1SQAA

Substituted 2-naphthamidine inhibitors of urokinase
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interaction with the S1beta-pocket of urokinase: 8-heterocycle substituted and 6,8-disubstituted 2-naphthamidine urokinase inhibitors.
pubmed rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Urokinase-type plasminogen activator
total genus 55
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2004-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sqaA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sqaA01
2XWBI 1BTPA 5DP8A 2BOKA 3ZZCA 2F9BH 3RXCA 1C1TA 1K1IA 4OS5A 1UHBA 2BLQA 1P2QA 4X1SU 1W11U 2HNTE 1AQ7A 2PW8H 3O8BA 4BAMB 2PLXA 4DGJA 5L6NH 4D9QA 1S85A 2FOBA 1MKWK 1HGTH 4AORA 3MH6A 3FZZA 5T6FA 4X8UH 2ANKH 4NFEA 3ATMA 1T7CA 3MH7A 1C2MA 1O39A 1O2IA 3UUZA 2A2XH 1GG6B 2OC0A 4FVDA 1XM1A 1TPAE 1S83A 1RTLA 2KAIA 4YOJA 5T6GA 5DG6A 4ABAA 1SGPE 1SI5H 1HAIH 1DX5M 2XWAA 3SQEE 1CVWH 5AFZH 4ASHA 2P94A 1VZQH 2BDBA 2JETB 2GDDA 1O5GH 3HGNA 1HAZB 3NPSA 1O35A 4J2YB 2ZCKP 3P8NA 1Q31A 3H7TA 1SGRE 2UWLA 4HFPB 8LPRA 3M5LA 2QXHA 5J4QA 4B76A 4X6PA 3M3SA 4WXIA 3ATIA 3TJNA 1GHAG 2VGCC 2B7DH 1V2KT 1TNIA 2VIPA 1ELCA 3SJ9A 1H9HE 3LGTA 1W13U 3A83A 3VB4A 5LGOA 4HTCH 3GYLB 4FU9A 1AMHA 1QTFA 4ZKOU 2ZO3H 3V13A 1G3CA 1O37A 2BD9A 2SGPE 3M5MA 4CRFA 8ESTE 1ZYOA 1MU8B 4Q7YA 1EPTC 1OWIA 4IW4E 3OTJE 5EPYA 1BTWA 1MH0A 4Z6AH 1HFDA 4DOQA 1T8OA 2TGPZ 2VJ1A 1THSH 4HGCA 4ABIA 1KXCA 1HIAA 2Z3EA 2WPLS 1U6QA 5C5OA 1BA8B 4ZXYH 2QAAA 1ZMJA 1EAIA 3D49H 4CBOA 1XMNB 3M37A 1BQYA 1O2YA 3UTUH 2PR3A 1UVTH 2Q6DA 1A3BH 2FS9A 1LVMA 3AAUA 5DP4A 1FAXA 1MKXK 5GDSH 3A86A 1P04A 4AFUA 4O03A 1DWCH 3ELAH 2J4IA 2QV1A 2QXGA 1AZZA 4JK5A 1C2JA 1WBGB 2LNCA 2VB0A 5JYIA 2AMPA 4XBCA 2BX4A 3PM3A 1O3GA 1SQAA 2OLGA 3BTHE 4ABDA 1ZJKA 2GP9B 2ZP0H 4MNYA 3ESTA 1QHRB 2VIWA 4AZ2B 1OS8A 1P02A 4B2CA 4YM9A 1NFXA 3RMOH 1GBEA 4YOIA 3SV2H 2XXLA 2ZDLA 2XBVA 2A7JA 3HGPA 1QRZA 1ANCA 4FUCA 5EPNA 1BHXF 2ZECA 3E1XB 1NZQH 1HAPH 4E05H 2XC4A 1MTWA 3EE0B 2QF0A 3PMJA 2SGAA 1GBBA 4OS7A 3HK6B 2ZFSA 1GJAB 3DHKH 2BTCE 3EGKH 7GCHG 1SGCA 2GZ8A 2FWWA 2OINA 1SVPA 2H2ZA 1GMHF 1NPMA 1NFYA 3HK3B 3LH3A 1CT0E 2GCTB 3GY7A 1LCYA 5JBBS 3UNSA 7KMEH 3A7VA 2QF3A 3NXPA 3BEIB 3MO9A 1MBQA 1QURH 1SSXA 1GHAF 2OD3B 1Y3XA 2HPQH 1C2IA 1DWBH 1HCGA 4GUXA 2QY0B 5JBTA 4RSPA 4Y7AA 4MPVA 3E6PH 1SFIA 1UTJA 2AGEX 3SGAE 2JH0D 3P17H 4NIWA 1QY6A 1ZGVA 3E0NB 3RXAA 4ISOA 1L1GA 1ESBA 1RS0A 1UVOA 2ZFRH 2OXSA 1A1RA 3A85A 1PPBH 1DE7H 1SGEE 2BD7A 1CA8B 1VCQA 1DWEH 5IYTA 2BB4A 2ZZUH 1IQJA 4K60A 3DUXH 3BSQA 4UD9H 2F9PA 2ZHFH 4WMFA 3SBKA 2CXVA 1T8LA 4BAKB 3STJA 3MH5A 1OP8A 1O5BB 1QGFA 1TGCA 1RFNA 3RC4A 1KSNA 3L6PA 1LO6A 1ZTLA 2ZIQH 1LHGH 1O30A 4ISIH 4MQAA 3BG4C 1P06A 5A8ZA 1TAWA 5L2ZH 1C5OH 1WSSH 4UDWH 4AX9H 4ZKNU 3BEFB 2IJOB 2BD2A 2DE8A 1BRBE 4IC5A 4B73A 1D3DB 4BOHA 1YPKH 2FDAA 2WPMS 4MPXA 1RXPA 3FZDA 2BD3A 1BUIA 6GCHG 1C5ZB 1YPLH 1O3DA 1O5DH 2XBXA 1SOZA 3RDZA 4I31A 1MTNC 2TIOA 2M5TA 3PLBA 1UCYE 2H5DA 3GOVB 4K8BA 1SL3A 3EAJA 1TNHA 3PMBB 3GY2A 1NRQH 1IQFA 2C8YB 4Y6DA 1SQOA 2CF8H 3RXEA 2PKAB 4FUEA 1BBRE 4X8TH 4O3UA 4H42U 1GVZA 1LKBA 4NSYA 4CRDA 2V3HH 3GISB 2BLWA 3E8LA 5JB9S 3ZZBA 1EASA 2Y7XA 4OS4A 5F8ZA 3LONA 1O3IA 3A88A 3UREA 1F7ZA 1V2JT 2GCTC 1V2UT 2HGTH 1AO5A 1P9SA 1UCYH 2Y81A 1BB0B 4U30A 5E0GA 2BQWB 3TJUA 1UMAH 4B74A 4WMEA 1DM4B 2BDYA 3QTOH 1K9OE 4AYVB 1ZSJA 5FAHA 3RLYH 3LGYA 4M7GA 1YPJH 1XUGA 2G00A 1C2GA 4INHA 1O38A 1O2ZA 1N6XA 1MTNB 2QGRA 2C3SA 1DVAH 2XCNA 1Z8RA 4CREA 1B0FA 3U8TH 1F5RA 6CHAC 2CGAA 5JBCS 1HV7A 1RJXB 3RXHA 3T29A 2WUCA 1W0ZU 5EXMA 1SGQE 2HALA 1GI7B 2W7UA 5E2OA 1ELDE 2WV4A 3KQDA 2A4GA 1O0DH 5EW1H 3TJOA 1OWHA 2B0FA 1EB1H 3N7OA 4D7GA 2D8WA 1KTTB 4OGXA 1TWXB 2O8WA 1K28D 3A8AA 1DT2A 1TOMH 1O31A 2RG3A 3TPIZ 2AMDA 1C2HA 1VJ9U 4LZ4B 2ZGXH 3SNAA 4NWLA 3VPKA 2O8TA 1AKSB 4DVAU 4UFFH 4THNH 4MNXA 4Y8XA 1YPEH 4MG3A 1GJ5H 3U98H 3RXSA 1GMDG 2FM2A 2ZI2H 4YTAA 2A4OA 1GBDA 2TGDA 2ZKSA 2NU4E 1SG8B 4D9RA 2BDIA 1AU8A 3TH2H 1ARCA 3RXGA 2AGGX 2XC0A 1ZTKA 1Q3XA 1DPOA 1AWHB 1JOUB 1O5CB 4O3TA 3T62A 1F5KU 3EA9A 3QN7A 1EJAA 2BZ6H 4ZHAA 2JKHA 3FVFB 1SGYE 3MNBA 3UOPA 2UUKB 4LOYH 3MO3A 2ZCLP 2GVFA 2GX4A 1QFKH 2XBWA 2ZU3A 3FP7E 3GICB 3ATKA 5HMAA 1AVGH 2YNBA 3GY5A 3ZV9A 4BNRA 1QJ7B 5HXFA 1CHOG 2OC7A 3GY8A 2OQ5A 1LQEA 2BLVA 3V7TA 1SQTA 4NGAH 1DSUA 2FO9A 1J8AA 2Q1JA 1ZPCA 1UTQA 1P10A 3SO3A 4OS2A 1IQKA 2IPHA 4X8VH 3EQ0H 1OKXA 1LHFH 1AVWA 4Y7BA 2AERH 5TCCA 3LU9B 1LVBA 3RXKA 1ANDA 1YCPM 1CQQA 1C1QA 2OBOA 2PFEA 5GIBA 1NFUA 4FUJA 5EW2H 4B75A 1Y5AT 1O2MA 2OUAA 1TGTA 2CMYA 2O8UA 1GCTB 2J94A 3VB3A 1D9IA 1ABIH 1EJMA 1E35B 1QQ4A 1OPHB 1AE8H 1AFQC 4NIYA 1XXFA 1Z8IB 2G81E 1O2TA 4JCNA 4IMZA 3LJJA 3KIDU 1GI4A 1TFXA 3R0FA 4U01A 4FU8A 1AGJA 2TPIZ 1UTMA 2XNIA 3V0XA 2J92A 3M35A 2AFQB 1TX6A 1K1MA 4X1RU 2FP7B 2WINI 2ZU1A 2XBYA 1GBHA 1YP9A 1T8MA 4GSOA 3UOUA 1C5XB 2HPPH 2VIDA 2WYGA 2ZHDA 3PMAB 1Y3VA 1NT1A 1SLWB 4A92A 3K6YA 2GMTC 5CE1A 4FUFA 1Y3YA 1SBWA 4E7NA 1G3BA 2GZ7A 3OYPA 4JZFH 4WY3A 1NC6A 1OYQA 1C1WH 1TA2A 1KXEA 1INCA 1GVKB 1L1JA 1WV7H 4X2VA 2A32A 1PPEE 1JIRA 2BM2A 4NIXA 1M9UA 2Y5GA 4HI3A 3LGVA 4FU7A 4H6SB 3CS7A 3GCTG 1HJAB 1Z8GA 2ZDMA 2RA0A 3RM0H 2W5EA 4IBLH 1LDTT 3G01A 3GCOA 1GJ7B 3KEEA 1P05A 2I6QA 1PYTC 5BRRE 2ZC9H 1P01A 2BY5X 1T8NA 8GCHG 4MDSA 5A2MH 2BXUH 5AFYH 1MCTA 1B0EA 1ZMNA 5FPSA 5TJXA 1VITH 1BTYA 1O3PB 2V3OH 4ABHA 2Z7FE 2BVXH 1SLVB 1ELAA 4B71A 4YT6H 1OP0A 1V2MT 4NZQA 1QR3E 1Z7KA 1ZPBA 1FUJA 3L33A 1Y5UT 3ZZDA 1HYLA 3GY4A 3A7YA 1DLKB 1OXGA 2PGBB 3MU4A 4YLQH 1LKAA 1UTPA 3SI3H 1K22H 4PROA 1ZOMA 4LZ1H 3GCTF 3TGJE 2BYAX 1WQVH 4R0IA 1DITH 4NZLA 4NIVA 4WWYA 2FIRH 1QB9A 4AG2A 4AFSA 2F91A 2ZA5A 2Q6GA 2ZHEH 3MO6A 4ABEA 3LGIA 5LH8A 1SGTA 1O3FA 2CHAC 1BTXA 1O34A 1FI8A 1O2SA 4A7IB 2BY7X 3ZVDA 2Z9IA 1AKSA 1MTUA 1SGDE 1C5PA 3KQEA 3MU0A 1O2VA 3SNEA 3TJVA 4MPUA 3M7QA 3LGWA 2SNWA 1EUFA 3H7OA 4CRGA 1FY1A 4X2YA 4TY6A 1DUEA 3U9AH 9ESTA 3O8RA 1GPZA 1GBFA 2ZQ2A 2GZ9A 1GI8B 1GJ4H 4ZH8A 4GHTA 3V12A 5ESTE 1GBMA 1KXBA 2EC9H 1CA0C 1BMMH 2A4RA 2QCYA 4X8SH 4AYYB 1O2UA 4YT7H 4OS6A 3SGQE 1TALA 1C1VH 1VR1H 4UFEH 1VITF 3MYWA 4CRBA 1ZZZA 3BEUA 3WY8A 1TIOA 2P8OC 2Z9GA 1NO9H 2R2MB 3AVZA 1YPGH 3ZVGA 1V2TT 4I8GA 3ZVFA 5EQRA 3RU4T 1KLJH 2WUBA 4BTIB 2VNTA 1H9IE 5EU8A 1ESAA 4E7RG 3GY3A 3TLOA 1A46H 1DDJA 1YPMH 2ESTE 1ELEE 4X1NU 1THPB 1AZ8A 2ODQA 1ZPZA 3RLWH 3SUFA 1V3XA 3MI4A 1T32A 1A4WH 3AASA 1YKTA 3PLKA 1FIZA 1QRXA 2D2DA 2GD4B 4JZDH 2FOCA 4GVUA 1LHDH 3A7TA 1GBKA 1C4V2 2A7CA 1MMJN 4TWWA 5JBAS 1EAWA 7ESTE 1SLXB 1QJ6B 1D6WA 1W7GH 1E36B 1ELBA 5G4BA 4YZUA 7LPRA 1TB6H 1L1NA 2Y5HA 1JMOH 3FAOA 1C4U2 1K2I1 2LPRA 2VVCA 4KTUA 1MAXA 4UEHH 1F5LA 2TGAA 4IMQA 2PKSC 4KP0A 2FI4E 1GGDB 2DE9A 1BMNH 1HAGE 8KME2 4ISHH 1Z71A 1KXFA 1HAOH 3R3GB 2A45B 4X0WU 3QUMP 1AHTH 1C5TA 1HAVA 2BY6X 1NROH 1DOJA 1CE5A 4UFGH 2Y5FA 1CGHA 4OS1A 1P12E 1ZSKA 4AGKA 1TGBA 2EEKA 3A7XA 4B2BA 1TPSA 3LDXH 2NWNA 2NU0E 4NA7A 5DP9A 1D3QB 2ZTYA 2O9QA 4KKDA 2Y7ZA 1PPFE 1AVXA 1UJ1A 1YLCA 3NUMA 3KL6A 3SGBE 4YESB 1SHHB 4DW2U 1ID5H 1O3JA 1TLDA 1IHTH 4CR9A 1DXWA 3S7HB 5GCHG 3M36A 4GHQA 1GJ8B 4ABBA 2BDHA 4Y0YE 3PWBA 1C9PA 3QGNB 2ZGBH 2BZAA 1A0JA 1P11E 3RXMA 4BXWA 4BTUB 1KXDA 2W3IA 2Y82A 3AW1A 1J9CH 2C90B 3P8FA 1FY3A 5F03A 2ILNA 4DY7B 5C2ZA 4AFQA 1PQAA 2WV5A 3RXFA 1GI3A 4DT7B 2F3CE 1O3HA 1RRKA 3F9EA 2JETC 2FOAA 1UK2A 3BIUH 1O2LA 1WOFA 3TGKE 1C5VA 3SU4A 1HBTH 3SJIA 1G32B 3ODFA 1C2EA 1FZZA 2PGQB 1WTHD 2FI5E 1BRUP 4TPYA 3T2NA 3Q76A 5LPRA 1B7XB 1TX8A 4ABFA 3MNCA 1E38B 1SGFA 4X2XA 4U2WA 2XW9A 1S0QA 1KLTA 4K1EA 3GCHC 5C1UA 2NU3E 1N8OB 1LVYA 4XE4A 1HDTH 1GI5A 2ZWLH 1H4WA 3OSYA 1J14A 4Y79A 3ZZ8A 2PTCE 1NFWA 2BVSH 1MD8A 1F0SA 1ETTH 1GHYH 2A0QB 3E0PB 1A0LA 4ISNA 1GJCB 1Y8TA 2Y6TA 2OC1A 4FVBA 3VXFH 1EATA 1GHWH 1EPTA 1L4DA 1GHVH 1DLEA 3SI4H 1DUAA 1TBZH 4BTTB 3A8BA 3UPEA 1TONA 1NRSH 1P8VC 1BOQA 3IG6B 3SV8A 1ZGIA 3T26A 3C27B 4KELA 3GDUA 4GPGA 4GAWA 1DANH 4JK6A 1BJUA 2P16A 3BTFE 1QB1A 2TBSA 2FLRH 1ELVA 1C1OA 1DY9A 4X6OA 4ZHMU 2C8ZB 1GJBB 3MFJA 1XUFA 5F8XA 3PMHB 1XUIA 1F0RA 3M7TA 3PYHA 4I8HA 5EXLA 2GT7A 1BDAA 1CT4E 4K1TA 4XBBA 4GCHG 1UK4A 3P6ZB 4TY7A 2CN0H 1XKBC 3SQHE 2NU1E 2VINA 3F9GA 1SGFG 4IS5A 4ZKSU 4ZXXH 3DD2H 2OP9A 3FP6E 3SZNA 1GHXH 2FESH 4XBDA 2JH6D 1S6FA 1Y59T 3STIA 2EI7A 4K69A 3RMNH 1PPZA 3PWCA 4JYUH 2SGDE 4ZHLU 1W10U 2R9PA 1YLDA 3BTQE 1UCYK 2A2QH 2I6SA 2VWOA 1BT7A 2G5NA 1A5HA 1BTHH 1AFEH 2ASUB 3RXIA 1EP6A 3PV4A 1IAUA 9LPRA 1YGCH 1H8IH 4CH2B 1GDUA 2H9HA 3KCGH 3U1IB 1QB6A 1GBJA 2ZPSA 5E0HA 3M3VA 1SGIB 5DPAA 1EAUA 5EG4A 4INKA 1G9IE 3F1SB 3TNSA 1ZLRA 3RXBA 4IC6A 3RXLA 1UTNA 2STBE 3RC6A 4A1VA 1NTPA 2ZU2A 2QYIA 5DO4H 1KXAA 2FOEA 2PKAA 4DURA 3B9FH 1QL7A 3LIWA 5T6DA 3T5FH 4I8KA 4AOQA 3QWCH 3HKJB 3ODDA 1FDPA 1P2IA 2HWLB 3MU5A 4JZIA 3OY5U 5K7RA 2GGVB 2WYJA 2VWNA 2D26C 1TGSZ 5HYOA 1F2SE 2FLBH 3F9FA 3ATWA 3SU3A 1LPZB 3Q3XA 5JPMH 1EJNA 3TK9A 1CGIE 3VB6A 2HRVA 3OX7U 4CRCA 2ULLA 3VGCC 5HGGA 2TRMA 1MQ6A 3JZ1B 3SUEA 4CH8B 3U69H 3BG4B 1UHBB 5A0CA 1KYNA 1A61H 3M5OA 1A0HB 1HPGA 1LTOA 2EI6A 4INLA 1ZR0A 1QL9A 4ZROA 3PO1C 4CHAC 1FIWA 1W14U 2BD4A 5AVDA 2FMJA 3RXDA 1VCPA 4KTSA 2H1UA 1ANEA 2VWMA 1J15A 1OWEA 1O3EA 4YLUA 1LHEH 4I7YH 2JH5D 1AB9B 2A7HA 2Z3CA 1QL8A 3ATLA 1P2JA 3LPRA 5C1XA 3MNSA 3EA7A 3GDVA 5EOKA 2FI3E 4A6LA 1A5IA 1YCPK 1QIXB 1CBWC 4MTBA 4Q2KA 1D3PB 3ITIA 4UE7H 3ZZ9A 4WVPE 2H5CA 1D3TB 2QA9E 3RXJA 1VJAU 1TNJA 3H5CB 6CHAB 4WH6A 4FUHA 3AW0A 1FPCH 5EXNA 1V2OT 2R3YA 1GBTA 4QT8C 1JRTA 1C2DA 1EOJA 1EKBB 2A5IA 1HRTH 1O3KA 1DICA 4WXVA 2ZF0H 2OQUA 1IQHA 1TABE 4Y0ZE 4VGCB 4X1PU 3E16B 2AS9A 4B2AA 3D65E 4OGYA 4LXBH 2V35A 1TMUH 1FY4A 3S0NA 1MBMA 3SHCH 2G55A 3CENA 4H6TA 1O32A 3A81A 4DIHH 3P70B 1GI2A 1IOEA 2STAE 1JIMA 1EB2A 2WPIS 3VEQB 2RA3A 2VH0A 4XDEA 1CU1A 3DFJA 1K21H 1HAXB 2ZDAH 1TYNA 1AUTC 4CBNA 2FYRA 2QC2A 5DK1A 4BXSA 5GPIB 1C9TA 4WH8A 3LC3A 1GDNA 2SGQE 1IQMA 4Y11E 3E90B 1V6DA 1ANBA 3QX5H 4DIIH 2QIQA 1HJ9A 3GCHB 1C5MD 3VB5A 3L3TA 4D76A 1FY5A 3U1JB 4I33A 2ODYB 2ALPA 2XCFA 3A8CA 3RU4D 5LPFA 3SUGA 2V0BA 3BG8A 4I8LA 1MCVA 3K65B 3DFLA 1GCTC 1PQ7A 5FXLA 1WUNH 4XSKU 3MU1A 4AGJA 2ZDNA 1C1RA 4Z0KA 3RUOA 3SHAH 2XYAA 1ZTJA 2FTLE 1C5SA 1S82A 1BMLA 2BD5A 2ANYA 2BQ7B 1E34B 2SFAA 3SNDA 4YO9A 1MKXH 1LHCH 3SJOA 3TITA 1KIGH 2GV6A 1A3EH 1G2MA 3ZZ6A 4FUBA 2VVVA 1VGCC 1Z1JA 1UK3A 1FQ3A 1XUJA 1IQNA 1NRPH 2BQ6B 3SUDA 1K1NA 1O2NA 1GDQA 4K2YA 3RXTA 4FXGH 1RD3B 1XVOA 1XKAC 4A5TS 3I77A 5TCAA 1G2LA 1VGCB 2R2WU 4X2WA 1BBRK 2HNTF 5A0BA 3LGUA 1ZHMA 4ABGA 1MTSA 5FPYA 2C93B 1G3DA 1MZDA 2GKVE 2ZG0H 1V2PT 3AAVA 3QZRA 3U8RH 5AF9H 1PPGE 2BMGB 1OYTH 2ZFPH 3MMGA 3U8OH 1P9UA 3E91A 2BY9X 3A7WA 4BANB 5I25A 3D23A 2VGCB 1AIXH 3A82A 1P03A 1W7XH 3FFGA 5C67A 3UWJH 4O9VA 1EZSC 2PUQH 4B1TA 2Z9KA 1IQIA 3P95A 2W3KA 3RM2H 2BDCA 1O2QA 2QN5T 3TVJB 4NG9H 4JYTA 1D6RA 1GL0E 4Y10E 2A31A 1S81A 1C1NA 5IDKA 1ORFA 3RXPA 1O2GH 1QBOA 5EODA 1W3CA 1Y3WA 1EOLA 3SORA 2F9VA 2F9UA 4R8TB 5E2PA 1RGQA 4E06H 5CHAC 5JDUB 3CS0A 5ESBA 3M5NA 3BTKE 4Q7ZA 5BPEA 3M3TA 1O2JA 3UR6A 3RMMH 3A89A 5FCKA 2W26A 4XOJA 3SJKA 1T4UH 3SNCA 3ZZ4A 3Q3YA 4XFQA 1TX7A 1WU1A 1P57B 2UWPA 3BTTE 3BF6H 4TPIZ 1SOTA 1BRAA 1C2FA 3QK1A 1XXDA 4IN2A 5FHTA 1AD8H 4JZ1A 2GMTB 1GJDB 1BHXB 5GXPA 1TRYA 3QDZB 1MTVA 3RXRA 2BVRH 1A5GH 2BLOA 1Z6EA 1J16A 1PPCE 1FV9A 3GCNA 3EA8A 3IWMA 3NWUA 4AB9A 1Y5BT 1IHSH 3KGPA 1UVUH 1YBWA 4HZHA 1TNGA 1XX9A 3HATH 1CGJE 1TNLA 1CBWB 3UIRA 3SU1A 1O2HA 2CJIA 3LT3A 3SW2B 1LPKB 1YF4A 5F8TA 1F0UA 6ESTA 1GJ9B 3M7UA 1AFQB 2F83A 4MVNA 2J2UA 1Z6JH 2BY8X 3K9XB 4NFFA 1P2KA 2O8LA 1FONA 5DP5A 2HNTC 1DY8A 2V6NA 4I8JA 4AFZA 1WAYB 1MD7A 2VVUA 1TMBH 2ZNKH 4NA8A 2GDEH 5C1YA 3W95A 3SU6A 4CHAB 2G52A 5EGMA 1P2NA 2RCEA 2W7SA 3BV9B 5DKMA 5C20A 2IOTA 1C5LH 1VCWA 1WTGH 3ZZ5A 2VH6A 1O33A 2ZFFH 1FNIA 3B23B 4FUIA 3URDA 3UY9A 1GVLA 1O5FH 3RP2A 3ZYDA 1Z8JB 3LC5A 2Q6FA 2PHBA 1O2WA 3A80A 5LPEA 1GCDA 1V2NT 1C5YB 3ZYEA 2G4UA 1UTLM 1V2WT 3I78A 1ELGA 2O8MA 1UVPA 2Y80A 5A09A 3Q3KA 1P3CA 4GLYA 1KDQA 4K1SA 5PTPA 3BTGE 1HXEH 5L2YH 1FMGA 1AWFH 1RTFB 3RMLH 1IQEA 1HAYB 1L0ZA 1EX3A 2WPJS 3PTBA 1N1LA 1UTKA 1S6HA 1EZXC 3TIUA 5L30H 1OSSA 4AB8A 5FBEA 3GDSA 3T25A 3S9BA 1G3EA 5ABWA 1HXFH 1NS3A 1SHYA 5ETXA 3LOXA 3PLPA 4WF8A 1NESE 1NU7B 1MKWH 1DSTA 4VGCC 3RU4E 1V2LT 2OCVB 2P93A 2WPKS 2Z6BD 1HLTH 3NCLA 4D8NA 1XUHA 3I29A 2OBQA 2B8OH 3NKKA 1QCPA 1SB1H 1CO7E 2FEQH 1F92A 3KN2A 1TE0A 1AY6H 3EYDA 2TGTA 1GWAA 3O8DA 1W8BH 1OWDA 2SGEE 1FXYA 2XRCA 3TK6A 2P3TB 3NK8A 2FYQA 3GYMA 1QBVH 3S7KB 1YCPH 1HAVB 2ZHQH 3T27A 1C1MA 2ZU4A 3BTME 1PJPA 2J38A 3OY6U 1T4VH 1QA7A 1LMWB 1ZSLA 1HJAC 2D1JA 4Y8ZA 3ZV8A 2H9EH 1H9LB 4Y8YA 1AUJA 3UNQA 3W94A 4LK4A 1GI1A 2J34A 2B9LA 5DGJA 1K1LA 1L2EA 1TQ7B 2GV7A 1EAXA 3LJOA 1BRCE 1N6YA 4MLFB 5AHGH 1C2KA 1YPHC 2ZDVH 1C5WB 1GMCF 3TH4H 1O2RA 5FCRA 3V3MA 2FOGA 3C1KA 1PQ8A 4FUGA 5HM9A 1W0YH 1QNJA 1FLEE 1O2KA 1O36A 1HUTH 3OU0A 1HJ8A 3SNBA 1O3NA 2CF9H 2R3UA 3URCA 4WJG2 1GL1A 1A2CH 1P2MA 1SGNE 1E0FD 2C8WB 3F6UH 3K2UA 4K8YA 1WYKA 3M61U 2VIQA 3TU7H 3KNXA 1MAYA 1RTKA 1O3OA 1L4ZA 3A8DA 5A8XA 1DS2E 1Z1IA 3LH1A 1O3CA 3PROA 4ABJA 3BN9A 3KQCA 1ZRBA 1AI8H 2BXTH 3SV6A 3FANA 1D4PB 2SNVA 6LPRA 4SGBE 3ZVAA 1O2OA 3CP7A 2Z3DA 5T3HA 5DP6A 1AB9C 2G8TA 1V2RT 3QZQA 1AE5A 4ZKRU 1ZHRA 4Y71A 4X1QU 1JRSA 1TPOA 1LPGB 2GCHG 2BDAA 4MPWA 4DCDA 1H8DH 4DG4A 1ZJDA 3SU0A 4BAQB 1K1OA 3Q77A 2A5AA 1O3LA 1PFXC 3UR9A 2OC8A 1EZQA 1GI6A 1P3EA 3ZZAA 1EPTB 3F9HA 1P09A 1E37B 2VIOA 4IN1A 5CHAB 1C5NH 2PV9B 2AIQA 1UO6A 1YM0A 2AYWA 3LKWA 2P8OB 1SR5C 2WPHS 2A1DB 1FN6A 2AH4X 1EQ9A 3GY6A 4JZEH 2FS8A 8GCHF 1BITA 3P8OA 3PTNA 1VITG 2J9NA 4A1TA 1WCZA 1C5RA 1S0RA 1ZHPA 2A4QA 2C8XB 4X6NA 1JBUH 2BHGA 5J4SA 1TMTH 1O3MA 4F49A 1QA0A 3A7ZA 4KTCA 4Q80A 1GMHG 1DXPA 2AEIH 1LVOA 2ZGCA 3EDXB 2BOHB 1MQ5A 3T28A 2ODPA 1TBRH 1FAKH 1B5GH 5A8YA 2NU2E 2ZU5A 4CRAA 2F9NA 1ABJH 1TRMA 1GG6C 3ZZ7A 5HM2A 2PSXA 4AN7A 3NZIA 2PWXA 1C4Y2 1K1JA 2ZHWH 4F4OC 2FX6A 3HKIB 1BIOA 4K3JA 3D62A 4K5ZA 4NCYA 1EP5A 1C5UA 1G36A 2A5KA 1V2ST 4SGAE 1TPPA 2FOHA 2FTMA 2PUXB 1CSOE 1ESTA 1GBLA 2FXRA 5DP3A 1ELTA 4KGAA 3S9CA 1NY22 2XC5A 1BTUA 4MNWA 1MUEB 4D7FA 1SC8U 2GTBA 3IITA 4RKOB 5H4IB 1NU9A 4GCHF 1ZRKA 1NN6A 1UVSH 2VWLA 4YOGA 2ZFQH 3SJ8A 7GCHF 5GJ4B 3S69A 2BX3A 1Y3UA 1OWJA 3MTYA 3Q00A 5F6MA 2EI8A 1V2QT 2HVXA 3TGIE 1MU6B 3KQBA 3QTVH 5EQQA 4JYVH 1T31A 4I32A 1X7AC 2H6MA 1PPHE 4FUDA 1BJVA 2YNAA 3O8CA 2CV3A 3MNXA 1H1BA 2ANMH 1XVMA 2VIVA 2PSYA 1HB0B 1F0TA 2YOLA 4TWYA 4BAHB 2Z9JA 3BTDE 3QGJA 1PQ5A 2EA3A 5C3NA 2G5VA 4AG1A 1SLUB 5FBIA 3SU2A 4CR5A 3RXVA 4J1YA 3QLPH 3UQOA 4A1XA 1GI9B 1GBAA 4O97A 3SOSA 5B6OA 3MU8A 2FOFA 3MOCA 1BBRH 2HOBA 2ZFTA 3PB1E 2R0KA 2FX4A 1DWDH 3E3TA 1YPHE 1QBNA 1ETRH 2K1QA 2GCHF 1HAHH 1RIWC 5I46H 1WQSA 3K6ZA 3PO1B 1C5QA 4RN6A 1GBCA 1O2XA 1P2OA 1KDQB 2FZZA 3ZVBA 2G51A 1C1SA 2P3FH 1EZUC 1NRRH 4JMYA 2P95A 1GI0A 3TH3H 1CT2E 2ZTXA 5GWZA 3DA9B 1TQ0B 2UWOA 1N8OC 1TA6A 2ZPQA 5FX5A 4U32A 1IQGA 2ZPRA 3SV7A 5JB8S 1ELFA 4TYDA 4ZUHA 5CMXH 2Z9LA 1CA0B 2BDGA 1GJ6A 1FJSA 2ZTZA 3VXEH 1YC0A 1QQUA 1FN8A 1KY9A 3FP8E 1O3BA 2KAIB 2QXIA 3BIVH 4X6MA 4WMDA 2G4TA 1NRNH 1TGNA 3VFEA 1O2PA 2P59A 3VB7A 1EXFA 3A87A 1JXPA 4DJZB 4H4FA 2F9OA 1ETSH 1ACBE 5C5NA 1CHGA 3A84A 1YYY1 2ZDKA 3ENSB 3BTEE 4ESTE 3ZVEA 1UTOA 1TOCB 1XUKA 2ZGHA 3QO6A 1AN1E 5SGAE 4UFDH 3KHVA 1QRWA 4Q7XA 1K1PA 2CHAB 1GMCG 4Y76A 1C1PA 1S5SA 1P0SH 5DP7A 4IGDA 3UFAA 2GT8A 2BD8A 3MHWU 2FOMB 1GGDC 1ARBA 3F68H 2AMQA 2PKSB 3HPTB 3VGCB 4ISLA 3B8JA 1LQDB 3RC5A 1PYTD 1J17T 1W12U 4MNVA 1KLIH 1JWTA 4NSVA 3ZZ3A 2C4FH 2J95A 1ZMLA 3MH4A 1TNKA 1C1UH 4BAOB 1BZXE 5E0JA 1CHOF 1TBQH 5K0HA 1OX1A 1BMAA 2ALVA 2AIPA 2VU8E 2ANWA 4ZAEA 2QXJA 1GHZA 1IQLA 3S9AA 1GHBF 2OTVA 1W2KH 5A0AE 5E8EH 3RXQA 2RDLA 1OOKB 1RIWB 1O5AB 2ZCHP 2SGFE 2UUFB 3BTWE 2ZGJA 5FPTA 1QJ1B 3RXOA 5GCHF 2UUJB 3TNTA 1BCUH 3SN8A 1O5EH 3UNRA 1G37A 1O3AA 3TK5A 1A7SA 1HNEE 1OP2A 2PTNA 2FPZA 3ZVCA 4NA9H 2Z94A 4UONA 1Q2WA 1GMDF 1SFQB 3JZ2B 3KF2A 2P3UB 3UWIA 5DJ7A 2HLCA 2AGIX 1SMFE 2ZQ1A 4NWKA 1GHBG 1C2LA 2UUYA 2THFB 2ZEBA 2R0LA 1FPHH 3MWIU 3SV9A 3DT0H 1S84A 2DUCA 2H9TH 1G30B 1KTSB 1FY8E 1MZAA 1HIAB 1DFPA 1TRNA 4ZMAH 3SU5A 4RKJB 1BTZA 2IN2A 3P92A 1V2VT 5FX6A 1THRH 6GCHF 5EQSA 2FODA 1GBIA 1OWKA 1NM6A 3UQVA 3P8GA 3RXUA 2B5TB 1SPJA 2XTTB
chains in the Genus database with same CATH superfamily
2XWBI 1BTPA 5DP8A 2BOKA 3ZZCA 2F9BH 3RXCA 1C1TA 1K1IA 4OS5A 1UHBA 2BLQA 1P2QA 4X1SU 2V7QD 1W11U 2HNTE 1AQ7A 2PW8H 3O8BA 4BAMB 2PLXA 4DGJA 5L6NH 5C0UA 4D9QA 1S85A 2FOBA 1MKWK 1HGTH 4AORA 3MH6A 5T1VA 3FZZA 3FOAA 5T6FA 4X8UH 2ANKH 4NFEA 3ATMA 1T7CA 3MH7A 2LELA 1C2MA 1O39A 1O2IA 2KZ4A 3UUZA 2A2XH 1GG6B 2OC0A 4FVDA 1XM1A 1TPAE 1S83A 1RTLA 2KAIA 4YOJA 4B6EA 5T6GA 5DG6A 4ABAA 1SGPE 1SI5H 1HAIH 1DX5M 2XWAA 3SQEE 1CVWH 5AFZH 4ASHA 2P94A 1VZQH 2BDBA 2JETB 2GDDA 1O5GH 3HGNA 1HAZB 3NPSA 1O35A 4J2YB 2ZCKP 3P8NA 1Q31A 3H7TA 1SGRE 2UWLA 4HFPB 8LPRA 3M5LA 2QXHA 5J4QA 4B76A 4X6PA 3M3SA 4WXIA 3ATIA 3TJNA 1GHAG 2VGCC 2B7DH 1V2KT 1TNIA 2VIPA 1ELCA 3SJ9A 1H9HE 3LGTA 1W13U 3A83A 3VB4A 5LGOA 4HTCH 3GYLB 4FU9A 1AMHA 1QTFA 4ZKOU 2ZO3H 3V13A 1G3CA 1O37A 2BD9A 2SGPE 3M5MA 4CRFA 8ESTE 1ZYOA 1MU8B 4Q7YA 1EPTC 1OWIA 4IW4E 3OTJE 5EPYA 1BTWA 1MH0A 4Z6AH 1HFDA 4DOQA 1T8OA 2TGPZ 2VJ1A 1THSH 4HGCA 4ABIA 2HLDD 1KXCA 1HIAA 2Z3EA 2WPLS 1U6QA 5C5OA 1BA8B 4ZXYH 2QAAA 1ZMJA 1EAIA 3D49H 4CBOA 1XMNB 3M37A 1BQYA 1O2YA 3UTUH 2PR3A 1UVTH 2KCAA 2Q6DA 1A3BH 2FS9A 1LVMA 3AAUA 5DP4A 1FAXA 1MKXK 5GDSH 3A86A 1P04A 4AFUA 4O03A 1DWCH 3ELAH 2J4IA 3SYJA 2QV1A 2QXGA 1AZZA 4JK5A 1C2JA 1WBGB 2LNCA 2VB0A 3PV5A 5JYIA 2AMPA 4XBCA 2BX4A 3PM3A 1O3GA 1SQAA 2OLGA 3BTHE 4ABDA 1ZJKA 2GP9B 2ZP0H 4MNYA 3ESTA 1QHRB 5CHBA 2VIWA 4AZ2B 1OS8A 1P02A 4B2CA 4YM9A 1NFXA 3RMOH 1GBEA 4YOIA 3SV2H 2XXLA 2ZDLA 2XBVA 2A7JA 3HGPA 1QRZA 1ANCA 4FUCA 5EPNA 1BHXF 2ZECA 3E1XB 4B6FA 1NZQH 1HAPH 4E05H 2XC4A 1MTWA 3EE0B 2QF0A 3PMJA 2SGAA 1GBBA 4OS7A 3HK6B 2ZFSA 1GJAB 3DHKH 2BTCE 3DSGA 3EGKH 7GCHG 1SGCA 2GZ8A 2FWWA 2OINA 1SVPA 2H2ZA 1GMHF 1NPMA 1NFYA 3HK3B 3LH3A 1CT0E 2GCTB 3GY7A 1LCYA 5JBBS 3UNSA 7KMEH 3A7VA 2QF3A 3NXPA 3BEIB 3MO9A 1MBQA 1QURH 1SSXA 1GHAF 2OD3B 1Y3XA 2HPQH 1C2IA 1DWBH 1HCGA 4GUXA 2QY0B 5JBTA 4RSPA 4Y7AA 4MPVA 4TT3D 3E6PH 1SFIA 1UTJA 2AGEX 3SGAE 2JH0D 3P17H 4NIWA 1QY6A 1ZGVA 3E0NB 3RXAA 4ISOA 1L1GA 1ESBA 1RS0A 1UVOA 2ZFRH 2OXSA 1A1RA 3A85A 1QZ8A 1PPBH 1DE7H 1SGEE 2BD7A 1CA8B 1VCQA 1DWEH 5IYTA 2BB4A 2ZZUH 1IQJA 4K60A 3DUXH 3BSQA 4UD9H 2F9PA 2ZHFH 4WMFA 3SBKA 2CXVA 1T8LA 4BAKB 3STJA 3MH5A 1OP8A 1O5BB 3PRDA 1QGFA 1TGCA 1RFNA 2CK3D 3RC4A 1KSNA 3L6PA 1LO6A 1ZTLA 2ZIQH 1LHGH 1O30A 3FKSD 4ISIH 4MQAA 3BG4C 1P06A 5A8ZA 1TAWA 5L2ZH 1C5OH 1WSSH 4UDWH 4AX9H 4ZKNU 3BEFB 2IJOB 2BD2A 2KCOA 2DE8A 1BRBE 4IC5A 4B73A 1D3DB 4BOHA 1YPKH 2FDAA 2WPMS 4MPXA 1E79D 1RXPA 3FZDA 2BD3A 1BUIA 6GCHG 1C5ZB 1YPLH 1O3DA 1O5DH 2XBXA 1SOZA 3RDZA 4I31A 1MTNC 2TIOA 2M5TA 1SQRA 3PLBA 1UCYE 2H5DA 3GOVB 4K8BA 1SL3A 3EAJA 1TNHA 3PMBB 3GY2A 1NRQH 1IQFA 2C8YB 4Y6DA 1SQOA 2CF8H 3RXEA 2PKAB 4FUEA 1BBRE 2YMSD 4X8TH 4O3UA 4H42U 1GVZA 1LKBA 4NSYA 4CRDA 2V3HH 3U28C 3GISB 2BLWA 3E8LA 5JB9S 3ZZBA 1EASA 2Y7XA 4OS4A 3KYGA 5F8ZA 3LONA 1O3IA 3A88A 2XOKD 5CDFE 3UREA 1F7ZA 1V2JT 2GCTC 1V2UT 2HGTH 1AO5A 1P9SA 1UCYH 2Y81A 1BB0B 4U30A 5E0GA 2BQWB 3TJUA 1UMAH 4B74A 4WMEA 1DM4B 2BDYA 3QTOH 1K9OE 4AYVB 1ZSJA 5FAHA 3RLYH 3LGYA 4M7GA 1YPJH 1XUGA 2G00A 1NBME 2YMSB 1C2GA 4INHA 1O38A 1O2ZA 2LP6A 1N6XA 1MTNB 2QGRA 2YMSC 2C3SA 1DVAH 2XCNA 1Z8RA 4CREA 1B0FA 3U8TH 1F5RA 6CHAC 2CGAA 2K0QA 3W1EA 5JBCS 1HV7A 1RJXB 3RXHA 3T29A 2WUCA 1W0ZU 5EXMA 1SGQE 2HALA 1GI7B 2W7UA 5E2OA 1ELDE 2WV4A 3KQDA 2A4GA 1O0DH 5EW1H 2RFKC 3TJOA 1OWHA 2B0FA 1EB1H 3N7OA 4D7GA 2D8WA 1KTTB 4OGXA 1TWXB 2O8WA 1K28D 3A8AA 1DT2A 1TOMH 1O31A 2RG3A 3TPIZ 2AMDA 1C2HA 1VJ9U 4LZ4B 2ZGXH 3SNAA 4NWLA 3VPKA 2O8TA 1AKSB 4DVAU 4UFFH 4THNH 4MNXA 4Y8XA 1YPEH 4MG3A 1GJ5H 3U98H 4YXWD 3RXSA 1GMDG 2FM2A 2ZI2H 4YTAA 2A4OA 1GBDA 2TGDA 4ACBA 2ZKSA 2NU4E 1SG8B 4D9RA 2BDIA 1AU8A 3TH2H 1ARCA 3RXGA 2AGGX 2XC0A 1ZTKA 1Q3XA 1DPOA 1AWHB 1JOUB 1O5CB 4O3TA 3T62A 1F5KU 3EA9A 3QN7A 1EJAA 2BZ6H 4ZHAA 2JKHA 3FVFB 1SGYE 3MNBA 3UOPA 2UUKB 4LOYH 3MO3A 2ZCLP 2GVFA 2GX4A 1QFKH 2XBWA 2ZU3A 3FP7E 3GICB 3ATKA 5HMAA 1AVGH 2YNBA 5EJLA 2EY4C 3GY5A 3ZV9A 4BNRA 1QJ7B 5HXFA 1CHOG 2OC7A 1YWUA 2OQ5A 3GY8A 1LQEA 2BLVA 3V7TA 1SQTA 4NGAH 1DSUA 2FO9A 1J8AA 2Q1JA 1ZPCA 1UTQA 1P10A 3F2HA 2W6ID 3SO3A 4OS2A 1IQKA 2IPHA 4X8VH 3EQ0H 1OKXA 1LHFH 4AC9A 1MABB 3OTPA 1AVWA 4Y7BA 2AERH 5TCCA 3LU9B 1LVBA 3RXKA 1ANDA 4F48B 1YCPM 1CQQA 1C1QA 2OBOA 2PFEA 5GIBA 1NFUA 4FUJA 5EW2H 4B75A 1Y5AT 1O2MA 2OUAA 1TGTA 2CMYA 2O8UA 1GCTB 2J94A 3VB3A 1D9IA 1WXRA 1ABIH 1EJMA 1E35B 1QQ4A 1W0KD 2EQNA 1OPHB 1AE8H 1AFQC 4NIYA 1XXFA 1Z8IB 2G81E 1O2TA 4JCNA 4IMZA 3LJJA 3KIDU 1GI4A 1TFXA 3R0FA 4U01A 4FU8A 1AGJA 2TPIZ 1UTMA 2XNIA 3V0XA 2J92A 3AK5A 3M35A 2AFQB 1TX6A 1K1MA 2J5UA 4X1RU 2FP7B 2WINI 2ZU1A 2XBYA 1GBHA 1YP9A 1T8MA 4GSOA 3UOUA 2JDID 1C5XB 2HPPH 2VIDA 4DT4A 2WYGA 2ZHDA 3EE7A 3PMAB 1Y3VA 1NT1A 1SLWB 4A92A 3K6YA 2GMTC 5CE1A 4FUFA 1Y3YA 1SBWA 4E7NA 1G3BA 2QF4A 2GZ7A 3OYPA 4JZFH 4P00A 4WY3A 1NC6A 1H8HD 1OYQA 1C1WH 1TA2A 1KXEA 1INCA 1GVKB 3OE7D 1L1JA 1WV7H 3WW7A 4X2VA 2A32A 1PPEE 5FL7D 1JIRA 2BM2A 4NIXA 1M9UA 2Y5GA 4HI3A 3LGVA 4FU7A 4H6SB 3CS7A 3GCTG 1HJAB 1Z8GA 2ZDMA 2RA0A 3RM0H 2W5EA 4IBLH 1LDTT 3G01A 3GCOA 1GJ7B 3KEEA 1P05A 2I6QA 1PYTC 5BRRE 2ZC9H 1P01A 2BY5X 1T8NA 8GCHG 4MDSA 5A2MH 2BXUH 5AFYH 1MCTA 1B0EA 1ZMNA 5FPSA 5TJXA 1VITH 1BTYA 1O3PB 2V3OH 4ABHA 2Z7FE 2BVXH 1SLVB 1ELAA 1OHHD 4B71A 4YT6H 1OP0A 1V2MT 4NZQA 1QR3E 1Z7KA 1ZPBA 1FUJA 3L33A 1Y5UT 3ZZDA 1HYLA 3GY4A 3A7YA 1DLKB 5B6LA 1OXGA 2PGBB 3MU4A 4YLQH 1LKAA 1UTPA 3SI3H 1K22H 4PROA 1ZOMA 4LZ1H 3GCTF 3TGJE 2BYAX 1WQVH 4R0IA 1DITH 4NZLA 4NIVA 4WWYA 2FIRH 1QB9A 4AG2A 4AFSA 2F91A 2ZA5A 2Q6GA 2ZHEH 3MO6A 4ABEA 3LGIA 5LH8A 1SGTA 1O3FA 2CHAC 1BTXA 1O34A 1FI8A 1O2SA 4A7IB 2BY7X 3ZVDA 2Z9IA 1AKSA 1MTUA 1SGDE 1C5PA 3KQEA 3MU0A 1O2VA 4FETA 3SNEA 4MPUA 3TJVA 3NRLA 3M7QA 3LGWA 2SNWA 1EUFA 3H7OA 4CRGA 1FY1A 4X2YA 4TY6A 1DUEA 3U9AH 9ESTA 4I86A 3O8RA 1GPZA 1GBFA 2ZQ2A 2GZ9A 1GI8B 1COWD 1GJ4H 4ZH8A 4GHTA 5HIZA 3V12A 5ESTE 1GBMA 1KXBA 2EC9H 1CA0C 1BMMH 2A4RA 2QCYA 4X8SH 4AYYB 1O2UA 4YT7H 4OS6A 3SGQE 1TALA 1C1VH 1VR1H 4UFEH 3UB0A 1VITF 3MYWA 4CRBA 1ZZZA 3BEUA 3WY8A 1TIOA 2P8OC 2Z9GA 1NO9H 2R2MB 3F0OA 3AVZA 1YPGH 3ZVGA 1V2TT 4I8GA 3ZVFA 5EQRA 3RU4T 1KLJH 2WUBA 4BTIB 2VNTA 1H9IE 5EU8A 1ESAA 1S6LA 4E7RG 3GY3A 3TLOA 1A46H 1DDJA 1YPMH 2ESTE 1ELEE 4X1NU 1THPB 4XRNA 1AZ8A 2ODQA 1ZPZA 3RLWH 3SUFA 1V3XA 3MI4A 1T32A 1A4WH 3AASA 1YKTA 3PLKA 1FIZA 1QRXA 2D2DA 2PP6A 2GD4B 2KCPA 2FOCA 4GVUA 4JZDH 3DSOA 1LHDH 3A7TA 1GBKA 1C4V2 2A7CA 1MMJN 1E1QD 4TWWA 5JBAS 1EAWA 7ESTE 1SLXB 1QJ6B 1D6WA 1W7GH 1E36B 1ELBA 1FX0B 5G4BA 4YZUA 7LPRA 1TB6H 1L1NA 2Y5HA 1JMOH 3FAOA 1C4U2 1K2I1 2LPRA 2VVCA 4KTUA 1MAXA 4UEHH 1F5LA 2TGAA 4IMQA 2PKSC 4TSFD 4KP0A 2FI4E 1GGDB 1VKYA 2DE9A 1BMNH 1HAGE 8KME2 4ISHH 1Z71A 1KXFA 1HAOH 3R3GB 2A45B 4X0WU 3QUMP 1AHTH 1C5TA 1HAVA 2RDEA 2J98A 2BY6X 1NROH 1DOJA 1CE5A 4UFGH 2QF5A 2Y5FA 1CGHA 4OS1A 1P12E 1ZSKA 4AGKA 1TGBA 2EEKA 3A7XA 4B2BA 1TPSA 3LDXH 2NWNA 2NU0E 4NA7A 5DP9A 1D3QB 2ZTYA 4ACAA 2O9QA 4KKDA 2Y7ZA 2F43B 1PPFE 1AVXA 1UJ1A 1YLCA 3NUMA 3KL6A 3SGBE 4YESB 1SHHB 4DW2U 3DSPA 1ID5H 1O3JA 1TLDA 1IHTH 4CR9A 1DXWA 3S7HB 5KGOA 5GCHG 3M36A 4GHQA 1GJ8B 4ABBA 2BDHA 4Y0YE 3PWBA 1C9PA 2WSSD 3QGNB 2ZGBH 2BZAA 1A0JA 1P11E 3RXMA 4BXWA 4BTUB 1KXDA 2W3IA 2Y82A 3AW1A 1J9CH 2C90B 3P8FA 1FY3A 5F03A 2ILNA 4DY7B 5C2ZA 4AFQA 1PQAA 2WV5A 3RXFA 1GI3A 4DT7B 2F3CE 1O3HA 1RRKA 3F9EA 2JETC 5C17A 2FOAA 1UK2A 3BIUH 1O2LA 1WOFA 3TGKE 1C5VA 3SU4A 1HBTH 3SJIA 1G32B 3ODFA 3PV2A 1C2EA 1FZZA 5KECA 2PGQB 1WTHD 2FI5E 1BRUP 4TPYA 3T2NA 3Q76A 2KM0A 5LPRA 5F53A 1B7XB 1TX8A 2KX4A 4ABFA 2GJGA 3MNCA 1E38B 1SGFA 3N7EA 4X2XA 4U2WA 2XW9A 1S0QA 1KLTA 4K1EA 3GCHC 5C1UA 3OFND 2NU3E 1N8OB 1LVYA 4XE4A 1HDTH 1GI5A 2ZWLH 1H4WA 3OSYA 1J14A 4Y79A 3ZZ8A 2PTCE 1NFWA 2BVSH 1MD8A 1F0SA 1ETTH 1GHYH 2A0QB 3E0PB 1A0LA 4ISNA 1GJCB 1Y8TA 2Y6TA 2OC1A 5IK2D 4FVBA 3VXFH 1EATA 3DCLA 1GHWH 1EPTA 1L4DA 1GHVH 1DLEA 3SI4H 1DUAA 1TBZH 4BTTB 3A8BA 3UPEA 1TONA 1NRSH 1P8VC 1BOQA 3IG6B 3SV8A 1ZGIA 3T26A 3C27B 4KELA 3GDUA 4GPGA 4GAWA 1DANH 4JK6A 4RI0A 1BJUA 2P16A 3BTFE 1QB1A 2TBSA 2FLRH 1ELVA 1C1OA 1DY9A 4X6OA 4ZHMU 2C8ZB 1GJBB 3MFJA 1XUFA 2M2AA 3PMHB 5F8XA 1XUIA 1F0RA 3M7TA 3PYHA 4I8HA 5EXLA 2GT7A 1BDAA 1CT4E 4K1TA 4XBBA 4GCHG 1UK4A 3P6ZB 4TY7A 2CN0H 1XKBC 3SQHE 2NU1E 2VINA 3F9GA 1SGFG 4IS5A 4ZKSU 4ZXXH 3DD2H 3SZEA 2OP9A 3FP6E 2XNDD 3SZNA 1GHXH 2FESH 4XBDA 2JH6D 1S6FA 1WDIA 1Y59T 3STIA 1YY3A 2EI7A 4K69A 3RMNH 1PPZA 5DN6D 3PWCA 4JYUH 2SGDE 4ZHLU 1W10U 2R9PA 1YLDA 3BTQE 1UCYK 2A2QH 2I6SA 2VWOA 1BT7A 2G5NA 1A5HA 1BTHH 2AHME 1AFEH 2ASUB 3RXIA 1EP6A 3PV4A 1IAUA 9LPRA 1YGCH 1H8IH 4CH2B 1GDUA 2H9HA 3KCGH 3U1IB 1QB6A 1GBJA 2ZPSA 5E0HA 3M3VA 2K8IA 1SGIB 5C0TA 5DPAA 1EAUA 5EG4A 4INKA 1G9IE 3F1SB 3TNSA 1ZLRA 3RXBA 4IC6A 3RXLA 1UTNA 2STBE 3RC6A 4A1VA 1NTPA 2ZU2A 2QYIA 5DO4H 1KXAA 2FOEA 2PKAA 4DURA 3B9FH 1QL7A 3LIWA 5T6DA 3T5FH 4I8KA 4AOQA 3QWCH 3HKJB 3ODDA 1FDPA 1P2IA 2HWLB 3MU5A 4JZIA 3OY5U 5K7RA 2GGVB 2VWNA 2WYJA 2D26C 1TGSZ 5HYOA 1F2SE 2FLBH 3F9FA 3ATWA 3SU3A 1LPZB 3Q3XA 5JPMH 1EJNA 3TK9A 1CGIE 3VB6A 2HRVA 3OX7U 4CRCA 2ULLA 3VGCC 5HGGA 2TRMA 1MQ6A 3JZ1B 3SUEA 4CH8B 3U69H 3CNRA 2WZQA 1UHBB 3BG4B 5A0CA 1KYNA 1A61H 3M5OA 1A0HB 1HPGA 1LTOA 2EI6A 4INLA 1ZR0A 1QL9A 4ZROA 3PO1C 4CHAC 1FIWA 1W14U 2BD4A 5AVDA 2FMJA 3RXDA 1VCPA 3KYFA 4KTSA 1NBMD 2H1UA 3N99A 1ANEA 2VWMA 1J15A 1OWEA 1O3EA 4YLUA 1LHEH 4I7YH 2JH5D 1AB9B 2A7HA 2Z3CA 1QL8A 3ATLA 4RT1A 1P2JA 3LPRA 5C1XA 3MNSA 3EA7A 4Z1MD 3GDVA 5EOKA 2FI3E 4A6LA 1A5IA 1YCPK 1QIXB 1CBWC 4MTBA 4Q2KA 1D3PB 3ITIA 4UE7H 3ZZ9A 4WVPE 2H5CA 1D3TB 2QA9E 3RXJA 1VJAU 1TNJA 3H5CB 6CHAB 4WH6A 4FUHA 3AW0A 1EFRD 1FPCH 5EXNA 1V2OT 2R3YA 1GBTA 4QT8C 1JRTA 1C2DA 1EOJA 1EKBB 2A5IA 1HRTH 1O3KA 2WV9A 1DICA 4WXVA 2ZF0H 2OQUA 1IQHA 1TABE 4Y0ZE 4VGCB 4X1PU 3E16B 2AS9A 4B2AA 3D65E 4OGYA 4LXBH 2V35A 1TMUH 1FY4A 3S0NA 1MBMA 3SHCH 5C94A 2G55A 3CENA 4H6TA 1O32A 3A81A 4DIHH 3P70B 1GI2A 1IOEA 2STAE 5GNDA 1JIMA 1EB2A 2WPIS 3VEQB 2RA3A 2VH0A 4XDEA 1CU1A 3DFJA 1K21H 1HAXB 2ZDAH 1TYNA 1AUTC 4CBNA 2FYRA 2QC2A 5DK1A 4BXSA 5GPIB 1C9TA 4WH8A 3LC3A 1GDNA 2SGQE 1IQMA 4Y11E 3E90B 1V6DA 1ANBA 3QX5H 1BMFD 4DIIH 2QIQA 1HJ9A 3GCHB 1C5MD 3VB5A 3L3TA 4D76A 1FY5A 3U1JB 4I33A 2ODYB 2ALPA 2XCFA 3A8CA 3RU4D 5LPFA 3SUGA 2V0BA 3BG8A 4I8LA 1MCVA 3K65B 3DFLA 1GCTC 1PQ7A 3F2GA 1WUNH 4XSKU 3MU1A 5FXLA 4AGJA 2ZDNA 1C1RA 4Z0KA 3RUOA 3SHAH 2XYAA 1ZTJA 2FTLE 1C5SA 1S82A 1BMLA 2BD5A 2ANYA 2BQ7B 1E34B 2SFAA 3SNDA 4YO9A 1MKXH 1LHCH 3SJOA 3TITA 1KIGH 2GV6A 1A3EH 1G2MA 3ZZ6A 4FUBA 2VVVA 1VGCC 1Z1JA 2JJ1D 1UK3A 1FQ3A 1XUJA 1IQNA 1NRPH 2BQ6B 3SUDA 1K1NA 1O2NA 1GDQA 4K2YA 3RXTA 4FXGH 1RD3B 1XVOA 1XKAC 4A5TS 3I77A 5TCAA 1G2LA 1VGCB 2R2WU 4X2WA 1BBRK 2HNTF 5A0BA 3LGUA 1ZHMA 4ABGA 1MTSA 5FPYA 2C93B 1G3DA 1MZDA 2GKVE 3VG8A 2ZG0H 1V2PT 3AAVA 3QZRA 3U8RH 5AF9H 2W6JD 1PPGE 2BMGB 1OYTH 2ZFPH 3MMGA 3U8OH 1P9UA 3E91A 2BY9X 3A7WA 4BANB 5I25A 3D23A 2VGCB 1AIXH 3A82A 1P03A 1W7XH 3FFGA 3ZIAD 5C67A 3UWJH 4O9VA 1EZSC 2PUQH 3WWBA 4B1TA 2Z9KA 1IQIA 3P95A 2W3KA 3RM2H 3FO8D 2BDCA 1O2QA 2QN5T 3TVJB 4NG9H 3F3BA 4JYTA 1D6RA 1GL0E 4Y10E 2A31A 1S81A 1C1NA 5IDKA 1ORFA 3RXPA 1O2GH 1QBOA 3F2FA 5EODA 1W3CA 1Y3WA 1EOLA 3SORA 2J98B 2F9VA 2F9UA 4R8TB 5E2PA 1RGQA 4E06H 5CHAC 5JDUB 3CS0A 5ESBA 3M5NA 3BTKE 4Q7ZA 5BPEA 3M3TA 1O2JA 3UR6A 3RMMH 3A89A 5FCKA 2W26A 4XOJA 3SJKA 1T4UH 3SNCA 3ZZ4A 3Q3YA 4XFQA 1TX7A 1WU1A 1P57B 2UWPA 3BTTE 3BF6H 4P02A 4TPIZ 1SOTA 1BRAA 1C2FA 3QK1A 1XXDA 4IN2A 5FHTA 1AD8H 4JZ1A 2GMTB 1GJDB 1BHXB 1H8ED 5GXPA 1TRYA 3QDZB 1MTVA 3RXRA 2BVRH 1A5GH 2BLOA 1Z6EA 1J16A 1PPCE 1FV9A 1YLNA 3EA8A 3GCNA 3IWMA 3NWUA 4AB9A 1K0HA 1Y5BT 1IHSH 2HVYB 3KGPA 1UVUH 1YBWA 4HZHA 1TNGA 1XX9A 3HATH 1CGJE 1TNLA 4FOUC 1CBWB 3UIRA 3SU1A 1O2HA 4XD7D 2CJIA 5HIYA 3LT3A 3SW2B 1LPKB 1YF4A 5F8TA 1F0UA 6ESTA 1GJ9B 3M7UA 1AFQB 2F83A 4MVNA 2J2UA 1Z6JH 2BY8X 3K9XB 2KFWA 4NFFA 1P2KA 2O8LA 1FONA 5DP5A 2HNTC 1DY8A 2V6NA 4I8JA 4AFZA 1WAYB 1MD7A 2VVUA 1TMBH 2ZNKH 4NA8A 2GDEH 5C1YA 3W95A 3SU6A 4CHAB 2G52A 5EGMA 1P2NA 4HG6A 2RCEA 2W7SA 3BV9B 5DKMA 5C20A 2IOTA 1C5LH 1VCWA 1WTGH 3ZZ5A 2VH6A 4ASUD 1O33A 2ZFFH 1FNIA 3B23B 4FUIA 3URDA 3UY9A 1GVLA 3FN8A 1O5FH 3RP2A 3ZYDA 1Z8JB 3LC5A 2Q6FA 2PHBA 1O2WA 3A80A 5LPEA 1GCDA 1V2NT 1C5YB 3ZYEA 2G4UA 1UTLM 1V2WT 3I78A 1ELGA 2O8MA 1UVPA 2Y80A 5A09A 3Q3KA 1P3CA 4GLYA 1KDQA 4K1SA 5PTPA 3BTGE 1HXEH 5L2YH 1FMGA 1AWFH 1RTFB 3RMLH 1IQEA 1HAYB 2KCYA 1EX3A 1L0ZA 2WPJS 3PTBA 1N1LA 1UTKA 5EJZA 3MQKC 1S6HA 1EZXC 3TIUA 5L30H 1OSSA 4AB8A 5FBEA 3GDSA 3T25A 3S9BA 1G3EA 5ABWA 1HXFH 1NS3A 1SHYA 5EIYA 5ETXA 3LOXA 3PLPA 4WF8A 1NESE 1NU7B 1MKWH 1DSTA 4VGCC 3RU4E 1V2LT 2OCVB 2P93A 2WPKS 2Z6BD 1HLTH 3NCLA 4D8NA 1XUHA 3I29A 2OBQA 2B8OH 3NKKA 1QCPA 1SB1H 1CO7E 2FEQH 1KMHB 1F92A 3KN2A 1TE0A 1SKYE 1AY6H 3EYDA 2TGTA 1GWAA 3O8DA 4OM9A 1W8BH 1OWDA 2JIZD 2SGEE 1FXYA 2XRCA 3TK6A 2P3TB 3NK8A 2FYQA 3GYMA 1QBVH 3S7KB 1YCPH 1HAVB 2ZHQH 3T27A 1C1MA 2WHXA 2ZU4A 3BTME 1PJPA 2J38A 3OY6U 1T4VH 1QA7A 1LMWB 1ZSLA 1HJAC 2D1JA 4Y8ZA 1UW7A 3ZV8A 2H9EH 1H9LB 4Y8YA 1AUJA 3UNQA 3W94A 4LK4A 1GI1A 5HKKD 2J34A 2B9LA 5DGJA 1K1LA 1L2EA 1TQ7B 2GV7A 4Q63A 1EAXA 3LJOA 1BRCE 1N6YA 4MLFB 5AHGH 1C2KA 1YPHC 2ZDVH 1C5WB 1GMCF 3TH4H 1O2RA 5FCRA 3V3MA 2FOGA 3C1KA 1PQ8A 2QE7D 4FUGA 5HM9A 4Q4LA 1W0YH 1QNJA 1FLEE 1O2KA 1O36A 1HUTH 3OU0A 1HJ8A 3SNBA 1O3NA 2CF9H 2R3UA 3URCA 4WJG2 1GL1A 1A2CH 1P2MA 1SGNE 1E0FD 2C8WB 3F6UH 3K2UA 4K8YA 1WYKA 3M61U 2VIQA 3TU7H 3KNXA 1MAYA 1RTKA 1O3OA 1L4ZA 3A8DA 5A8XA 1DS2E 1Z1IA 3LH1A 1O3CA 3PROA 4ABJA 3BN9A 3KQCA 1ZRBA 4RT0A 1AI8H 2BXTH 3SV6A 3FANA 1D4PB 2SNVA 6LPRA 4SGBE 3ZVAA 1O2OA 3CP7A 2Z3DA 5T3HA 5DP6A 1AB9C 2G8TA 1V2RT 3QZQA 1AE5A 4ZKRU 1ZHRA 4Y71A 4X1QU 1JRSA 1TPOA 1LPGB 2GCHG 2BDAA 4MPWA 4DCDA 1H8DH 3N7DA 4DG4A 1ZJDA 3SU0A 4BAQB 4F55A 1K1OA 3Q77A 2A5AA 1O3LA 1PFXC 3UR9A 2OC8A 1EZQA 1GI6A 1P3EA 3ZZAA 1EPTB 3F9HA 1P09A 1E37B 2VIOA 4IN1A 5CHAB 1C5NH 2PV9B 2AIQA 1UO6A 1YM0A 2AYWA 3LKWA 2P8OB 1SR5C 2WPHS 2A1DB 1FN6A 2AH4X 1EQ9A 3GY6A 4JZEH 2FS8A 8GCHF 1BITA 3P8OA 3PTNA 1VITG 2J9NA 4A1TA 1WCZA 1C5RA 1S0RA 1ZHPA 2A4QA 2C8XB 4X6NA 1JBUH 2BHGA 5J4SA 1TMTH 1O3MA 4F49A 1QA0A 3A7ZA 4KTCA 4Q80A 1GMHG 1DXPA 2AEIH 1LVOA 2ZGCA 3EDXB 2BOHB 1MQ5A 3T28A 2ODPA 1TBRH 1FAKH 1B5GH 5A8YA 2NU2E 2ZU5A 4CRAA 2F9NA 1ABJH 1TRMA 1GG6C 3ZZ7A 5HM2A 2PSXA 4AN7A 3NZIA 2PWXA 1C4Y2 1K1JA 2ZHWH 4F4OC 2FX6A 3HKIB 1BIOA 4K3JA 3D62A 4K5ZA 4NCYA 3OAAD 1EP5A 1C5UA 1G36A 2A5KA 1V2ST 4SGAE 1TPPA 2FOHA 2FTMA 2PUXB 1CSOE 1ESTA 1GBLA 2FXRA 5DP3A 1ELTA 4KGAA 3S9CA 1NY22 2XC5A 1BTUA 4MNWA 1MUEB 4D7FA 1SC8U 2GTBA 3IITA 4RKOB 5H4IB 1NU9A 4GCHF 1ZRKA 1NN6A 1UVSH 2VWLA 1E1RD 2ZFQH 5DSFA 4YOGA 3SJ8A 7GCHF 5GJ4B 3S69A 2BX3A 1Y3UA 1OWJA 3MTYA 3Q00A 5F6MA 2EI8A 1V2QT 2HVXA 3TGIE 1MU6B 3KQBA 3QTVH 5EQQA 4JYVH 1T31A 4I32A 1X7AC 2J97A 2H6MA 1PPHE 4FUDA 1BJVA 2YNAA 3O8CA 2CV3A 3MNXA 1H1BA 2ANMH 1XVMA 2VIVA 2PSYA 1HB0B 1F0TA 2YOLA 4TWYA 4BAHB 2Z9JA 3BTDE 3QGJA 1PQ5A 2EA3A 5C3NA 2G5VA 4AG1A 1SLUB 5FBIA 3SU2A 4CR5A 3RXVA 4J1YA 3QLPH 3UQOA 4A1XA 2L6OA 1GI9B 1GBAA 4O97A 3SOSA 5B6OA 3MU8A 5EJ1A 2FOFA 3MOCA 1BBRH 2HOBA 2ZFTA 3PB1E 2R0KA 2FX4A 1DWDH 3E3TA 1YPHE 1QBNA 2WPDD 1ETRH 2K1QA 2GCHF 1HAHH 1RIWC 5I46H 1WQSA 3K6ZA 3PO1B 1C5QA 4RN6A 1GBCA 1O2XA 3KQ5A 1P2OA 1KDQB 2FZZA 3ZVBA 2G51A 1C1SA 2P3FH 1EZUC 4M9FA 1NRRH 4JMYA 2P95A 1GI0A 3TH3H 1CT2E 2ZTXA 5GWZA 3DA9B 1TQ0B 2UWOA 1N8OC 1TA6A 2ZPQA 5FX5A 4U32A 1IQGA 2ZPRA 3SV7A 5JB8S 1ELFA 4TYDA 4ZUHA 5CMXH 2KR7A 2Z9LA 1CA0B 2BDGA 1GJ6A 1FJSA 2ZTZA 3OEHD 3VXEH 1YC0A 1QQUA 2IPQX 1FN8A 1KY9A 3FP8E 2F4LA 1O3BA 2KAIB 2QXIA 3BIVH 4X6MA 4WMDA 2G4TA 1NRNH 1TGNA 3VFEA 1O2PA 2P59A 3VB7A 1EXFA 3A87A 1JXPA 4DJZB 4H4FA 2F9OA 1ETSH 1ACBE 5C5NA 1CHGA 3A84A 1YYY1 2ZDKA 3ENSB 3BTEE 4ESTE 3ZVEA 1UTOA 1TOCB 1XUKA 2ZGHA 3QO6A 1AN1E 5SGAE 4UFDH 3KHVA 3PRBA 1QRWA 4Q7XA 1K1PA 2CHAB 1GMCG 4Y76A 1C1PA 1S5SA 1P0SH 3F0PA 5DP7A 4IGDA 3UFAA 2GT8A 2BD8A 3MHWU 2FOMB 1GGDC 1ARBA 3F68H 2AMQA 2PKSB 3HPTB 3VGCB 4ISLA 3B8JA 1LQDB 3RC5A 2VBCA 1PYTD 1J17T 1W12U 4MNVA 1KLIH 1JWTA 4NSVA 3ZZ3A 2C4FH 2J95A 1ZMLA 3MH4A 1TNKA 1C1UH 4BAOB 1BZXE 5E0JA 1CHOF 1TBQH 5K0HA 1OX1A 1BMAA 3UAIC 2ALVA 2AIPA 2V3MA 2VU8E 2ANWA 4ZAEA 2QXJA 5KEDA 1GHZA 1IQLA 3S9AA 1GHBF 2OTVA 1W2KH 5A0AE 5E8EH 3RXQA 2L74A 2RDLA 1OOKB 1RIWB 1O5AB 2ZCHP 2SGFE 2UUFB 3BTWE 2ZGJA 5FPTA 1QJ1B 3RXOA 5GCHF 2UUJB 2OK5A 3TNTA 1BCUH 3SN8A 1O5EH 3UNRA 1G37A 1O3AA 3H09A 3TK5A 1A7SA 2IJD1 1HNEE 1OP2A 2PTNA 2FPZA 3ZVCA 4NA9H 2Z94A 4UONA 1Q2WA 1GMDF 1SFQB 3GS9A 3JZ2B 3KF2A 2P3UB 3UWIA 5DJ7A 2HLCA 2AGIX 1SMFE 2ZQ1A 4NWKA 1GHBG 1C2LA 4ZCNA 2UUYA 3OEED 2THFB 2ZEBA 2R0LA 1FPHH 3MWIU 3SV9A 3DT0H 1S84A 2DUCA 2H9TH 1G30B 1KTSB 1FY8E 1MZAA 1HIAB 1DFPA 1TRNA 4ZMAH 3WWFA 1W0JD 3SU5A 2JJ2D 4RKJB 1BTZA 2IN2A 3P92A 1V2VT 5FX6A 1THRH 6GCHF 5EQSA 2FODA 1GBIA 1OWKA 1NM6A 3UQVA 3P8GA 3RXUA 2B5TB 1SPJA 2XTTB
chains in the Genus database with same CATH topology
2XWBI 1BTPA 5DP8A 2BOKA 3ZZCA 2F9BH 3RXCA 1C1TA 1K1IA 4OS5A 1UHBA 2BLQA 1P2QA 4X1SU 1W11U 2HNTE 1AQ7A 2PW8H 3O8BA 4BAMB 2PLXA 4DGJA 5L6NH 4D9QA 1S85A 2FOBA 1MKWK 1HGTH 4AORA 3MH6A 3FZZA 5T6FA 4X8UH 2ANKH 4NFEA 3ATMA 1T7CA 3MH7A 1C2MA 1O39A 1O2IA 3UUZA 2A2XH 1GG6B 2OC0A 4FVDA 1XM1A 1TPAE 1S83A 1RTLA 2KAIA 4YOJA 5T6GA 5DG6A 4ABAA 1SGPE 1SI5H 1HAIH 1DX5M 2XWAA 3SQEE 1CVWH 5AFZH 4ASHA 2P94A 1VZQH 2BDBA 2JETB 2GDDA 1O5GH 3HGNA 1HAZB 3NPSA 1O35A 4J2YB 2ZCKP 3P8NA 1Q31A 3H7TA 1SGRE 2UWLA 4HFPB 8LPRA 3M5LA 2QXHA 5J4QA 4B76A 4X6PA 3M3SA 4WXIA 3ATIA 3TJNA 1GHAG 2VGCC 2B7DH 1V2KT 1TNIA 2VIPA 1ELCA 3SJ9A 1H9HE 3LGTA 1W13U 3A83A 3VB4A 5LGOA 4HTCH 3GYLB 4FU9A 1AMHA 1QTFA 4ZKOU 2ZO3H 3V13A 1G3CA 1O37A 2BD9A 2SGPE 3M5MA 4CRFA 8ESTE 1ZYOA 1MU8B 4Q7YA 1EPTC 1OWIA 4IW4E 3OTJE 5EPYA 1BTWA 1MH0A 4Z6AH 1HFDA 4DOQA 1T8OA 2TGPZ 2VJ1A 1THSH 4HGCA 4ABIA 1KXCA 1HIAA 2Z3EA 2WPLS 1U6QA 5C5OA 1BA8B 4ZXYH 2QAAA 1ZMJA 1EAIA 3D49H 4CBOA 1XMNB 3M37A 1BQYA 1O2YA 3UTUH 2PR3A 1UVTH 2Q6DA 1A3BH 2FS9A 1LVMA 3AAUA 5DP4A 1FAXA 1MKXK 5GDSH 3A86A 1P04A 4AFUA 4O03A 1DWCH 3ELAH 2J4IA 2QV1A 2QXGA 1AZZA 4JK5A 1C2JA 1WBGB 2LNCA 2VB0A 5JYIA 2AMPA 4XBCA 2BX4A 3PM3A 1O3GA 1SQAA 2OLGA 3BTHE 4ABDA 1ZJKA 2GP9B 2ZP0H 4MNYA 3ESTA 1QHRB 2VIWA 4AZ2B 1OS8A 1P02A 4B2CA 4YM9A 1NFXA 3RMOH 1GBEA 4YOIA 3SV2H 2XXLA 2ZDLA 2XBVA 2A7JA 3HGPA 1QRZA 1ANCA 4FUCA 5EPNA 1BHXF 2ZECA 3E1XB 1NZQH 1HAPH 4E05H 2XC4A 1MTWA 3EE0B 2QF0A 3PMJA 2SGAA 1GBBA 4OS7A 3HK6B 2ZFSA 1GJAB 3DHKH 2BTCE 3EGKH 7GCHG 1SGCA 2GZ8A 2FWWA 2OINA 1SVPA 2H2ZA 1GMHF 1NPMA 1NFYA 3HK3B 3LH3A 1CT0E 2GCTB 3GY7A 1LCYA 5JBBS 3UNSA 7KMEH 3A7VA 2QF3A 3NXPA 3BEIB 3MO9A 1MBQA 1QURH 1SSXA 1GHAF 2OD3B 1Y3XA 2HPQH 1C2IA 1DWBH 1HCGA 4GUXA 2QY0B 5JBTA 4RSPA 4Y7AA 4MPVA 3E6PH 1SFIA 1UTJA 2AGEX 3SGAE 2JH0D 3P17H 4NIWA 1QY6A 1ZGVA 3E0NB 3RXAA 4ISOA 1L1GA 1ESBA 1RS0A 1UVOA 2ZFRH 2OXSA 1A1RA 3A85A 1PPBH 1DE7H 1SGEE 2BD7A 1CA8B 1VCQA 1DWEH 5IYTA 2BB4A 2ZZUH 1IQJA 4K60A 3DUXH 3BSQA 4UD9H 2F9PA 2ZHFH 4WMFA 3SBKA 2CXVA 1T8LA 4BAKB 3STJA 3MH5A 1OP8A 1O5BB 1QGFA 1TGCA 1RFNA 3RC4A 1KSNA 3L6PA 1LO6A 1ZTLA 2ZIQH 1LHGH 1O30A 4ISIH 4MQAA 3BG4C 1P06A 5A8ZA 1TAWA 5L2ZH 1C5OH 1WSSH 4UDWH 4AX9H 4ZKNU 3BEFB 2IJOB 2BD2A 2DE8A 1BRBE 4IC5A 4B73A 1D3DB 4BOHA 1YPKH 2FDAA 2WPMS 4MPXA 1RXPA 3FZDA 2BD3A 1BUIA 6GCHG 1C5ZB 1YPLH 1O3DA 1O5DH 2XBXA 1SOZA 3RDZA 4I31A 1MTNC 2TIOA 2M5TA 3PLBA 1UCYE 2H5DA 3GOVB 4K8BA 1SL3A 3EAJA 1TNHA 3PMBB 3GY2A 1NRQH 1IQFA 2C8YB 4Y6DA 1SQOA 2CF8H 3RXEA 2PKAB 4FUEA 1BBRE 4X8TH 4O3UA 4H42U 1GVZA 1LKBA 4NSYA 4CRDA 2V3HH 3GISB 2BLWA 3E8LA 5JB9S 3ZZBA 1EASA 2Y7XA 4OS4A 5F8ZA 3LONA 1O3IA 3A88A 3UREA 1F7ZA 1V2JT 2GCTC 1V2UT 2HGTH 1AO5A 1P9SA 1UCYH 2Y81A 1BB0B 4U30A 5E0GA 2BQWB 3TJUA 1UMAH 4B74A 4WMEA 1DM4B 2BDYA 3QTOH 1K9OE 4AYVB 1ZSJA 5FAHA 3RLYH 3LGYA 4M7GA 1YPJH 1XUGA 2G00A 1C2GA 4INHA 1O38A 1O2ZA 1N6XA 1MTNB 2QGRA 2C3SA 1DVAH 2XCNA 1Z8RA 4CREA 1B0FA 3U8TH 1F5RA 6CHAC 2CGAA 5JBCS 1HV7A 1RJXB 3RXHA 3T29A 2WUCA 1W0ZU 5EXMA 1SGQE 2HALA 1GI7B 2W7UA 5E2OA 1ELDE 2WV4A 3KQDA 2A4GA 1O0DH 5EW1H 3TJOA 1OWHA 2B0FA 1EB1H 3N7OA 4D7GA 2D8WA 1KTTB 4OGXA 1TWXB 2O8WA 1K28D 3A8AA 1DT2A 1TOMH 1O31A 2RG3A 3TPIZ 2AMDA 1C2HA 1VJ9U 4LZ4B 2ZGXH 3SNAA 4NWLA 3VPKA 2O8TA 1AKSB 4DVAU 4UFFH 4THNH 4MNXA 4Y8XA 1YPEH 4MG3A 1GJ5H 3U98H 3RXSA 1GMDG 2FM2A 2ZI2H 4YTAA 2A4OA 1GBDA 2TGDA 2ZKSA 2NU4E 1SG8B 4D9RA 2BDIA 1AU8A 3TH2H 1ARCA 3RXGA 2AGGX 2XC0A 1ZTKA 1Q3XA 1DPOA 1AWHB 1JOUB 1O5CB 4O3TA 3T62A 1F5KU 3EA9A 3QN7A 1EJAA 2BZ6H 4ZHAA 2JKHA 3FVFB 1SGYE 3MNBA 3UOPA 2UUKB 4LOYH 3MO3A 2ZCLP 2GVFA 2GX4A 1QFKH 2XBWA 2ZU3A 3FP7E 3GICB 3ATKA 5HMAA 1AVGH 2YNBA 3GY5A 3ZV9A 4BNRA 1QJ7B 5HXFA 1CHOG 2OC7A 3GY8A 2OQ5A 1LQEA 2BLVA 3V7TA 1SQTA 4NGAH 1DSUA 2FO9A 1J8AA 2Q1JA 1ZPCA 1UTQA 1P10A 3SO3A 4OS2A 1IQKA 2IPHA 4X8VH 3EQ0H 1OKXA 1LHFH 1AVWA 4Y7BA 2AERH 5TCCA 3LU9B 1LVBA 3RXKA 1ANDA 1YCPM 1CQQA 1C1QA 2OBOA 2PFEA 5GIBA 1NFUA 4FUJA 5EW2H 4B75A 1Y5AT 1O2MA 2OUAA 1TGTA 2CMYA 2O8UA 1GCTB 2J94A 3VB3A 1D9IA 1ABIH 1EJMA 1E35B 1QQ4A 1OPHB 1AE8H 1AFQC 4NIYA 1XXFA 1Z8IB 2G81E 1O2TA 4JCNA 4IMZA 3LJJA 3KIDU 1GI4A 1TFXA 3R0FA 4U01A 4FU8A 1AGJA 2TPIZ 1UTMA 2XNIA 3V0XA 2J92A 3M35A 2AFQB 1TX6A 1K1MA 4X1RU 2FP7B 2WINI 2ZU1A 2XBYA 1GBHA 1YP9A 1T8MA 4GSOA 3UOUA 1C5XB 2HPPH 2VIDA 2WYGA 2ZHDA 3PMAB 1Y3VA 1NT1A 1SLWB 4A92A 3K6YA 2GMTC 5CE1A 4FUFA 1Y3YA 1SBWA 4E7NA 1G3BA 2GZ7A 3OYPA 4JZFH 4WY3A 1NC6A 1OYQA 1C1WH 1TA2A 1KXEA 1INCA 1GVKB 1L1JA 1WV7H 4X2VA 2A32A 1PPEE 1JIRA 2BM2A 4NIXA 1M9UA 2Y5GA 4HI3A 3LGVA 4FU7A 4H6SB 3CS7A 3GCTG 1HJAB 1Z8GA 2ZDMA 2RA0A 3RM0H 2W5EA 4IBLH 1LDTT 3G01A 3GCOA 1GJ7B 3KEEA 1P05A 2I6QA 1PYTC 5BRRE 2ZC9H 1P01A 2BY5X 1T8NA 8GCHG 4MDSA 5A2MH 2BXUH 5AFYH 1MCTA 1B0EA 1ZMNA 5FPSA 5TJXA 1VITH 1BTYA 1O3PB 2V3OH 4ABHA 2Z7FE 2BVXH 1SLVB 1ELAA 4B71A 4YT6H 1OP0A 1V2MT 4NZQA 1QR3E 1Z7KA 1ZPBA 1FUJA 3L33A 1Y5UT 3ZZDA 1HYLA 3GY4A 3A7YA 1DLKB 1OXGA 2PGBB 3MU4A 4YLQH 1LKAA 1UTPA 3SI3H 1K22H 4PROA 1ZOMA 4LZ1H 3GCTF 3TGJE 2BYAX 1WQVH 4R0IA 1DITH 4NZLA 4NIVA 4WWYA 2FIRH 1QB9A 4AG2A 4AFSA 2F91A 2ZA5A 2Q6GA 2ZHEH 3MO6A 4ABEA 3LGIA 5LH8A 1SGTA 1O3FA 2CHAC 1BTXA 1O34A 1FI8A 1O2SA 4A7IB 2BY7X 3ZVDA 2Z9IA 1AKSA 1MTUA 1SGDE 1C5PA 3KQEA 3MU0A 1O2VA 3SNEA 3TJVA 4MPUA 3M7QA 3LGWA 2SNWA 1EUFA 3H7OA 4CRGA 1FY1A 4X2YA 4TY6A 1DUEA 3U9AH 9ESTA 3O8RA 1GPZA 1GBFA 2ZQ2A 2GZ9A 1GI8B 1GJ4H 4ZH8A 4GHTA 3V12A 5ESTE 1GBMA 1KXBA 2EC9H 1CA0C 1BMMH 2A4RA 2QCYA 4X8SH 4AYYB 1O2UA 4YT7H 4OS6A 3SGQE 1TALA 1C1VH 1VR1H 4UFEH 1VITF 3MYWA 4CRBA 1ZZZA 3BEUA 3WY8A 1TIOA 2P8OC 2Z9GA 1NO9H 2R2MB 3AVZA 1YPGH 3ZVGA 1V2TT 4I8GA 3ZVFA 5EQRA 3RU4T 1KLJH 2WUBA 4BTIB 2VNTA 1H9IE 5EU8A 1ESAA 4E7RG 3GY3A 3TLOA 1A46H 1DDJA 1YPMH 2ESTE 1ELEE 4X1NU 1THPB 1AZ8A 2ODQA 1ZPZA 3RLWH 3SUFA 1V3XA 3MI4A 1T32A 1A4WH 3AASA 1YKTA 3PLKA 1FIZA 1QRXA 2D2DA 2GD4B 4JZDH 2FOCA 4GVUA 1LHDH 3A7TA 1GBKA 1C4V2 2A7CA 1MMJN 4TWWA 5JBAS 1EAWA 7ESTE 1SLXB 1QJ6B 1D6WA 1W7GH 1E36B 1ELBA 5G4BA 4YZUA 7LPRA 1TB6H 1L1NA 2Y5HA 1JMOH 3FAOA 1C4U2 1K2I1 2LPRA 2VVCA 4KTUA 1MAXA 4UEHH 1F5LA 2TGAA 4IMQA 2PKSC 4KP0A 2FI4E 1GGDB 2DE9A 1BMNH 1HAGE 8KME2 4ISHH 1Z71A 1KXFA 1HAOH 3R3GB 2A45B 4X0WU 3QUMP 1AHTH 1C5TA 1HAVA 2BY6X 1NROH 1DOJA 1CE5A 4UFGH 2Y5FA 1CGHA 4OS1A 1P12E 1ZSKA 4AGKA 1TGBA 2EEKA 3A7XA 4B2BA 1TPSA 3LDXH 2NWNA 2NU0E 4NA7A 5DP9A 1D3QB 2ZTYA 2O9QA 4KKDA 2Y7ZA 1PPFE 1AVXA 1UJ1A 1YLCA 3NUMA 3KL6A 3SGBE 4YESB 1SHHB 4DW2U 1ID5H 1O3JA 1TLDA 1IHTH 4CR9A 1DXWA 3S7HB 5GCHG 3M36A 4GHQA 1GJ8B 4ABBA 2BDHA 4Y0YE 3PWBA 1C9PA 3QGNB 2ZGBH 2BZAA 1A0JA 1P11E 3RXMA 4BXWA 4BTUB 1KXDA 2W3IA 2Y82A 3AW1A 1J9CH 2C90B 3P8FA 1FY3A 5F03A 2ILNA 4DY7B 5C2ZA 4AFQA 1PQAA 2WV5A 3RXFA 1GI3A 4DT7B 2F3CE 1O3HA 1RRKA 3F9EA 2JETC 2FOAA 1UK2A 3BIUH 1O2LA 1WOFA 3TGKE 1C5VA 3SU4A 1HBTH 3SJIA 1G32B 3ODFA 1C2EA 1FZZA 2PGQB 1WTHD 2FI5E 1BRUP 4TPYA 3T2NA 3Q76A 5LPRA 1B7XB 1TX8A 4ABFA 3MNCA 1E38B 1SGFA 4X2XA 4U2WA 2XW9A 1S0QA 1KLTA 4K1EA 3GCHC 5C1UA 2NU3E 1N8OB 1LVYA 4XE4A 1HDTH 1GI5A 2ZWLH 1H4WA 3OSYA 1J14A 4Y79A 3ZZ8A 2PTCE 1NFWA 2BVSH 1MD8A 1F0SA 1ETTH 1GHYH 2A0QB 3E0PB 1A0LA 4ISNA 1GJCB 1Y8TA 2Y6TA 2OC1A 4FVBA 3VXFH 1EATA 1GHWH 1EPTA 1L4DA 1GHVH 1DLEA 3SI4H 1DUAA 1TBZH 4BTTB 3A8BA 3UPEA 1TONA 1NRSH 1P8VC 1BOQA 3IG6B 3SV8A 1ZGIA 3T26A 3C27B 4KELA 3GDUA 4GPGA 4GAWA 1DANH 4JK6A 1BJUA 2P16A 3BTFE 1QB1A 2TBSA 2FLRH 1ELVA 1C1OA 1DY9A 4X6OA 4ZHMU 2C8ZB 1GJBB 3MFJA 1XUFA 5F8XA 3PMHB 1XUIA 1F0RA 3M7TA 3PYHA 4I8HA 5EXLA 2GT7A 1BDAA 1CT4E 4K1TA 4XBBA 4GCHG 1UK4A 3P6ZB 4TY7A 2CN0H 1XKBC 3SQHE 2NU1E 2VINA 3F9GA 1SGFG 4IS5A 4ZKSU 4ZXXH 3DD2H 2OP9A 3FP6E 3SZNA 1GHXH 2FESH 4XBDA 2JH6D 1S6FA 1Y59T 3STIA 2EI7A 4K69A 3RMNH 1PPZA 3PWCA 4JYUH 2SGDE 4ZHLU 1W10U 2R9PA 1YLDA 3BTQE 1UCYK 2A2QH 2I6SA 2VWOA 1BT7A 2G5NA 1A5HA 1BTHH 1AFEH 2ASUB 3RXIA 1EP6A 3PV4A 1IAUA 9LPRA 1YGCH 1H8IH 4CH2B 1GDUA 2H9HA 3KCGH 3U1IB 1QB6A 1GBJA 2ZPSA 5E0HA 3M3VA 1SGIB 5DPAA 1EAUA 5EG4A 4INKA 1G9IE 3F1SB 3TNSA