomoics target er58
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
172
structure length
172
Chain Sequence
TRIHVVQGDITKLAVDVIVNAANPSLMGGGGVDGAIHRAAGPALLDACLKVRQQQGDCPTGHAVITLAGDLPAKAVVHTVGPVWRGGEQNEDQLLQDAYLNSLRLVAANSYTSVAFPAISTGVYGYPRAAAAEIAVKTVSEFITRHALPEQVYFVCYDEENAHLYERLLTQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Putative Phosphatase of Escherichia coli, Northeast Structural Genomoics Target ER58
rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
molecule keywords putative polyprotein/phosphatase
total genus 55
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2004-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 1spvA00
3IIFA 1TXZA 3EJFA 4JLLA 1LCPA 3KR4A 4ABKA 3SIHA 4GVVA 5HIHA 1YD9A 4GUAA 1NJRA 3H8EA 4R6TA 5FSVA 3EKEA 4J5RA 2XD7A 4ETJA 3H8GA 4JGKA 5FSUA 3V2BA 4ZYQA 2VRIA 5E3BA 1SPVA 1LAPA 3GPOA 3GQEA 4R76A 2DX6A 1TY8A 4K3NA 3GPQA 4D86A 3Q6ZA 3SIGA 4JVVA 2ACFA 3EWOA 4KSIA 3VFQA 4TU0A 4ZY0A 4KYBA 3IJ3A 2BFRA 3GQOA 1BLLE 1BPNA 5AILA 5D8NA 4GVWA 4UMLA 4ZX8A 4X2TA 2BFQA 1LAMA 2FXKA 2AFCA 2L8RA 4J5QA 5CB3A 5CB5A 4ZX9A 3KQZA 5DUSA 2X47A 1ZR3A 2LGRA 5HOLA 5FSXA 1VHUA 5FSZA 3PEIA 4ZY2A 3T8WA 3JRUA 4ESSA 4J4ZA 5FSYA 3EW5A 3ETIA 1ZR5A 2EEEA 1BPMA 1HJZA 3SIJA 3SIIA 4R7MA 3IIDA 4JCAA 3JZTA 3H8FA 3EWPA 3EJGA 4ZI6A 3V45A 4ABLA 4ZY1A 4ETKA 4K0CA 5CBMA 3EWQA 3GPGA 3EWRA 3Q71A 2FG1A 3KZWA 1LANA 5CMSA 4IQYA 2FAVA 3KR5A 2J9AA 3KQXA 1GYTA 4J5SA 2EWBA
chains in the Genus database with same CATH superfamily
3IIFA 1TXZA 3EJFA 4JLLA 1LCPA 3KR4A 4ABKA 3SIHA 4GVVA 5HIHA 1YD9A 4GUAA 1NJRA 3H8EA 4R6TA 5FSVA 3EKEA 4J5RA 2XD7A 4ETJA 3H8GA 4JGKA 5FSUA 3V2BA 4ZYQA 2JZFA 2VRIA 5E3BA 1SPVA 1LAPA 3GPOA 3GQEA 4R76A 2DX6A 1TY8A 4K3NA 3GPQA 4D86A 2KQVA 3Q6ZA 3SIGA 4JVVA 2ACFA 3EWOA 4KSIA 3VFQA 4TU0A 4ZY0A 4KYBA 3IJ3A 2BFRA 3GQOA 1BLLE 1BPNA 5AILA 5D8NA 4GVWA 4UMLA 4ZX8A 2W2GA 2BFQA 4X2TA 1LAMA 2FXKA 2AFCA 2L8RA 4J5QA 5CB3A 5CB5A 2WCTA 4ZX9A 3KQZA 5DUSA 2X47A 2JZDA 1ZR3A 2LGRA 5HOLA 5FSXA 1VHUA 5FSZA 3PEIA 4ZY2A 3T8WA 3JRUA 4ESSA 4J4ZA 5FSYA 3EW5A 3ETIA 1ZR5A 2EEEA 1BPMA 2RNKA 1HJZA 3SIJA 3SIIA 4R7MA 3IIDA 4JCAA 3JZTA 2JZEA 3H8FA 3EWPA 3EJGA 4ZI6A 3V45A 4ABLA 4ZY1A 4ETKA 4K0CA 5CBMA 3EWQA 3GPGA 3EWRA 3Q71A 2FG1A 3KZWA 1LANA 5CMSA 4IQYA 2FAVA 3KR5A 2J9AA 3KQXA 1GYTA 4J5SA 2EWBA
chains in the Genus database with same CATH topology
3IIFA 1TXZA 3EJFA 4JLLA 1LCPA 3KR4A 4ABKA 3SIHA 4GVVA 5HIHA 1YD9A 4GUAA 1NJRA 3H8EA 4R6TA 5FSVA 3EKEA 4J5RA 2XD7A 4ETJA 3H8GA 4JGKA 5FSUA 3V2BA 4ZYQA 2VRIA 5E3BA 1SPVA 1LAPA 3GPOA 3GQEA 4R76A 2DX6A 1TY8A 4K3NA 3GPQA 4D86A 3Q6ZA 3SIGA 4JVVA 2ACFA 3EWOA 4KSIA 3VFQA 4TU0A 4ZY0A 4KYBA 3IJ3A 2BFRA 3GQOA 1BLLE 1BPNA 5AILA 5D8NA 4GVWA 4UMLA 4ZX8A 4X2TA 2BFQA 1LAMA 2FXKA 2AFCA 2L8RA 4J5QA 5CB3A 5CB5A 4ZX9A 3KQZA 5DUSA 2X47A 1ZR3A 2LGRA 5HOLA 5FSXA 1VHUA 5FSZA 3PEIA 4ZY2A 3T8WA 3JRUA 4ESSA 4J4ZA 5FSYA 3EW5A 3ETIA 1ZR5A 2EEEA 1BPMA 1HJZA 3SIJA 3SIIA 4R7MA 3IIDA 4JCAA 3JZTA 3H8FA 3EWPA 3EJGA 4ZI6A 3V45A 4ABLA 4ZY1A 4ETKA 4K0CA 5CBMA 3EWQA 3GPGA 3EWRA 3Q71A 2FG1A 3KZWA 1LANA 5CMSA 4IQYA 2FAVA 3KR5A 2J9AA 3KQXA 1GYTA 4J5SA 2EWBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IIF A;  1TXZ A;  3EJF A;  4JLL A;  1LCP A;  3KR4 A;  4ABK A;  3SIH A;  4GVV A;  5HIH A;  1YD9 A;  4GUA A;  1NJR A;  3H8E A;  4R6T A;  5FSV A;  3EKE A;  4J5R A;  2XD7 A;  4ETJ A;  3H8G A;  4JGK A;  5FSU A;  3V2B A;  4ZYQ A;  2VRI A;  5E3B A;  1SPV A;  1LAP A;  3GPO A;  3GQE A;  4R76 A;  2DX6 A;  1TY8 A;  4K3N A;  3GPQ A;  4D86 A;  3Q6Z A;  3SIG A;  4JVV A;  2ACF A;  3EWO A;  4KSI A;  3VFQ A;  4TU0 A;  4ZY0 A;  4KYB A;  3IJ3 A;  2BFR A;  3GQO A;  1BLL E;  1BPN A;  5AIL A;  5D8N A;  4GVW A;  4UML A;  4ZX8 A;  4X2T A;  2BFQ A;  1LAM A;  2FXK A;  2AFC A;  2L8R A;  4J5Q A;  5CB3 A;  5CB5 A;  4ZX9 A;  3KQZ A;  5DUS A;  2X47 A;  1ZR3 A;  2LGR A;  5HOL A;  5FSX A;  1VHU A;  5FSZ A;  3PEI A;  4ZY2 A;  3T8W A;  3JRU A;  4ESS A;  4J4Z A;  5FSY A;  3EW5 A;  3ETI A;  1ZR5 A;  2EEE A;  1BPM A;  1HJZ A;  3SIJ A;  3SII A;  4R7M A;  3IID A;  4JCA A;  3JZT A;  3H8F A;  3EWP A;  3EJG A;  4ZI6 A;  3V45 A;  4ABL A;  4ZY1 A;  4ETK A;  4K0C A;  5CBM A;  3EWQ A;  3GPG A;  3EWR A;  3Q71 A;  2FG1 A;  3KZW A;  1LAN A;  5CMS A;  4IQY A;  2FAV A;  3KR5 A;  2J9A A;  3KQX A;  1GYT A;  4J5S A;  2EWB A; 
#chains in the Genus database with same CATH topology
 3IIF A;  1TXZ A;  3EJF A;  4JLL A;  1LCP A;  3KR4 A;  4ABK A;  3SIH A;  4GVV A;  5HIH A;  1YD9 A;  4GUA A;  1NJR A;  3H8E A;  4R6T A;  5FSV A;  3EKE A;  4J5R A;  2XD7 A;  4ETJ A;  3H8G A;  4JGK A;  5FSU A;  3V2B A;  4ZYQ A;  2JZF A;  2VRI A;  5E3B A;  1SPV A;  1LAP A;  3GPO A;  3GQE A;  4R76 A;  2DX6 A;  1TY8 A;  4K3N A;  3GPQ A;  4D86 A;  2KQV A;  3Q6Z A;  3SIG A;  4JVV A;  2ACF A;  3EWO A;  4KSI A;  3VFQ A;  4TU0 A;  4ZY0 A;  4KYB A;  3IJ3 A;  2BFR A;  3GQO A;  1BLL E;  1BPN A;  5AIL A;  5D8N A;  4GVW A;  4UML A;  4ZX8 A;  2W2G A;  2BFQ A;  4X2T A;  1LAM A;  2FXK A;  2AFC A;  2L8R A;  4J5Q A;  5CB3 A;  5CB5 A;  2WCT A;  4ZX9 A;  3KQZ A;  5DUS A;  2X47 A;  2JZD A;  1ZR3 A;  2LGR A;  5HOL A;  5FSX A;  1VHU A;  5FSZ A;  3PEI A;  4ZY2 A;  3T8W A;  3JRU A;  4ESS A;  4J4Z A;  5FSY A;  3EW5 A;  3ETI A;  1ZR5 A;  2EEE A;  1BPM A;  2RNK A;  1HJZ A;  3SIJ A;  3SII A;  4R7M A;  3IID A;  4JCA A;  3JZT A;  2JZE A;  3H8F A;  3EWP A;  3EJG A;  4ZI6 A;  3V45 A;  4ABL A;  4ZY1 A;  4ETK A;  4K0C A;  5CBM A;  3EWQ A;  3GPG A;  3EWR A;  3Q71 A;  2FG1 A;  3KZW A;  1LAN A;  5CMS A;  4IQY A;  2FAV A;  3KR5 A;  2J9A A;  3KQX A;  1GYT A;  4J5S A;  2EWB A; 
#chains in the Genus database with same CATH homology
 3IIF A;  1TXZ A;  3EJF A;  4JLL A;  1LCP A;  3KR4 A;  4ABK A;  3SIH A;  4GVV A;  5HIH A;  1YD9 A;  4GUA A;  1NJR A;  3H8E A;  4R6T A;  5FSV A;  3EKE A;  4J5R A;  2XD7 A;  4ETJ A;  3H8G A;  4JGK A;  5FSU A;  3V2B A;  4ZYQ A;  2VRI A;  5E3B A;  1SPV A;  1LAP A;  3GPO A;  3GQE A;  4R76 A;  2DX6 A;  1TY8 A;  4K3N A;  3GPQ A;  4D86 A;  3Q6Z A;  3SIG A;  4JVV A;  2ACF A;  3EWO A;  4KSI A;  3VFQ A;  4TU0 A;  4ZY0 A;  4KYB A;  3IJ3 A;  2BFR A;  3GQO A;  1BLL E;  1BPN A;  5AIL A;  5D8N A;  4GVW A;  4UML A;  4ZX8 A;  4X2T A;  2BFQ A;  1LAM A;  2FXK A;  2AFC A;  2L8R A;  4J5Q A;  5CB3 A;  5CB5 A;  4ZX9 A;  3KQZ A;  5DUS A;  2X47 A;  1ZR3 A;  2LGR A;  5HOL A;  5FSX A;  1VHU A;  5FSZ A;  3PEI A;  4ZY2 A;  3T8W A;  3JRU A;  4ESS A;  4J4Z A;  5FSY A;  3EW5 A;  3ETI A;  1ZR5 A;  2EEE A;  1BPM A;  1HJZ A;  3SIJ A;  3SII A;  4R7M A;  3IID A;  4JCA A;  3JZT A;  3H8F A;  3EWP A;  3EJG A;  4ZI6 A;  3V45 A;  4ABL A;  4ZY1 A;  4ETK A;  4K0C A;  5CBM A;  3EWQ A;  3GPG A;  3EWR A;  3Q71 A;  2FG1 A;  3KZW A;  1LAN A;  5CMS A;  4IQY A;  2FAV A;  3KR5 A;  2J9A A;  3KQX A;  1GYT A;  4J5S A;  2EWB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...