1SQ8A

A variant 434 repressor dna binding domain devoid of hydroxyl groups, nmr, 20 structures
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
64
structure length
64
Chain Sequence
MLMGERIRARRIQLGLNQAELAQKVGVDQQAIEQLENGKAKRPRFLPELARALGVAVDWLLNGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Structure of a Variant 434 Repressor DNA-binding Domain Devoid of Hydroxyl Groups
pubmed doi rcsb
source organism Phage 434
molecule tags Dna binding protein
molecule keywords dh434
total genus 22
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2004-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1sq8A00
3SCGA 3ZHMA 2CROA 4X4CA 2EWTA 3OQOA 4J1XA 3U3WA 4I6TA 1PNRA 1ZPQA 1ZZ9A 2IV1A 3F51A 1GT0C 2O38A 2AXVA 1PRUA 1LMB3 1QQAA 4IWRA 3OQNA 3B7HA 1AU7A 4I8TA 2R1JL 2O49A 2AWIA 2EBYA 2AUWA 1RIOA 2IVGA 1POUA 1QPZA 3CROL 4X4DA 1NERA 1QP0A 1UXCA 4FN3A 4YG1A 4Y42A 4X4EA 4Z59A 1ZVVA 1RZRA 3SCHA 2GRLA 2MQKA 1WETA 2LYLA 4IVZA 3QF3A 2LYJA 2GRMA 3SCFA 2L8NA 2OFYA 1BDIA 3DNVB 3CECA 1QQBA 1ZAYA 4YG4A 4JCXA 2AXUA 2LYSA 4IA8A 3OQMA 3HZIB 4X4FA 4J1WA 1JFSA 3LFPA 4Z5CA 1EFAA 1JH9A 2IVBA 4YBAA 3H5TA 1LCDA 1B0NA 1OSLA 4I6RA 1ZZ8A 2CSFA 3GN5A 2JCGA 2PUFA 3G7DA 2PUGA 4MCTA 1IC8A 2BJCA 3IVPA 1RPEL 4PU7A 2PUDA 1ZZ6A 4PU3C 1LCCA 2PUAA 3F6WA 2XCJA 1Y9QA 3S8QA 3VK0A 3G5GA 1WH6A 2LYRA 2AXZA 1JWLA 2AW6A 4F8DA 2OR1L 2ICTA 1LQCA 2PUBA 2MEZA 2PIJA 1YSEA 1L1MA 1RZSA 2HSGA 1X2LA 3OMTA 2GZUA 2PUEA 1S7EA 2H8RA 2A6CA 2WUSR 1BDHA 1ZUGA 3UFDA 1CQTA 3FYMA 4MCXA 4NDWA 1LLIA 2IU7A 3MLFA 1UTXA 1ZZ7A 2EF8A 4PU4C 5K98B 1VPWA 4Z5HA 4JQDA 1HF0A 2FJRA 2XSDC 3ZHIA 3QWGA 1UXDA 2KPJA 4YG7B 3JXBC 1E3OC 3QYXA 4PU8A 1RZRD 2KEJA 1JFTA 1CJGA 3FYAA 2D5VA 3O9XA 3D1NI 2R63A 2JVLA 3BS3A 2IVQA 1PRAA 3GN5B 1QP7A 2L49A 2LCVA 3FMYA 3LISA 3CLCA 4JCYA 2XI8A 1WH8A 2KEIA 2IUOA 1Y7YA 3EUSA 1DW9A 3KXAA 4GQMA 4O8BA 4X4HA 3JXCL 3OP9A 1WIZA 3BDNA 2O4AA 3GBFA 3ZKCA 1ADRA 3F52A 4X4IA 1ZS4A 1QP4A 1XWRA 2KEKA 1R69A 2PE5A 4Z58A 2HINA 2ICPA 2WIUB 3BD1A 2XJ3A 4GHJA 4OB4A 2LYKA 1NEQA 3RZZA 1DWKA 1PRVA 2LYQA 3QQ6A 5A7LA 4X4GA 3PXPA 2PPXA 2BNMA 2BNNA 1SQ8A 3KJXA 1ZZCA 2B5AA 4FBIA 1OCTC 1ZZBA 4YARA 4Z5DA 3L1PA 1X57A 3R1FA 2BNOA 2XIUA 2KZ8A 4I6UA 3JXDL 1PERL 1R63A 4X4BA 1O4XA 2PUCA 3TRBA 2LYPA 3KZ3A
chains in the Genus database with same CATH superfamily
3GZDC 2MXDA 3OQOA 4J1XA 4DE8A 4EZIA 4I6TA 1PNRA 1ZZ9A 1GT0C 2O38A 2O49A 1AU7A 2LLWA 2AUWA 4X4DA 1UXCA 4FN3A 1ZVVA 3TELA 3A9ZA 3DNVB 4YG4A 3ZPXA 1EFAA 5JUWA 4EK9A 2IVBA 3QOWA 2JCGA 1RPEL 5GAHi 1LCCA 3GZCA 3VWSA 3G5GA 1WH6A 2AXZA 2OR1L 2MEZA 2PXVA 1YSEA 5DRYA 2HSGA 1X2LA 2PUEA 1S7EA 2A6CA 3UFDA 1CQTA 4NDWA 5K98B 2JQEA 3OKZA 3ZHIA 3NXHA 3QWGA 1UXDA 4YG7B 3O9XA 3D1NI 3A9YA 2PXUA 3FMYA 3LISA 2XI8A 1WH8A 4GQMA 3JXCL 3OP9A 1WIZA 3GBFA 3ZKCA 3SX0A 1QP4A 2PXEA 4WVLA 3BD1A 3QQ6A 4X4GA 2PPXA 2BNMA 2BNNA 2L1PA 3NDBB 4X4BA 2LYPA 3KZ3A 4EQZA 4X4CA 4HRAA 3U3WA 3F51A 2PXPA 2EBYA 3QFIA 3R09A 1QPZA 4ER3A 4X4EA 2GRLA 2MQKA 1WETA 2LYLA 4IVZA 2GRMA 2LYJA 3SCFA 1QQBA 2OFYA 1ZAYA 2HFZA 2AXUA 2LYSA 5DT2A 3OQMA 3HZIB 4J1WA 1JFSA 3LFPA 4Z5CA 1JH9A 3ME5A 1LCDA 4I6RA 2CSFA 3G7DA 3DM5A 2PUGA 2BJCA 3IVPA 1ZZ6A 5DTQA 2YBDA 3VK0A 2LYRA 2AW6A 4F8DA 2H8RA 3FYMA 4MCXA 1LLIA 2IU7A 3MLFA 1HF0A 4OBMA 3JXBC 3QYXA 2HCSA 2D5VA 2IVQA 2PXKA 1QP7A 2PXFA 2L49A 2LCVA 3EUSA 2O4AA 2FFHA 5DTRA 1ADRA 4X4IA 1ZS4A 1R69A 2PE5A 4Z58A 3TEPA 2WIUB 1O4XA 4OB4A 1NEQA 1DWKA 1PRVA 3KJXA 2PXDA 1OCTC 1X57A 4DE9A 3SCGA 1QZXA 1MFQC 1ZPQA 1QB2A 1LMB3 2V3CC 4I8TA 2R1JL 2LLVA 2AWIA 2IVGA 3CROL 1NERA 1QP0A 5DSXA 1BDIA 3CECA 3GZDA 4JCXA 1ZZ8A 3GN5A 1IC8A 2J7WA 4PU7A 4PU3C 2PUAA 3GUUA 1U2ZA 1Y9QA 2PIJA 3NROA 1L1MA 1RZSA 3OMTA 2GZUA 1BDHA 1ZUGA 1NW3A 1UTXA 1ZZ7A 2EF8A 1VPWA 2FJRA 2XSDC 2KPJA 4PU8A 1CJGA 2KEJA 3FYAA 3BS3A 3GN5B 2IUOA 1Y7YA 4X4HA 4O8BA 3BDNA 3F52A 3OWQA 2M4HA 2HINA 2ICPA 3RZZA 2XJ3A 2LYQA 5A7LA 3G0TA 3PXPA 1HQ1A 2B5AA 4FBIA 1ZZBA 4Z5DA 3L1PA 2XIUA 2KZ8A 4ER0A 3ZHMA 2CROA 2EWTA 3PE5A 2IV1A 1QQAA 2AXVA 1PRUA 4IWRA 3OQNA 3B7HA 1DULA 2XXAA 1RIOA 1POUA 4ER7A 4EKIA 4YG1A 4Y42A 4Z59A 1RZRA 3SCHA 3UWPA 2XXQA 3M9LA 3QF3A 2L8NA 3A9XA 4IA8A 4ER6A 4X4FA 5DTMA 4YBAA 3H5TA 1B0NA 1OSLA 2PUFA 4MCTA 2PUDA 3F6WA 2XCJA 3S8QA 1JWLA 2ICTA 1LQCA 2PUBA 2J7UA 3MEJA 2VEOA 3QOXA 3TFLA 2WUSR 2XXPA 4PU4C 4ER5A 4Z5HA 4JQDA 2HCNA 3KL4A 5DRTA 1E3OC 2LNMA 1JFTA 4EKGA 3SR4A 2R63A 2JVLA 1PRAA 3LQXA 4JCYA 3CLCA 2KEIA 1DW9A 3KXAA 2PXQA 3NZLA 1XWRA 2KEKA 2PXLA 1RZRD 4GHJA 2LYKA 1SQ8A 1ZZCA 5GAGi 2ODRD 4YARA 4Q2JA 3R1FA 1PERL 2BNOA 4I6UA 3JXDL 2PXTA 1R63A 2PUCA 3TRBA 2PXBA
chains in the Genus database with same CATH topology
3SCGA 3ZHMA 2CROA 4X4CA 2EWTA 3OQOA 4J1XA 3U3WA 4I6TA 1PNRA 1ZPQA 1ZZ9A 2IV1A 3F51A 1GT0C 2O38A 2AXVA 1PRUA 1LMB3 1QQAA 4IWRA 3OQNA 3B7HA 1AU7A 4I8TA 2R1JL 2O49A 2AWIA 2EBYA 2AUWA 1RIOA 2IVGA 1POUA 1QPZA 3CROL 4X4DA 1NERA 1QP0A 1UXCA 4FN3A 4YG1A 4Y42A 4X4EA 4Z59A 1ZVVA 1RZRA 3SCHA 2GRLA 2MQKA 1WETA 2LYLA 4IVZA 3QF3A 2LYJA 2GRMA 3SCFA 2L8NA 2OFYA 1BDIA 3DNVB 3CECA 1QQBA 1ZAYA 4YG4A 4JCXA 2AXUA 2LYSA 4IA8A 3OQMA 3HZIB 4X4FA 4J1WA 1JFSA 3LFPA 4Z5CA 1EFAA 1JH9A 2IVBA 4YBAA 3H5TA 1LCDA 1B0NA 1OSLA 4I6RA 1ZZ8A 2CSFA 3GN5A 2JCGA 2PUFA 3G7DA 2PUGA 4MCTA 1IC8A 2BJCA 3IVPA 1RPEL 4PU7A 2PUDA 1ZZ6A 4PU3C 1LCCA 2PUAA 3F6WA 2XCJA 1Y9QA 3S8QA 3VK0A 3G5GA 1WH6A 2LYRA 2AXZA 1JWLA 2AW6A 4F8DA 2OR1L 2ICTA 1LQCA 2PUBA 2MEZA 2PIJA 1YSEA 1L1MA 1RZSA 2HSGA 1X2LA 3OMTA 2GZUA 2PUEA 1S7EA 2H8RA 2A6CA 2WUSR 1BDHA 1ZUGA 3UFDA 1CQTA 3FYMA 4MCXA 4NDWA 1LLIA 2IU7A 3MLFA 1UTXA 1ZZ7A 2EF8A 4PU4C 5K98B 1VPWA 4Z5HA 4JQDA 1HF0A 2FJRA 2XSDC 3ZHIA 3QWGA 1UXDA 2KPJA 4YG7B 3JXBC 1E3OC 3QYXA 4PU8A 1RZRD 2KEJA 1JFTA 1CJGA 3FYAA 2D5VA 3O9XA 3D1NI 2R63A 2JVLA 3BS3A 2IVQA 1PRAA 3GN5B 1QP7A 2L49A 2LCVA 3FMYA 3LISA 3CLCA 4JCYA 2XI8A 1WH8A 2KEIA 2IUOA 1Y7YA 3EUSA 1DW9A 3KXAA 4GQMA 4O8BA 4X4HA 3JXCL 3OP9A 1WIZA 3BDNA 2O4AA 3GBFA 3ZKCA 1ADRA 3F52A 4X4IA 1ZS4A 1QP4A 1XWRA 2KEKA 1R69A 2PE5A 4Z58A 2HINA 2ICPA 2WIUB 3BD1A 2XJ3A 4GHJA 4OB4A 2LYKA 1NEQA 3RZZA 1DWKA 1PRVA 2LYQA 3QQ6A 5A7LA 4X4GA 3PXPA 2PPXA 2BNMA 2BNNA 1SQ8A 3KJXA 1ZZCA 2B5AA 4FBIA 1OCTC 1ZZBA 4YARA 4Z5DA 3L1PA 1X57A 3R1FA 2BNOA 2XIUA 2KZ8A 4I6UA 3JXDL 1PERL 1R63A 4X4BA 1O4XA 2PUCA 3TRBA 2LYPA 3KZ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SCG A;  3ZHM A;  2CRO A;  4X4C A;  2EWT A;  3OQO A;  4J1X A;  3U3W A;  4I6T A;  1PNR A;  1ZPQ A;  1ZZ9 A;  2IV1 A;  3F51 A;  1GT0 C;  2O38 A;  2AXV A;  1PRU A;  1LMB 3;  1QQA A;  4IWR A;  3OQN A;  3B7H A;  1AU7 A;  4I8T A;  2R1J L;  2O49 A;  2AWI A;  2EBY A;  2AUW A;  1RIO A;  2IVG A;  1POU A;  1QPZ A;  3CRO L;  4X4D A;  1NER A;  1QP0 A;  1UXC A;  4FN3 A;  4YG1 A;  4Y42 A;  4X4E A;  4Z59 A;  1ZVV A;  1RZR A;  3SCH A;  2GRL A;  2MQK A;  1WET A;  2LYL A;  4IVZ A;  3QF3 A;  2LYJ A;  2GRM A;  3SCF A;  2L8N A;  2OFY A;  1BDI A;  3DNV B;  3CEC A;  1QQB A;  1ZAY A;  4YG4 A;  4JCX A;  2AXU A;  2LYS A;  4IA8 A;  3OQM A;  3HZI B;  4X4F A;  4J1W A;  1JFS A;  3LFP A;  4Z5C A;  1EFA A;  1JH9 A;  2IVB A;  4YBA A;  3H5T A;  1LCD A;  1B0N A;  1OSL A;  4I6R A;  1ZZ8 A;  2CSF A;  3GN5 A;  2JCG A;  2PUF A;  3G7D A;  2PUG A;  4MCT A;  1IC8 A;  2BJC A;  3IVP A;  1RPE L;  4PU7 A;  2PUD A;  1ZZ6 A;  4PU3 C;  1LCC A;  2PUA A;  3F6W A;  2XCJ A;  1Y9Q A;  3S8Q A;  3VK0 A;  3G5G A;  1WH6 A;  2LYR A;  2AXZ A;  1JWL A;  2AW6 A;  4F8D A;  2OR1 L;  2ICT A;  1LQC A;  2PUB A;  2MEZ A;  2PIJ A;  1YSE A;  1L1M A;  1RZS A;  2HSG A;  1X2L A;  3OMT A;  2GZU A;  2PUE A;  1S7E A;  2H8R A;  2A6C A;  2WUS R;  1BDH A;  1ZUG A;  3UFD A;  1CQT A;  3FYM A;  4MCX A;  4NDW A;  1LLI A;  2IU7 A;  3MLF A;  1UTX A;  1ZZ7 A;  2EF8 A;  4PU4 C;  5K98 B;  1VPW A;  4Z5H A;  4JQD A;  1HF0 A;  2FJR A;  2XSD C;  3ZHI A;  3QWG A;  1UXD A;  2KPJ A;  4YG7 B;  3JXB C;  1E3O C;  3QYX A;  4PU8 A;  1RZR D;  2KEJ A;  1JFT A;  1CJG A;  3FYA A;  2D5V A;  3O9X A;  3D1N I;  2R63 A;  2JVL A;  3BS3 A;  2IVQ A;  1PRA A;  3GN5 B;  1QP7 A;  2L49 A;  2LCV A;  3FMY A;  3LIS A;  3CLC A;  4JCY A;  2XI8 A;  1WH8 A;  2KEI A;  2IUO A;  1Y7Y A;  3EUS A;  1DW9 A;  3KXA A;  4GQM A;  4O8B A;  4X4H A;  3JXC L;  3OP9 A;  1WIZ A;  3BDN A;  2O4A A;  3GBF A;  3ZKC A;  1ADR A;  3F52 A;  4X4I A;  1ZS4 A;  1QP4 A;  1XWR A;  2KEK A;  1R69 A;  2PE5 A;  4Z58 A;  2HIN A;  2ICP A;  2WIU B;  3BD1 A;  2XJ3 A;  4GHJ A;  4OB4 A;  2LYK A;  1NEQ A;  3RZZ A;  1DWK A;  1PRV A;  2LYQ A;  3QQ6 A;  5A7L A;  4X4G A;  3PXP A;  2PPX A;  2BNM A;  2BNN A;  1SQ8 A;  3KJX A;  1ZZC A;  2B5A A;  4FBI A;  1OCT C;  1ZZB A;  4YAR A;  4Z5D A;  3L1P A;  1X57 A;  3R1F A;  2BNO A;  2XIU A;  2KZ8 A;  4I6U A;  3JXD L;  1PER L;  1R63 A;  4X4B A;  1O4X A;  2PUC A;  3TRB A;  2LYP A;  3KZ3 A; 
#chains in the Genus database with same CATH topology
 3GZD C;  2MXD A;  3OQO A;  4J1X A;  4DE8 A;  4EZI A;  4I6T A;  1PNR A;  1ZZ9 A;  1GT0 C;  2O38 A;  2O49 A;  1AU7 A;  2LLW A;  2AUW A;  4X4D A;  1UXC A;  4FN3 A;  1ZVV A;  3TEL A;  3A9Z A;  3DNV B;  4YG4 A;  3ZPX A;  1EFA A;  5JUW A;  4EK9 A;  2IVB A;  3QOW A;  2JCG A;  1RPE L;  5GAH i;  1LCC A;  3GZC A;  3VWS A;  3G5G A;  1WH6 A;  2AXZ A;  2OR1 L;  2MEZ A;  2PXV A;  1YSE A;  5DRY A;  2HSG A;  1X2L A;  2PUE A;  1S7E A;  2A6C A;  3UFD A;  1CQT A;  4NDW A;  5K98 B;  2JQE A;  3OKZ A;  3ZHI A;  3NXH A;  3QWG A;  1UXD A;  4YG7 B;  3O9X A;  3D1N I;  3A9Y A;  2PXU A;  3FMY A;  3LIS A;  2XI8 A;  1WH8 A;  4GQM A;  3JXC L;  3OP9 A;  1WIZ A;  3GBF A;  3ZKC A;  3SX0 A;  1QP4 A;  2PXE A;  4WVL A;  3BD1 A;  3QQ6 A;  4X4G A;  2PPX A;  2BNM A;  2BNN A;  2L1P A;  3NDB B;  4X4B A;  2LYP A;  3KZ3 A;  4EQZ A;  4X4C A;  4HRA A;  3U3W A;  3F51 A;  2PXP A;  2EBY A;  3QFI A;  3R09 A;  1QPZ A;  4ER3 A;  4X4E A;  2GRL A;  2MQK A;  1WET A;  2LYL A;  4IVZ A;  2GRM A;  2LYJ A;  3SCF A;  1QQB A;  2OFY A;  1ZAY A;  2HFZ A;  2AXU A;  2LYS A;  5DT2 A;  3OQM A;  3HZI B;  4J1W A;  1JFS A;  3LFP A;  4Z5C A;  1JH9 A;  3ME5 A;  1LCD A;  4I6R A;  2CSF A;  3G7D A;  3DM5 A;  2PUG A;  2BJC A;  3IVP A;  1ZZ6 A;  5DTQ A;  2YBD A;  3VK0 A;  2LYR A;  2AW6 A;  4F8D A;  2H8R A;  3FYM A;  4MCX A;  1LLI A;  2IU7 A;  3MLF A;  1HF0 A;  4OBM A;  3JXB C;  3QYX A;  2HCS A;  2D5V A;  2IVQ A;  2PXK A;  1QP7 A;  2PXF A;  2L49 A;  2LCV A;  3EUS A;  2O4A A;  2FFH A;  5DTR A;  1ADR A;  4X4I A;  1ZS4 A;  1R69 A;  2PE5 A;  4Z58 A;  3TEP A;  2WIU B;  1O4X A;  4OB4 A;  1NEQ A;  1DWK A;  1PRV A;  3KJX A;  2PXD A;  1OCT C;  1X57 A;  4DE9 A;  3SCG A;  1QZX A;  1MFQ C;  1ZPQ A;  1QB2 A;  1LMB 3;  2V3C C;  4I8T A;  2R1J L;  2LLV A;  2AWI A;  2IVG A;  3CRO L;  1NER A;  1QP0 A;  5DSX A;  1BDI A;  3CEC A;  3GZD A;  4JCX A;  1ZZ8 A;  3GN5 A;  1IC8 A;  2J7W A;  4PU7 A;  4PU3 C;  2PUA A;  3GUU A;  1U2Z A;  1Y9Q A;  2PIJ A;  3NRO A;  1L1M A;  1RZS A;  3OMT A;  2GZU A;  1BDH A;  1ZUG A;  1NW3 A;  1UTX A;  1ZZ7 A;  2EF8 A;  1VPW A;  2FJR A;  2XSD C;  2KPJ A;  4PU8 A;  1CJG A;  2KEJ A;  3FYA A;  3BS3 A;  3GN5 B;  2IUO A;  1Y7Y A;  4X4H A;  4O8B A;  3BDN A;  3F52 A;  3OWQ A;  2M4H A;  2HIN A;  2ICP A;  3RZZ A;  2XJ3 A;  2LYQ A;  5A7L A;  3G0T A;  3PXP A;  1HQ1 A;  2B5A A;  4FBI A;  1ZZB A;  4Z5D A;  3L1P A;  2XIU A;  2KZ8 A;  4ER0 A;  3ZHM A;  2CRO A;  2EWT A;  3PE5 A;  2IV1 A;  1QQA A;  2AXV A;  1PRU A;  4IWR A;  3OQN A;  3B7H A;  1DUL A;  2XXA A;  1RIO A;  1POU A;  4ER7 A;  4EKI A;  4YG1 A;  4Y42 A;  4Z59 A;  1RZR A;  3SCH A;  3UWP A;  2XXQ A;  3M9L A;  3QF3 A;  2L8N A;  3A9X A;  4IA8 A;  4ER6 A;  4X4F A;  5DTM A;  4YBA A;  3H5T A;  1B0N A;  1OSL A;  2PUF A;  4MCT A;  2PUD A;  3F6W A;  2XCJ A;  3S8Q A;  1JWL A;  2ICT A;  1LQC A;  2PUB A;  2J7U A;  3MEJ A;  2VEO A;  3QOX A;  3TFL A;  2WUS R;  2XXP A;  4PU4 C;  4ER5 A;  4Z5H A;  4JQD A;  2HCN A;  3KL4 A;  5DRT A;  1E3O C;  2LNM A;  1JFT A;  4EKG A;  3SR4 A;  2R63 A;  2JVL A;  1PRA A;  3LQX A;  4JCY A;  3CLC A;  2KEI A;  1DW9 A;  3KXA A;  2PXQ A;  3NZL A;  1XWR A;  2KEK A;  2PXL A;  1RZR D;  4GHJ A;  2LYK A;  1SQ8 A;  1ZZC A;  5GAG i;  2ODR D;  4YAR A;  4Q2J A;  3R1F A;  1PER L;  2BNO A;  4I6U A;  3JXD L;  2PXT A;  1R63 A;  2PUC A;  3TRB A;  2PXB A; 
#chains in the Genus database with same CATH homology
 3SCG A;  3ZHM A;  2CRO A;  4X4C A;  2EWT A;  3OQO A;  4J1X A;  3U3W A;  4I6T A;  1PNR A;  1ZPQ A;  1ZZ9 A;  2IV1 A;  3F51 A;  1GT0 C;  2O38 A;  2AXV A;  1PRU A;  1LMB 3;  1QQA A;  4IWR A;  3OQN A;  3B7H A;  1AU7 A;  4I8T A;  2R1J L;  2O49 A;  2AWI A;  2EBY A;  2AUW A;  1RIO A;  2IVG A;  1POU A;  1QPZ A;  3CRO L;  4X4D A;  1NER A;  1QP0 A;  1UXC A;  4FN3 A;  4YG1 A;  4Y42 A;  4X4E A;  4Z59 A;  1ZVV A;  1RZR A;  3SCH A;  2GRL A;  2MQK A;  1WET A;  2LYL A;  4IVZ A;  3QF3 A;  2LYJ A;  2GRM A;  3SCF A;  2L8N A;  2OFY A;  1BDI A;  3DNV B;  3CEC A;  1QQB A;  1ZAY A;  4YG4 A;  4JCX A;  2AXU A;  2LYS A;  4IA8 A;  3OQM A;  3HZI B;  4X4F A;  4J1W A;  1JFS A;  3LFP A;  4Z5C A;  1EFA A;  1JH9 A;  2IVB A;  4YBA A;  3H5T A;  1LCD A;  1B0N A;  1OSL A;  4I6R A;  1ZZ8 A;  2CSF A;  3GN5 A;  2JCG A;  2PUF A;  3G7D A;  2PUG A;  4MCT A;  1IC8 A;  2BJC A;  3IVP A;  1RPE L;  4PU7 A;  2PUD A;  1ZZ6 A;  4PU3 C;  1LCC A;  2PUA A;  3F6W A;  2XCJ A;  1Y9Q A;  3S8Q A;  3VK0 A;  3G5G A;  1WH6 A;  2LYR A;  2AXZ A;  1JWL A;  2AW6 A;  4F8D A;  2OR1 L;  2ICT A;  1LQC A;  2PUB A;  2MEZ A;  2PIJ A;  1YSE A;  1L1M A;  1RZS A;  2HSG A;  1X2L A;  3OMT A;  2GZU A;  2PUE A;  1S7E A;  2H8R A;  2A6C A;  2WUS R;  1BDH A;  1ZUG A;  3UFD A;  1CQT A;  3FYM A;  4MCX A;  4NDW A;  1LLI A;  2IU7 A;  3MLF A;  1UTX A;  1ZZ7 A;  2EF8 A;  4PU4 C;  5K98 B;  1VPW A;  4Z5H A;  4JQD A;  1HF0 A;  2FJR A;  2XSD C;  3ZHI A;  3QWG A;  1UXD A;  2KPJ A;  4YG7 B;  3JXB C;  1E3O C;  3QYX A;  4PU8 A;  1RZR D;  2KEJ A;  1JFT A;  1CJG A;  3FYA A;  2D5V A;  3O9X A;  3D1N I;  2R63 A;  2JVL A;  3BS3 A;  2IVQ A;  1PRA A;  3GN5 B;  1QP7 A;  2L49 A;  2LCV A;  3FMY A;  3LIS A;  3CLC A;  4JCY A;  2XI8 A;  1WH8 A;  2KEI A;  2IUO A;  1Y7Y A;  3EUS A;  1DW9 A;  3KXA A;  4GQM A;  4O8B A;  4X4H A;  3JXC L;  3OP9 A;  1WIZ A;  3BDN A;  2O4A A;  3GBF A;  3ZKC A;  1ADR A;  3F52 A;  4X4I A;  1ZS4 A;  1QP4 A;  1XWR A;  2KEK A;  1R69 A;  2PE5 A;  4Z58 A;  2HIN A;  2ICP A;  2WIU B;  3BD1 A;  2XJ3 A;  4GHJ A;  4OB4 A;  2LYK A;  1NEQ A;  3RZZ A;  1DWK A;  1PRV A;  2LYQ A;  3QQ6 A;  5A7L A;  4X4G A;  3PXP A;  2PPX A;  2BNM A;  2BNN A;  1SQ8 A;  3KJX A;  1ZZC A;  2B5A A;  4FBI A;  1OCT C;  1ZZB A;  4YAR A;  4Z5D A;  3L1P A;  1X57 A;  3R1F A;  2BNO A;  2XIU A;  2KZ8 A;  4I6U A;  3JXD L;  1PER L;  1R63 A;  4X4B A;  1O4X A;  2PUC A;  3TRB A;  2LYP A;  3KZ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...