1SQAA

Substituted 2-naphthamidine inhibitors of urokinase
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title Interaction with the S1beta-pocket of urokinase: 8-heterocycle substituted and 6,8-disubstituted 2-naphthamidine urokinase inhibitors.
pubmed rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 55
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2004-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sqaA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sqaA01
1JMOH 1SGDE 1EXFA 1N8OC 5T6GA 1ZMJA 4CRAA 1SLWB 2SGQE 2A4QA 1AIXH 2V35A 3RXOA 5HM9A 1AQ7A 3ATWA 4BAHB 1NS3A 1KY9A 3P8OA 1CT2E 5PTPA 2GKVE 1IQFA 5DO4H 1XXDA 1Z1JA 1TGBA 1FAKH 1LCYA 3SV6A 3NPSA 2VIQA 4WH6A 1OWEA 5L30H 3SQHE 1ZHRA 1OP0A 2A2QH 2OCVB 2Z9LA 2QF0A 4NA9H 2BM2A 5DP6A 1AVGH 1P0SH 1Z7KA 2VIDA 3A7WA 2OC8A 1O5DH 1QJ7B 1WQSA 8GCHG 4K60A 1QA7A 1Z8JB 2RA0A 1C5UA 4RSPA 3A87A 1UTNA 2BD7A 4I8HA 1XUGA 1V2ST 1EPTB 2DE8A 2GCTC 1P9UA 4X6NA 1K22H 3E16B 1GI7B 1UK4A 1DITH 3P6ZB 2QGRA 3FP7E 4Z6AH 1DE7H 2GDDA 1HYLA 2NU2E 4ZHAA 2V6NA 4X8UH 1LQEA 3SJ9A 1D9IA 2ZTZA 4AOQA 3SJ8A 4DW2U 1OOKB 2FZZA 3SV2H 1MQ5A 1FMGA 1YPHC 2VWLA 1QL7A 1H9LB 3A7VA 1V2WT 3RXSA 4MTBA 3RMMH 2EC9H 5T6DA 1GVLA 3T26A 1GMHF 1O2VA 1BBRH 1O3AA 4H6TA 4MNWA 1UVSH 2ZGJA 2AIQA 1BTUA 1S85A 1ELAA 3EQ0H 1IQLA 2ZCLP 2OC7A 2IJOB 1EZQA 2P3UB 1AFEH 4YLQH 4ISNA 2ZHWH 2SGEE 1A3BH 1C4Y2 1Y3XA 2FOAA 3WY8A 3BEIB 2D2DA 1G9IE 1SGTA 4Q7XA 2ANYA 2TBSA 5LPFA 1IAUA 2Z3DA 2B8OH 5C5NA 1ELTA 3IITA 3L33A 1TMTH 5AFZH 4NG9H 3ATIA 2VVCA 1KXEA 1P2IA 3TJVA 2OP9A 3MHWU 2FOCA 1T7CA 4A5TS 1FY4A 1LPZB 1BCUH 2ZKSA 3SGAE 2VIOA 3SORA 3V0XA 1AE5A 2XW9A 1P06A 1C5MD 3CENA 1P03A 1WAYB 1FY1A 5EW1H 2A0QB 3I77A 1Y3YA 1SLUB 5F8TA 4X1QU 1C2FA 3HATH 1O2MA 2VVUA 1GJ5H 1LHCH 2HPQH 5DPAA 1THRH 3PMAB 1O3LA 1P57B 2XYAA 2G00A 4B71A 1MTUA 4ZH8A 1ORFA 4JK6A 4D9QA 3A8BA 2R2WU 1HIAA 2ZQ1A 2FYQA 5TCAA 2AMQA 1MD8A 3E0PB 3LC5A 1GJ9B 1QQUA 2JH0D 1BDAA 1FN6A 1OSSA 2LPRA 3SV7A 1ABJH 2GZ9A 1G3CA 2ZCKP 3SV8A 3E6PH 5K7RA 4ISHH 3SGBE 4X6PA 1N6XA 1A2CH 5GCHG 1NN6A 1BITA 3A8CA 1EPTC 3W94A 1XUKA 3UREA 1XVOA 1HCGA 1O2ZA 1O3EA 2GVFA 3SU1A 1ZJDA 4UDWH 2ZU2A 3MH6A 3M7TA 1PQAA 1LKBA 4NA7A 1GI0A 1CQQA 1FIWA 2VWMA 1CU1A 1MBQA 4JMYA 3OTJE 4Y7AA 2AEIH 4E7NA 2OBQA 3BTFE 2P16A 1QL8A 1VITF 2CN0H 5JBCS 4Y8YA 2UUJB 3Q00A 4BAMB 1HBTH 1JRTA 2R3YA 4O3TA 5DP8A 1CA0C 1BTXA 1O33A 1UVOA 1OPHB 3RXRA 3TLOA 1O34A 5DG6A 1UHBB 1TX8A 3P95A 2FOHA 2A7HA 1H8DH 3MH5A 1SFQB 4E7RG 3LGYA 7ESTE 2JKHA 3E91A 4CH8B 1A61H 3TNSA 1HJAB 1SOZA 2FPZA 5H4IB 2ZFTA 3S9AA 1OP2A 4NIXA 3ZZ9A 1WV7H 2OTVA 3RXVA 2FI5E 1GCDA 4IC5A 4X1PU 2KAIA 1SLVB 2B7DH 2P59A 1O3PB 5GPIB 3UNRA 1C5YB 4NGAH 3S7KB 2Y6TA 4GHQA 5F03A 4SGAE 2O8MA 1SOTA 1BMNH 2H9EH 3OY6U 1W7GH 4MPVA 3GY7A 2RG3A 5EXMA 1OS8A 1S84A 2BD9A 1TGSZ 1UCYE 4FU8A 4X8TH 1C5ZB 2VNTA 3U1JB 1RJXB 3VFEA 1VJ9U 2ODQA 2P94A 1YYY1 5AVDA 1MCTA 1BB0B 1NU9A 1L1JA 2ANMH 3A7TA 3LU9B 5FX5A 4NFEA 3RM0H 1C2IA 2HOBA 3ATKA 1SGYE 3ZVFA 1ETTH 2GZ7A 2SGPE 4ZKRU 1Z8GA 4CBNA 4NZLA 3ITIA 2FOMB 2VVVA 4H6SB 2IOTA 1O3CA 2CHAB 1P2NA 2CXVA 3UR9A 1SB1H 1MUEB 2AH4X 3P8FA 3A8AA 1BMLA 1UVUH 1P8VC 2SGDE 4KP0A 1O2XA 4CBOA 4ESTE 2ZU5A 3BIUH 1UTKA 2PHBA 2D8WA 3UNSA 1V2TT 4B2AA 3A86A 1G30B 5EG4A 1TPSA 3TH2H 4DOQA 1O2YA 1WBGB 4HTCH 2Q1JA 1EAIA 4ISIH 1C1RA 1BUIA 1KLJH 3RMLH 1VR1H 3AW1A 2XWAA 4RKOB 3UIRA 3BIVH 1DY8A 1Y3UA 3E90B 2OQ5A 2BY5X 4YT7H 3U8RH 2UUFB 1MAYA 3MNBA 2GCHG 1AWFH 1MAXA 1EATA 3BTHE 3A7YA 2A45B 1UK2A 1FXYA 1HUTH 2EA3A 2PTNA 3KCGH 1Y8TA 1MZDA 5JB9S 2BY7X 1CHOG 1TX6A 4NA8A 3S0NA 1Z6EA 2BY9X 1EAUA 3PMJA 4U30A 3BTME 2FO9A 1KLIH 1WOFA 1NROH 4OGYA 3RXKA 3ZVCA 5K0HA 2ZDKA 4UEHH 1W12U 3KHVA 2GMTC 1ELCA 3BTTE 1ZRBA 3RXEA 1T4VH 1MD7A 3SU6A 1HJAC 1S83A 4X2YA 1LHFH 1C5TA 1PYTC 4YM9A 3MNCA 1BTZA 3F9GA 1Q31A 3M36A 1EOLA 1AB9B 3PWCA 1W11U 3MO9A 2JH5D 1L4ZA 2CGAA 2ZFFH 1G37A 4K1SA 1S81A 4UFEH 2BDYA 3VB5A 4GVUA 1KXDA 3RXPA 4ZKOU 2TGTA 3RC4A 1GBDA 4GAWA 2F91A 3O8DA 1YPLH 4YLUA 4IC6A 3KQDA 3GCNA 4BAOB 4IN1A 4Y8ZA 1GVKB 1HAPH 2V0BA 1OWHA 4PROA 1NFWA 3UUZA 5L2YH 3EAJA 1GI8B 1W10U 3MNXA 5JB8S 3M5NA 4AG2A 2GGVB 3A7XA 2BD8A 2YOLA 2AGGX 3SBKA 2CJIA 1GG6B 2ZA5A 1NM6A 3SQEE 1CE5A 4XBBA 5EW2H 4WY3A 1ESTA 3U8TH 1K1PA 2B9LA 2ASUB 3QTOH 4BTTB 1GJ4H 1VITH 1F5LA 1TRMA 1C1PA 2DE9A 5CHAB 2BXTH 1SGPE 3IG6B 3SO3A 3Q3YA 2CHAC 2Y81A 3RC5A 5LPRA 4UFGH 4H4FA 3VB7A 4RKJB 1EP6A 1PQ5A 3RXFA 1C5OH 1GHBF 1PPCE 1DUAA 2O8UA 3RXUA 1TNJA 5E0JA 3RUOA 1SI5H 3BEUA 4J1YA 5LH8A 3UWIA 4UFFH 1MTVA 2ANWA 4JYUH 3VEQB 1E34B 4KTCA 4OGXA 2F3CE 4OS7A 3QUMP 4NIVA 2CF9H 1XUHA 4UFDH 4ISOA 2OC1A 4I8JA 1O2RA 1ZZZA 3SI3H 3SU4A 1F7ZA 1W14U 1O3FA 2GV6A 2FOBA 1NRSH 3MU0A 1EJMA 2JETB 1TE0A 1EAXA 2HWLB 4K2YA 1NTPA 3DUXH 4ABDA 3URDA 1FONA 4LZ1H 3F9FA 2W7SA 1O3OA 2FOFA 1GHYH 3MU1A 1V2RT 1P3CA 3K6YA 1O5BB 4Y7BA 3TU7H 1FY3A 1LO6A 2EI8A 2ZCHP 1L0ZA 2NU1E 6CHAC 4ABHA 1CHGA 2W3IA 1V2LT 2R9PA 1HV7A 1AU8A 3SUDA 2ZP0H 1PPFE 4Q7YA 2G4UA 1TRYA 1PPBH 1AUJA 2FXRA 3TK9A 4D8NA 1TNIA 1IQIA 1B5GH 1AB9C 3JZ1B 1UO6A 4X2XA 4UONA 1QCPA 2XWBI 1OXGA 1ZHPA 4WJG2 7GCHF 1BRCE 1O2PA 1QJ6B 4NSYA 4I8LA 2PGBB 5JBBS 4F49A 2PWXA 1MBMA 3LOXA 3P8NA 4DIIH 1ELEE 2OQUA 1D6WA 2FTMA 4FUBA 3FP8E 1ZMNA 2PTCE 5BRRE 3QZRA 1ACBE 2F9NA 3GOVB 2Z94A 3QGNB 2BY6X 3G01A 4ZXYH 1O3JA 2XC4A 5HMAA 3RDZA 2VWNA 1VITG 3F6UH 2SGFE 3QTVH 1O2KA 1GBBA 1T8OA 2A4GA 2ZC9H 5TJXA 3TPIZ 2TGDA 3QGJA 1C1UH 1AZZA 2R3UA 3OU0A 4TWWA 1GG6C 2ZHEH 3LGWA 3HGPA 4YT6H 5E2OA 2Z3EA 1K2I1 3RXMA 1H4WA 5E0GA 3U98H 1YPJH 3Q76A 1SPJA 2SNWA 4OS6A 2NU0E 1DY9A 1K9OE 2LNCA 3MU4A 1O3GA 1BT7A 2VIVA 3KNXA 2P3TB 2VU8E 3VXEH 1CGJE 3VB3A 1O2OA 4RN6A 3PV4A 1RFNA 2HVXA 1ELGA 1HJ8A 1XKBC 1IHSH 1MZAA 2WPLS 2FS9A 1P3EA 2OC0A 1O0DH 2A7CA 2A1DB 4ABGA 4Y71A 1D3TB 4LOYH 1GJCB 2UUKB 1YPGH 1YBWA 3A7ZA 3SNAA 3A84A 3SUGA 4DVAU 2BVXH 4AORA 2ZGXH 4CH2B 4TY6A 1HNEE 1W13U 3UOUA 3F9HA 1B0FA 2C8XB 9ESTA 4IW4E 4NWKA 5JPMH 2JETC 4X1NU 5FCRA 4ZHMU 4DG4A 1ZSKA 1GBFA 1AGJA 1ZLRA 2P93A 2B0FA 5FPSA 3MWIU 3L3TA 1K1IA 1LTOA 3PTNA 2H9TH 3BF6H 5FPTA 3GISB 3SN8A 4B76A 3GYMA 3RXDA 1GMCG 3UPEA 1SLXB 3RP2A 4NFFA 4DURA 1FAXA 1E0FD 3PLKA 4CRBA 1DPOA 1GI1A 5JYIA 1V2UT 1HDTH 4MDSA 1GMDF 1EOJA 1XUFA 3MO3A 1LVYA 1YP9A 3C27B 4K8YA 5C20A 1O2QA 3SOSA 1SSXA 4ABEA 1DFPA 3ZYDA 3P17H 1CA0B 2A5IA 2BLOA 1C9TA 1PQ8A 1CA8B 1YGCH 4XDEA 1OKXA 2I6QA 1M9UA 1K28D 2CV3A 1P12E 1FPCH 1FQ3A 1HGTH 1PYTD 3GCTF 1E37B 4E05H 1HRTH 1DWBH 2GDEH 2NWNA 2VGCC 3TGIE 5DK1A 1G36A 1LHDH 1QRZA 1KSNA 1C1WH 1AVWA 3BTDE 1T8MA 1BOQA 4DCDA 1BTHH 5EQSA 1BIOA 1TGNA 3SJIA 3PM3A 2PSXA 3QX5H 4U32A 5GDSH 1QJ1B 1DUEA 2SFAA 2J38A 1MKWH 2THFB 3F9EA 1BMAA 1V2PT 3A82A 4DT7B 1W8BH 1LHEH 1IQNA 4CRCA 5F6MA 1HAVA 3DD2H 1PFXC 3RU4E 3SNBA 3LT3A 2F9BH 3GY8A 1YCPK 1BTWA 2FLBH 3KIDU 3ZZ5A 2G81E 1HPGA 1A5GH 1C2EA 1GBCA 3AAUA 1V2OT 1A46H 4CRDA 1G3BA 3TJOA 1QNJA 1QTFA 1MCVA 3QK1A 4AFSA 3MI4A 4D7GA 5GIBA 3DFJA 5ESBA 2VJ1A 4JZFH 3MYWA 1YLCA 2ZGHA 2YNAA 3SNDA 1G3EA 3RMOH 3T29A 5L2ZH 3AAVA 1TOCB 1NRPH 4FUDA 4GPGA 2C3SA 2PSYA 5GWZA 1GBJA 1PPHE 2ODPA 3DFLA 3FZDA 4WMFA 1WU1A 1L1GA 3RXGA 2BDCA 1C1SA 3LGIA 4F4OC 1OYQA 1CT4E 2PGQB 1XXFA 1AE8H 1DWEH 2I6SA 1Y5AT 4YO9A 3NK8A 1KDQB 2FODA 3ODDA 4Y79A 2ZDVH 2ZU1A 4YZUA 3ENSB 3UQVA 1GL1A 4TPYA 2FESH 3GY3A 3RXJA 1GDNA 4J2YB 2G8TA 1C5LH 1GDQA 2F83A 1UTQA 2G51A 5EXNA 1TRNA 3D49H 2IPHA 1BQYA 1TPOA 3GDSA 4GCHG 4FUJA 1MTWA 5EXLA 1O37A 2ZGBH 2ZFPH 4U2WA 2FTLE 5ETXA 4ABFA 2GMTB 1GHVH 3SUFA 2QIQA 1GI2A 1VJAU 4CREA 4TWYA 4AFZA 1TGCA 1GBHA 1NO9H 5EPNA 1ESBA 1O5EH 1DICA 4ABBA 1O38A 3IWMA 1Y3VA 4FU7A 2BHGA 4MVNA 1QA0A 1P01A 6GCHG 1TNKA 2EI7A 3ZZAA 1O36A 1QBOA 2AGIX 1EKBB 5C2ZA 1DM4B 1Y5UT 2UWPA 1GBKA 3PO1B 1MKXH 2CMYA 4ISLA 1QB1A 2EEKA 3M5LA 4BTIB 1LQDB 1KYNA 3SU5A 5ABWA 1EZSC 3S69A 3SV9A 4B1TA 1C5VA 1LPGB 4AN7A 1TBQH 5EOKA 1TOMH 4ZXXH 1B7XB 2BY8X 2PUQH 3EE0B 2GP9B 1AZ8A 2TGAA 1E35B 1P9SA 1ETSH 1XUJA 8LPRA 5T6FA 1ANEA 3GCHC 2A31A 2C93B 1C1MA 3TIUA 2ZDMA 1O2HA 3ZV8A 2BOKA 2D1JA 2BDIA 1EASA 1AKSA 2FX4A 4GUXA 4GSOA 3O8BA 4R8TB 5A8ZA 1BHXB 2BD5A 1D6RA 1FIZA 5GJ4B 1PPZA 1SG8B 1S0QA 2W7UA 1C5RA 4A6LA 8GCHF 1MQ6A 3NZIA 1GJBB 5FX6A 2C8YB 1VCPA 1O2SA 1QRXA 1RS0A 3LJJA 4MNXA 2IN2A 1A7SA 1PPEE 3GDVA 3MMGA 3U8OH 4JZEH 1GCTB 2J94A 1KXAA 1ARCA 1DANH 4X8SH 4JYTA 2ZNKH 1ESAA 2Z9JA 3S9CA 1YKTA 3R3GB 2ZHQH 1INCA 1DX5M 1JRSA 3DA9B 4OS4A 3K65B 5E2PA 1G3DA 2BX3A 1GHAF 2OXSA 3ZZ8A 1K1LA 3QZQA 1SQTA 2XCFA 1MTNB 4TY7A 2Z9IA 1HFDA 3TH4H 1Q3XA 5DP9A 1RTKA 2FMJA 4AX9H 2A5AA 1TPPA 2PKAA 1TNHA 2QY0B 3D23A 5JDUB 3ZVGA 1QBNA 2BMGB 4YOJA 4Y11E 2XBWA 1C1QA 3BG8A 3NKKA 1F0TA 2K1QA 1EX3A 1O3IA 1QURH 1GI4A 2BZ6H 6CHAB 1P2JA 1SGNE 2TPIZ 1X7AC 4ABAA 4O03A 2ZPQA 1ZTKA 2WUBA 1ANBA 2FI4E 3ZVDA 1QHRB 3LPRA 4JK5A 2P95A 1YF4A 1VCWA 3O8RA 1DWCH 5F8ZA 4ZKSU 1D4PB 2ZQ2A 4B2CA 4WMEA 2BDBA 1LVOA 3UR6A 3FFGA 5L6NH 2ZWLH 3PMBB 1HIAB 2ALPA 3QDZB 1Q2WA 1SR5C 5A0AE 1G2MA 1ZTLA 3UY9A 2AGEX 3SZNA 2H2ZA 4K3JA 1C5SA 1DDJA 3GDUA 1EZUC 2AIPA 2H1UA 2Y7XA 1C4V2 1S6HA 3PO1C 3TVJB 1BBRK 4X1RU 1C5QA 1S6FA 2BLVA 2Q6GA 4CR5A 1THSH 2FYRA 1J9CH 1YCPM 2VH6A 4Y10E 1K1NA 4R0IA 4YESB 3VPKA 2QXGA 3ATMA 3QLPH 1VCQA 3RC6A 1GMHG 1T31A 4K1TA 4BXSA 2ZFRH 3GY6A 4AFUA 1OWJA 4XOJA 3MU5A 1HAZB 4BANB 4TPIZ 2GZ8A 3SHCH 1TQ0B 1JIMA 1C2GA 1RRKA 3GCOA 4A1XA 1ANCA 5J4QA 1EPTA 3PLPA 3BG4B 3SU3A 6LPRA 1CBWB 2P3FH 2B5TB 4I8GA 3LC3A 4NIYA 4FUHA 2A2XH 1QBVH 2ZPSA 1ELVA 4O3UA 1TONA 1MKWK 4Y0YE 2W5EA 4ZMAH 1L4DA 1IQMA 1T8NA 1UK3A 1SC8U 2WYGA 5GCHF 1P11E 3ELAH 1D3PB 3DHKH 2VWOA 1GI3A 3K2UA 2PKSC 5GXPA 1HXEH 4YOIA 1JXPA 1UVPA 1ARBA 3BTWE 2G55A 1O35A 2KAIB 3TK6A 2FX6A 1GCTC 3ESTA 4D7FA 3T27A 2QV1A 2QXIA 4QT8C 3VGCB 3FAOA 4AG1A 1MU6B 4B75A 1ZOMA 1GJ7B 2BDAA 2HPPH 3A83A 1NZQH 1FUJA 1EB2A 2F9UA 3ZZ7A 3T2NA 1NY22 2WPKS 3UFAA 1OP8A 1TNGA 3RXBA 4DY7B 1MTNC 2Y5GA 1SQOA 3TNTA 1ZR0A 2QXHA 3KN2A 1O5AB 4INHA 3LGTA 5AHGH 2OBOA 2PV9B 3TJNA 2BD3A 2Y5FA 1OWIA 3RXQA 1AFQB 8ESTE 5BPEA 1KXFA 5JBAS 2A4RA 4IMZA 1H8IH 2RA3A 2ZTYA 1O32A 4LXBH 4THNH 2BD2A 3RXCA 2BB4A 4DJZB 1N6YA 3MNSA 1ZMLA 2J95A 4K1EA 4X2WA 6ESTA 4CRFA 2Y82A 2ZTXA 3OYPA 4WH8A 3HK6B 3EDXB 1VZQH 3O8CA 3Q77A 1LHGH 2R0LA 1FLEE 2F9VA 1P04A 3KEEA 4M7GA 4WWYA 1TNLA 3SI4H 3Q3XA 2XTTB 1OWDA 1U6QA 2ZHFH 3PROA 3TH3H 2Z9KA 4YTAA 2XXLA 3BTEE 2W26A 1TWXB 1Y59T 3URCA 4JZIA 3A80A 4OS5A 1YPKH 5I25A 2VGCB 3T25A 1HAXB 1RIWC 2BD4A 5A8XA 1O3HA 4CRGA 4Y6DA 1Z1IA 3LH3A 2V3HH 5G4BA 3LDXH 1P10A 2BLWA 2V3OH 4XBDA 1KTTB 2O8TA 2BX4A 1UTLM 1C2MA 2STAE 4INLA 1LDTT 3GY5A 4XE4A 1PQ7A 1MMJN 1UCYH 1UTOA 2QN5T 3F1SB 4O9VA 2ZI2H 3BSQA 1CT0E 4NCYA 2P8OC 4JZDH 1QB6A 1NFUA 3LONA 3RLWH 1TYNA 1W0ZU 3BG4C 5T3HA 1OX1A 4FVDA 1FDPA 4AGKA 1CBWC 1SVPA 4KELA 1P2OA 4ZKNU 1ZPBA 1BTPA 5AF9H 3LIWA 2BYAX 1O5GH 1GJ6A 1P02A 1DSUA 1GBIA 2VIPA 2FDAA 2ZDLA 3MOCA 1ETRH 1GBEA 3JZ2B 1E38B 1ANDA 1LKAA 1ZGIA 3SNEA 1V2VT 3TITA 2W3KA 2WV5A 1IOEA 1V3XA 3U9AH 2F9OA 5C1YA 4BXWA 4U01A 1JIRA 4A1VA 2ZU3A 2XBXA 3VGCC 1A0JA 4I8KA 1NFXA 1QY6A 2GCHF 4MPUA 1UHBA 2Y7ZA 2BQWB 2UWLA 3KQBA 4XFQA 1P2QA 3ZZDA 2VH0A 4I7YH 2BTCE 1CHOF 4D76A 3H7TA 3A8DA 1UVTH 2WPMS 1PPGE 4BAQB 2ZZUH 3K6ZA 3T62A 1EJNA 1FI8A 1AUTC 1AFQC 3I29A 1UJ1A 3SU0A 1XMNB 5EQQA 1ID5H 1WYKA 1QFKH 1TMUH 4KGAA 1GJAB 1LVMA 3N7OA 5HYOA 5A09A 3TK5A 5FPYA 4JYVH 2J4IA 1A5IA 1A0LA 1ELBA 3UOPA 1W0YH 4HI3A 1V6DA 4GHTA 1O2JA 1Y3WA 2OLGA 1HLTH 1LMWB 2HRVA 1C1TA 4Q2KA 4MG3A 1ZSLA 1EB1H 3LGVA 2G5NA 3SNCA 4AB9A 2C4FH 1OYTH 2HALA 4KKDA 4WVPE 1GHAG 4FUFA 1S0RA 1S82A 1D3DB 3E3TA 2HNTE 1AMHA 2WV4A 2YNBA 1SHYA 1CGHA 2GV7A 1FN8A 1KIGH 1V2JT 2QAAA 2ALVA 4Y0ZE 3MH7A 8KME2 3D65E 4FUCA 4MNVA 4UE7H 4FVBA 1IQEA 1O2UA 2FOGA 3KGPA 2H5CA 1NRRH 3K9XB 4X1SU 3KQEA 1J16A 4KTSA 2PFEA 3FVFB 2SGAA 1EUFA 1SL3A 1RTLA 1K1OA 5IDKA 3W95A 2GTBA 4AZ2B 5A0BA 3UQOA 4LZ4B 3PMHB 1TLDA 1F5KU 1TABE 1C1NA 4WMDA 1SGEE 2A32A 4FU9A 5DP3A 4Z0KA 4FUEA 3E1XB 2WPHS 2NU4E 3B23B 1EZXC 2O8WA 3U1IB 1L1NA 3GCHB 2AMPA 3BTGE 1OWKA 1FY5A 1GL0E 4AGJA 2ZEBA 2G4TA 1ABIH 1GI9B 1XUIA 1BTYA 1FJSA 3M7QA 3H7OA 1QQ4A 4AYVB 1C2DA 2BXUH 3VB6A 3Q3KA 5C1UA 3UNQA 1J15A 1GGDB 1UTJA 2WUCA 2FS8A 1QRWA 4X6MA 4AYYB 2O8LA 1QL9A 1TB6H 1GWAA 2Z3CA 1GJ8B 1TPAE 2ZGCA 2ZFSA 2HNTF 2ZU4A 4JZ1A 3RU4D 3TGJE 1IHTH 1Z8RA 4BTUB 4MQAA 2BVRH 1TX7A 1TQ7B 2BQ6B 3LJOA 3GY2A 2Z9GA 2A4OA 3M3VA 2WPJS 2WPIS 3V12A 2ZDNA 4X6OA 4ZHLU 1EAWA 5FHTA 1BZXE 2JH6D 7LPRA 3D62A 1ZHMA 3ZZCA 5F8XA 4BAKB 5LPEA 1F0UA 1YC0A 2OINA 1D3QB 5I46H 4XBCA 3RLYH 1BHXF 1GHBG 3MO6A 2QYIA 3M7UA 1GBLA 1HB0B 3H5CB 2R2MB 3NUMA 2OUAA 1SBWA 5FBIA 3NCLA 3TJUA 2GD4B 4XSKU 1TBRH 1C9PA 1F2SE 5DGJA 3VB4A 1NT1A 1DLEA 3M3TA 1W3CA 3FANA 2TRMA 5A0CA 2STBE 2OD3B 2QF3A 3PB1E 5LGOA 1CO7E 2FIRH 1VGCB 3EYDA 3RXIA 3UTUH 3M3SA 1ZTJA 2J92A 1C5PA 1C5XB 4IN2A 1H9IE 2NU3E 1BRUP 3RXAA 1Y5BT 1ZYOA 1IQKA 5DP7A 1GBAA 3ZVBA 3CS7A 5DKMA 3UWJH 4ASHA 4A92A 1K1JA 3V13A 2ZF0H 2GX4A 3S9BA 3MU8A 2FEQH 2H6MA 5TCCA 4Q7ZA 4K5ZA 3B9FH 1NU7B 2WINI 4B2BA 4MPWA 4BNRA 1DS2E 3ZZ4A 1THPB 1NPMA 4ZROA 1ZGVA 1XM1A 2H9HA 1IQJA 3RXHA 2ZDAH 1NRNH 2Q6DA 4X8VH 4GLYA 1HAGE 1BMMH 4FUIA 1V2KT 3E0NB 1FPHH 1H1BA 3ZVAA 1EQ9A 1O2WA 2J34A 1A4WH 1JWTA 2UUYA 4IS5A 3ZYEA 2HLCA 1GI6A 1MTSA 2FLRH 1EP5A 3EGKH 5FXLA 1O2LA 7GCHG 1GDUA 1JBUH 5HXFA 1P05A 2TIOA 4I33A 2QXJA 3HK3B 1AHTH 4I31A 4NSVA 5ESTE 3FZZA 3NWUA 3SU2A 2PW8H 1MH0A 1C2KA 4YOGA 1T4UH 2G52A 1FNIA 1O3MA 2DUCA 2QA9E 2XBVA 1UCYK 3LH1A 1NFYA 1GGDC 1O5FH 1TBZH 3RMNH 1C5WB 3V3MA 1C4U2 1DOJA 5CMXH 4VGCB 2PKSB 3SGQE 1V2MT 4ABJA 4CHAB 5E0HA 1TALA 3F68H 2HGTH 3EA7A 1A3EH 1GMCF 3GICB 1SFIA 3M35A 5FCKA 4WF8A 2UWOA 1NRQH 3ZZ6A 1ZSJA 1WSSH 2C8WB 4B74A 2AS9A 4K69A 5FBEA 4IBLH 1C2LA 2ZG0H 1SGRE 2PUXB 3ZVEA 1ZPCA 1SGIB 4ABIA 1CGIE 4MPXA 1F92A 1LPKB 1TMBH 2ZPRA 3FP6E 1DWDH 4Q80A 2AYWA 1ELFA 5HGGA 3AW0A 1Z6JH 3EA8A 4ZUHA 1HAVB 1YPHE 1O2TA 1GBTA 4FXGH 1TA6A 4MNYA 2BDGA 4INKA 1FY8E 3QN7A 1GJDB 3CP7A 2ZHDA 2BVSH 5C5OA 1SQAA 1VGCC 2ESTE 1PJPA 3PYHA 2Y5HA 1ZJKA 1CSOE 2H5DA 2SNVA 1F0RA 2FWWA 1A0HB 1DLKB 3SHAH 1TFXA 1GHXH 2XC5A 3ODFA 1JOUB 1G32B 1WTHD 3OY5U 2FI3E 3STIA 1IQGA 3SJOA 1W7XH 2TGPZ 1BBRE 3ZZ3A 1SGQE 1O3NA 1C2JA 4NWLA 9LPRA 3B8JA 1YPEH 3NXPA 1F0SA 4JCNA 1RXPA 1AN1E 1G2LA 3MTYA 1HAYB 1DT2A 3GY4A 1BRAA 2ANKH 4IGDA 2QCYA 1B0EA 2XNIA 2PLXA 1FV9A 1GHWH 3QWCH 1P2KA 1RIWB 1GMDG 2FM2A 4IMQA 2R0KA 2BOHB 2AMDA 2HNTC 5EODA 2ODYB 1KXCA 5EPYA 4TYDA 5IYTA 3ZZBA 5B6OA 1O3DA 5AFYH 4Y76A 4K8BA 3MH4A 1DSTA 2C90B 2ZFQH 3A88A 1ELDE 1YCPH 3M5OA 1QB9A 3A81A 3OSYA 2VINA 4FUGA 2PR3A 1WQVH 1TIOA 2Y80A 4BOHA 2VIWA 2P8OB 1SGFG 1O3KA 1TAWA 2Z7FE 1HAIH 2XC0A 1SMFE 4HFPB 3GCTG 1RD3B 4LK4A 1H9HE 1AD8H 1QGFA 2ZIQH 1EJAA 3BN9A 1J14A 2G5VA 3LKWA 3DT0H 3LGUA 5C3NA 5SGAE 1HJ9A 2ULLA 3M61U 3RXLA 2BQ7B 3AVZA 3I78A 4VGCC 1T32A 4CHAC 2Z6BD 3HPTB 3M5MA 1AY6H 1UTPA 1IQHA 3SJKA 4X2VA 7KMEH 3ATLA 1GI5A 4ZAEA 3RU4T 1MU8B 1O5CB 2CF8H 2VB0A 1ZPZA 1NC6A 3PTBA 3VXFH 1C1OA 2QC2A 1N8OB 2BZAA 5DJ7A 2BLQA 3E8LA 5JBTA 4HGCA 3C1KA 4H42U 4OS2A 1BJVA 1HXFH 5A2MH 2AERH 5DP5A 5C1XA 4B73A 1L2EA 4O97A 2J9NA 3PLBA 1XX9A 1O30A 4GCHF 2XCNA 1GVZA 2RDLA 3AASA 3T28A 1KTSB 3BTKE 1HAOH 1W2KH 4AB8A 5EGMA 2WYJA 3R0FA 1TGTA 1O2NA 3MFJA 2BDHA 1O39A 4A7IB 2ILNA 3KL6A 3L6PA 4D9RA 5J4SA 3BEFB 3EA9A 1GBMA 1DXPA 1BRBE 1J17T 1RTFB 4X0WU 1P09A 2GCTB 4SGBE 1E36B 2FOEA 1AKSB 1V2NT 6GCHF 5EQRA 1XKAC 5DP4A 1GPZA 1YLDA 5C67A 1UMAH 3S7HB 1ZRKA 1WCZA 1O3BA 1TA2A 5EU8A 3A89A 3RM2H 3A85A 3P92A 5A8YA 1T8LA 1CVWH 1YM0A 4UD9H 1QR3E 1Z71A 1KXBA 5CE1A 4WXIA 1AVXA 2GT7A 3SW2B 2GT8A 5FAHA 4MLFB 5E8EH 1AWHB 4KTUA 4NZQA 3QO6A 1O31A 3GYLB 1F5RA 1HAHH 3CS0A 2FP7B 2A5KA 1FZZA 4DIHH 3V7TA 1XVMA 4AFQA 1DVAH 2ZECA 1C1VH 4DGJA 1K21H 1RGQA 3U69H 3BV9B 4HZHA 3KQCA 1YPMH 5HM2A 1QIXB 3KF2A 2F9PA 1C2HA 2EI6A 1DXWA 2XBYA 3P70B 1C5NH 2M5TA 2A7JA 3PWBA 3M37A 4OS1A 2PKAB 2RCEA 3RXTA 2O9QA 1KDQA 1A5HA 1BJUA 1SGFA 1WUNH 1MKXK 1SGCA 1Z8IB 3T5FH 1KLTA 3ZV9A 1K1MA 3OX7U 3TGKE 1S5SA 2D26C 2ZO3H 2Q6FA 3HGNA 1LVBA 1UTMA 1BA8B 4A1TA 1J8AA 2XRCA 1NESE 1AI8H 1SHHB 3HKJB 1AO5A 1GHZA 1O2IA 1P2MA 1WTGH 3BTQE 4CR9A 3P8GA 4WXVA 1N1LA 4Y8XA 3STJA 1A1RA 4NIWA 1O2GH 3HKIB 3SUEA 1V2QT 5CHAC 4I32A 2AFQB 2J2UA 4E06H 2C8ZB
chains in the Genus database with same CATH superfamily
1JMOH 1SGDE 1EXFA 1N8OC 5T6GA 1ZMJA 4CRAA 1SLWB 2SGQE 2A4QA 1AIXH 2V35A 3RXOA 5HM9A 1AQ7A 3ATWA 4BAHB 1NS3A 1KY9A 3P8OA 1CT2E 3VG8A 5PTPA 2JJ1D 2GKVE 1IQFA 5DO4H 1XXDA 1Z1JA 1TGBA 1FAKH 1LCYA 4XRNA 3SV6A 3NPSA 2VIQA 4WH6A 1OWEA 5L30H 3SQHE 1ZHRA 1OP0A 2A2QH 2OCVB 2Z9LA 2QF0A 4NA9H 2BM2A 3N7EA 5DP6A 1AVGH 1P0SH 1Z7KA 2VIDA 3A7WA 2OC8A 5CDFE 1O5DH 1QJ7B 1WQSA 8GCHG 4K60A 1QA7A 1Z8JB 2RA0A 1C5UA 4RSPA 3A87A 1UTNA 2BD7A 4I8HA 1XUGA 1V2ST 1EPTB 2DE8A 2GCTC 3F2GA 1P9UA 4X6NA 1K22H 3E16B 1GI7B 1UK4A 1DITH 3P6ZB 2QGRA 4YXWD 3FP7E 4Z6AH 1DE7H 2GDDA 1HYLA 2NU2E 4ZHAA 2V6NA 2KX4A 4X8UH 1LQEA 3SJ9A 1D9IA 2ZTZA 4AOQA 3SJ8A 4DW2U 1OOKB 2V7QD 2FZZA 3SV2H 1MQ5A 1FMGA 1YPHC 2VWLA 1QL7A 1H9LB 3A7VA 1V2WT 3RXSA 4MTBA 5C0UA 3RMMH 2EC9H 5T6DA 1GVLA 3T26A 1FX0B 1GMHF 1O2VA 1BBRH 1O3AA 4H6TA 4MNWA 1UVSH 2ZGJA 2AIQA 2VBCA 1BTUA 1S85A 1ELAA 3EQ0H 1IQLA 2ZCLP 2OC7A 2IJOB 1EZQA 2P3UB 1AFEH 4YLQH 4ISNA 2ZHWH 2SGEE 1A3BH 1C4Y2 3PV2A 1Y3XA 2FOAA 3WY8A 3BEIB 2D2DA 1G9IE 1SGTA 4Q7XA 2ANYA 2TBSA 5LPFA 1IAUA 2Z3DA 2B8OH 5C5NA 1ELTA 3IITA 3L33A 1TMTH 5AFZH 4NG9H 3ATIA 2VVCA 1KXEA 1P2IA 3TJVA 2OP9A 3MHWU 2FOCA 1T7CA 4A5TS 1FY4A 1LPZB 1BCUH 2ZKSA 3SGAE 2VIOA 3SORA 3V0XA 1AE5A 2XW9A 1P06A 1C5MD 3CENA 1P03A 1WAYB 1FY1A 5EW1H 4FOUC 2A0QB 3I77A 1Y3YA 3OFND 1SLUB 5F8TA 4X1QU 1C2FA 3HATH 1O2MA 2VVUA 1GJ5H 2F4LA 1LHCH 4F55A 2HPQH 5DPAA 1THRH 3PMAB 1O3LA 1P57B 2XYAA 2G00A 4B71A 1MTUA 4ZH8A 1ORFA 4JK6A 4D9QA 3A8BA 2R2WU 1HIAA 2ZQ1A 2FYQA 5TCAA 2AMQA 1MD8A 3E0PB 3LC5A 1GJ9B 1QQUA 2JH0D 1BDAA 1FN6A 1OSSA 3NRLA 2LPRA 3SV7A 4TSFD 1ABJH 2GZ9A 1G3CA 2ZCKP 3SV8A 3E6PH 5K7RA 4ISHH 3SGBE 4X6PA 3CNRA 1N6XA 3AK5A 1A2CH 1VKYA 5GCHG 1NN6A 1BITA 2J97A 3A8CA 3MQKC 1EPTC 3W94A 1XUKA 3UREA 1XVOA 1HCGA 1O2ZA 1O3EA 2GVFA 3SU1A 1ZJDA 4UDWH 2ZU2A 3MH6A 3M7TA 1PQAA 1LKBA 4NA7A 1GI0A 1CQQA 3W1EA 1FIWA 2VWMA 1CU1A 1MBQA 4JMYA 3OTJE 4Y7AA 2AEIH 4E7NA 5C94A 2OBQA 2JJ2D 3BTFE 2P16A 1QL8A 4I86A 1VITF 2CN0H 5JBCS 2L74A 4Y8YA 2UUJB 4HG6A 3Q00A 4BAMB 1HBTH 1JRTA 2R3YA 4O3TA 3EE7A 5DP8A 1CA0C 1BTXA 1O33A 1UVOA 1OPHB 1KMHB 3RXRA 1O34A 5DG6A 1UHBB 3TLOA 1TX8A 3P95A 2FOHA 2A7HA 1H8DH 3MH5A 1SFQB 4E7RG 3LGYA 7ESTE 2JKHA 3E91A 1QZ8A 4CH8B 1A61H 3TNSA 1HJAB 1W0KD 1SOZA 2FPZA 5H4IB 2ZFTA 3S9AA 1OP2A 2CK3D 4NIXA 3ZZ9A 1WV7H 2OTVA 3RXVA 2FI5E 1GCDA 4IC5A 4X1PU 2KAIA 1SLVB 2B7DH 2HLDD 2P59A 1O3PB 5GPIB 3UNRA 5KGOA 1C5YB 4NGAH 3S7KB 2Y6TA 4GHQA 5F03A 4SGAE 2O8MA 1SOTA 2L6OA 1BMNH 2H9EH 3OY6U 1W7GH 4MPVA 3GY7A 2RG3A 5EXMA 1OS8A 1S84A 2BD9A 1TGSZ 1UCYE 4FU8A 4X8TH 1C5ZB 2VNTA 3KQ5A 3U1JB 1RJXB 3VFEA 1VJ9U 2ODQA 2P94A 1YYY1 5AVDA 1MCTA 1BB0B 1NU9A 1L1JA 2ANMH 3A7TA 3LU9B 5FX5A 4NFEA 3RM0H 2KCPA 1C2IA 2HOBA 3ATKA 1SGYE 3ZVFA 5EJZA 1ETTH 2GZ7A 2SGPE 4ZKRU 1Z8GA 4AC9A 1YLNA 4CBNA 4NZLA 3ITIA 2FOMB 4XD7D 2VVVA 4H6SB 2IOTA 1O3CA 2CHAB 1P2NA 2CXVA 3UR9A 1SB1H 1MUEB 2AH4X 3P8FA 3A8AA 1BMLA 1SQRA 1UVUH 1P8VC 2SGDE 4KP0A 1O2XA 4CBOA 4ESTE 2ZU5A 3BIUH 1UTKA 2PHBA 2D8WA 3UNSA 1V2TT 4B2AA 3A86A 1G30B 5EG4A 1TPSA 3TH2H 4DOQA 1O2YA 1WBGB 4HTCH 2Q1JA 1EAIA 4ISIH 1C1RA 1BUIA 1KLJH 3DSOA 3RMLH 1VR1H 3AW1A 2XWAA 4RKOB 3UIRA 3BIVH 1DY8A 1Y3UA 3E90B 2OQ5A 2HVYB 2BY5X 4YT7H 3U8RH 2UUFB 1MAYA 3MNBA 2GCHG 1AWFH 1MAXA 1EATA 3BTHE 3A7YA 2A45B 1UK2A 1FXYA 1HUTH 2EA3A 2PTNA 3KCGH 1Y8TA 1MZDA 5JB9S 2BY7X 1CHOG 1TX6A 4NA8A 3UAIC 1Z6EA 2BY9X 3S0NA 1EAUA 3PMJA 4U30A 3BTME 2FO9A 1KLIH 1WOFA 1NROH 4OGYA 3RXKA 3ZVCA 5K0HA 2ZDKA 4UEHH 1W12U 3KHVA 2GMTC 1ELCA 3BTTE 1ZRBA 3RXEA 1T4VH 1MD7A 3SU6A 1HJAC 1S83A 4X2YA 1LHFH 1C5TA 1PYTC 4YM9A 3MNCA 1BTZA 3F9GA 1Q31A 3M36A 1EOLA 1AB9B 5HIZA 3PWCA 1W11U 3MO9A 2JH5D 1L4ZA 2CGAA 4Q63A 2ZFFH 1G37A 4K1SA 1S81A 4UFEH 2BDYA 3VB5A 4GVUA 1KXDA 3RXPA 4ZKOU 2TGTA 3RC4A 1GBDA 4GAWA 3SZEA 2F91A 3O8DA 1YPLH 4YLUA 4IC6A 3KQDA 3GCNA 4BAOB 4IN1A 4Y8ZA 1GVKB 1HAPH 2V0BA 1OWHA 4PROA 1NFWA 3UUZA 5L2YH 3EAJA 1GI8B 1W10U 3MNXA 5JB8S 3M5NA 4AG2A 2GGVB 3A7XA 4B6EA 2BD8A 2YOLA 2AGGX 3WW7A 3SBKA 2CJIA 1GG6B 2ZA5A 1NM6A 3SQEE 1CE5A 4XBBA 5EW2H 4WY3A 1ESTA 3U8TH 1K1PA 2B9LA 2ASUB 3QTOH 4BTTB 1GJ4H 1VITH 1F5LA 1TRMA 1C1PA 2DE9A 5CHAB 2BXTH 1SGPE 3IG6B 3SO3A 3Q3YA 3FOAA 2CHAC 2Y81A 3RC5A 5LPRA 3F2HA 4UFGH 4H4FA 3VB7A 1E1RD 4RKJB 1EP6A 1PQ5A 3RXFA 1C5OH 1GHBF 1PPCE 1DUAA 2GJGA 2O8UA 3RXUA 1TNJA 5E0JA 1SKYE 3RUOA 1SI5H 3BEUA 4J1YA 5LH8A 3UWIA 4UFFH 1MTVA 2ANWA 4JYUH 3VEQB 1E34B 4KTCA 4OGXA 2F3CE 4OS7A 3QUMP 4NIVA 2CF9H 1XUHA 4UFDH 4ISOA 2OC1A 4I8JA 1O2RA 1ZZZA 3SI3H 3SU4A 1F7ZA 1W14U 1O3FA 2GV6A 2FOBA 1NRSH 3MU0A 1EJMA 2JETB 1TE0A 1EAXA 2HWLB 4K2YA 3KYGA 1NTPA 3DUXH 4ABDA 3URDA 1FONA 4LZ1H 3F9FA 2W7SA 1O3OA 2FOFA 1GHYH 3MU1A 1V2RT 1P3CA 3K6YA 1O5BB 4Y7BA 3TU7H 1FY3A 1LO6A 2EI8A 2ZCHP 1L0ZA 2NU1E 6CHAC 4ABHA 1CHGA 3H09A 2KM0A 2W3IA 1V2LT 3N99A 2R9PA 1HV7A 1AU8A 2YMSC 3SUDA 2ZP0H 1PPFE 4Q7YA 2G4UA 1TRYA 1PPBH 1AUJA 2FXRA 3TK9A 4D8NA 1TNIA 1IQIA 1B5GH 1AB9C 3JZ1B 1UO6A 4X2XA 4UONA 1QCPA 2XWBI 1OXGA 1ZHPA 4WJG2 7GCHF 1BRCE 1O2PA 1QJ6B 4NSYA 4I8LA 2PGBB 5JBBS 4F49A 2PWXA 1MBMA 3DCLA 3LOXA 5DSFA 3P8NA 4DIIH 1ELEE 2OQUA 1D6WA 2FTMA 4FUBA 3FP8E 1ZMNA 2PTCE 5BRRE 3QZRA 1ACBE 2F9NA 3GOVB 2Z94A 3QGNB 2BY6X 3G01A 4ZXYH 1O3JA 2XC4A 5HMAA 3RDZA 2VWNA 1VITG 3F6UH 2SGFE 3QTVH 1O2KA 1GBBA 1E79D 1T8OA 2A4GA 2ZC9H 5TJXA 3TPIZ 2TGDA 3QGJA 1C1UH 1AZZA 4TT3D 2R3UA 3OU0A 4TWWA 1GG6C 2ZHEH 3LGWA 3HGPA 4YT6H 5E2OA 2Z3EA 1K2I1 3RXMA 1H4WA 5E0GA 3U98H 1YPJH 3Q76A 1SPJA 2SNWA 4OS6A 2NU0E 1DY9A 1K9OE 2J98A 2LNCA 3MU4A 1O3GA 1BT7A 2VIVA 3KNXA 2P3TB 2VU8E 3VXEH 1CGJE 3VB3A 1O2OA 4RN6A 3PV4A 5C0TA 1RFNA 2HVXA 1ELGA 1HJ8A 1XKBC 1IHSH 1MZAA 2WPLS 2FS9A 1P3EA 2OC0A 1O0DH 2A7CA 2A1DB 1OHHD 4ABGA 4Y71A 1D3TB 4LOYH 1GJCB 2UUKB 1YPGH 1YBWA 3A7ZA 3SNAA 3A84A 3SUGA 4DVAU 2BVXH 4AORA 2ZGXH 4CH2B 4TY6A 1HNEE 1W13U 3UOUA 3F9HA 1B0FA 2C8XB 9ESTA 4IW4E 5EIYA 4NWKA 5JPMH 2JETC 4X1NU 5FCRA 4ZHMU 4DG4A 1ZSKA 1GBFA 1AGJA 1ZLRA 2P93A 2B0FA 5FPSA 3MWIU 3L3TA 1K1IA 1LTOA 5F53A 3PTNA 2H9TH 3BF6H 5FPTA 3GISB 3SN8A 4B76A 3GYMA 3RXDA 1GMCG 3UPEA 1SLXB 3RP2A 4NFFA 4DURA 1FAXA 1E0FD 3PLKA 4ACBA 4CRBA 1DPOA 1GI1A 5JYIA 1V2UT 1HDTH 4MDSA 1GMDF 4M9FA 1EOJA 1XUFA 3MO3A 1LVYA 1YP9A 3C27B 4K8YA 5C20A 1O2QA 3SOSA 1SSXA 4ABEA 1DFPA 3ZYDA 3P17H 1CA0B 2A5IA 2BLOA 1C9TA 1PQ8A 1CA8B 1YGCH 4XDEA 3PV5A 1OKXA 2I6QA 2EQNA 1M9UA 1K28D 2CV3A 1P12E 1FPCH 1FQ3A 1HGTH 1PYTD 3GCTF 1E37B 4E05H 1HRTH 2IPQX 1DWBH 2GDEH 2NWNA 2VGCC 3TGIE 5DK1A 4ACAA 1G36A 1LHDH 3SYJA 1QRZA 4FETA 1KSNA 1C1WH 1AVWA 3BTDE 1T8MA 1BOQA 5EJLA 4DCDA 1BTHH 5EQSA 1BIOA 1TGNA 3SJIA 3PM3A 2PSXA 1W0JD 3QX5H 4U32A 5GDSH 1QJ1B 1DUEA 2KZ4A 2SFAA 2J38A 1MKWH 2THFB 3F9EA 1BMAA 1V2PT 3A82A 4DT7B 1W8BH 1LHEH 1IQNA 4CRCA 5F6MA 1HAVA 3DD2H 1PFXC 3RU4E 3SNBA 3LT3A 2F9BH 3GY8A 1YCPK 1BTWA 2FLBH 2QF4A 3KIDU 3ZZ5A 2G81E 1HPGA 1A5GH 1C2EA 1GBCA 3AAUA 1V2OT 1A46H 5KEDA 4CRDA 1G3BA 3TJOA 1QNJA 1QTFA 1H8HD 1MCVA 3QK1A 4AFSA 3MI4A 4D7GA 5GIBA 3DFJA 5ESBA 2VJ1A 4JZFH 3MYWA 1YLCA 2ZGHA 2YNAA 3SNDA 1G3EA 2JDID 3RMOH 3T29A 5L2ZH 3AAVA 1TOCB 1NRPH 4FUDA 4GPGA 3OEHD 5EJ1A 2C3SA 2PSYA 5GWZA 1GBJA 1PPHE 2ODPA 3DFLA 3FZDA 4WMFA 1WU1A 1L1GA 3RXGA 2BDCA 1C1SA 3LGIA 4F4OC 1OYQA 1CT4E 2PGQB 1XXFA 1AE8H 1DWEH 2I6SA 1Y5AT 4YO9A 3NK8A 1KDQB 2FODA 3ODDA 4Y79A 3GS9A 2ZDVH 2ZU1A 2W6ID 4YZUA 3ENSB 3UQVA 1GL1A 4TPYA 2FESH 3GY3A 3RXJA 1GDNA 4J2YB 2G8TA 1C5LH 5GNDA 1GDQA 2K0QA 2F83A 1UTQA 2G51A 5EXNA 1TRNA 3D49H 2IPHA 1BQYA 1TPOA 3GDSA 4GCHG 4FUJA 1MTWA 5EXLA 1O37A 2ZGBH 2ZFPH 4U2WA 2FTLE 5ETXA 4ABFA 2GMTB 1GHVH 3SUFA 2YMSD 2QIQA 1GI2A 1VJAU 4CREA 1BMFD 4TWYA 4AFZA 1TGCA 1GBHA 1NO9H 5EPNA 1ESBA 1O5EH 1DICA 4ABBA 1O38A 3IWMA 1Y3VA 4FU7A 2BHGA 4MVNA 1QA0A 1P01A 6GCHG 1TNKA 2EI7A 3ZZAA 1O36A 1QBOA 2AGIX 1EKBB 5C2ZA 1DM4B 3KYFA 1Y5UT 2UWPA 1GBKA 3PO1B 1MKXH 2CMYA 4ISLA 1QB1A 2EEKA 3M5LA 4BTIB 1LQDB 1KYNA 3SU5A 5T1VA 5ABWA 1EZSC 3S69A 3SV9A 4B1TA 1E1QD 1C5VA 1LPGB 4AN7A 3FO8D 1TBQH 5EOKA 1TOMH 3WWBA 4ZXXH 1B7XB 2BY8X 2PUQH 3EE0B 2GP9B 1AZ8A 2TGAA 4ASUD 1E35B 1P9SA 1ETSH 1XUJA 3FKSD 1WDIA 8LPRA 5T6FA 1ANEA 3GCHC 2A31A 2C93B 1C1MA 3TIUA 2ZDMA 1O2HA 3ZV8A 2BOKA 2D1JA 5KECA 2KFWA 2WHXA 2BDIA 1EASA 1AKSA 2FX4A 4GUXA 4GSOA 3O8BA 4R8TB 5A8ZA 1BHXB 2BD5A 1D6RA 1FIZA 5GJ4B 1PPZA 1SG8B 1S0QA 3F0PA 2W7UA 1C5RA 4A6LA 8GCHF 1MQ6A 3NZIA 1GJBB 5FX6A 2C8YB 1VCPA 1O2SA 1QRXA 1RS0A 3LJJA 4MNXA 2IN2A 1A7SA 1PPEE 3GDVA 4DT4A 3MMGA 3U8OH 4JZEH 1GCTB 2J94A 1KXAA 1ARCA 1DANH 4X8SH 4JYTA 2ZNKH 1ESAA 2Z9JA 3S9CA 1YKTA 3R3GB 2ZHQH 1INCA 1DX5M 1JRSA 3DA9B 4OS4A 3K65B 5E2PA 1G3DA 2BX3A 1YY3A 1GHAF 2OXSA 3ZZ8A 1K1LA 3QZQA 1SQTA 2XCFA 1MTNB 4TY7A 2Z9IA 1HFDA 3TH4H 1Q3XA 5DP9A 1RTKA 2FMJA 4AX9H 2A5AA 1TPPA 2PKAA 1TNHA 2QY0B 3D23A 5JDUB 3ZVGA 1QBNA 2BMGB 4YOJA 4Y11E 2XBWA 1C1QA 3BG8A 3NKKA 1F0TA 2K1QA 1EX3A 1O3IA 1QURH 1GI4A 2BZ6H 6CHAB 1P2JA 1SGNE 2TPIZ 3F3BA 1X7AC 4ABAA 4O03A 2ZPQA 1ZTKA 2WUBA 1ANBA 2KR7A 2FI4E 2PP6A 3ZVDA 1QHRB 3LPRA 2YMSB 4JK5A 2P95A 1YF4A 1VCWA 3O8RA 1DWCH 5F8ZA 4ZKSU 1D4PB 2ZQ2A 4B2CA 4WMEA 2BDBA 1LVOA 3UR6A 3FFGA 5L6NH 2ZWLH 2JIZD 1HIAB 2ALPA 3PMBB 1Q2WA 3QDZB 1SR5C 5A0AE 1G2MA 1ZTLA 3UY9A 2AGEX 3SZNA 2H2ZA 2KCYA 4K3JA 1C5SA 1DDJA 3GDUA 1EZUC 2AIPA 2H1UA 2Y7XA 1C4V2 1S6HA 3PO1C 3TVJB 1BBRK 4X1RU 1C5QA 1S6FA 2BLVA 2Q6GA 4CR5A 1THSH 2FYRA 1J9CH 1YCPM 2VH6A 4Y10E 1K1NA 4R0IA 4YESB 3VPKA 2QXGA 3ATMA 3QLPH 1VCQA 3RC6A 1GMHG 1T31A 4K1TA 4BXSA 2ZFRH 3GY6A 4AFUA 1OWJA 4XOJA 3MU5A 1HAZB 4BANB 4TPIZ 2GZ8A 3SHCH 1TQ0B 1JIMA 1C2GA 1RRKA 3GCOA 4A1XA 1ANCA 5J4QA 1EPTA 3PLPA 3BG4B 3SU3A 6LPRA 1CBWB 2P3FH 2B5TB 4I8GA 3LC3A 4NIYA 4FUHA 2A2XH 1QBVH 2ZPSA 1ELVA 4O3UA 1TONA 1MKWK 4Y0YE 2W5EA 4ZMAH 1L4DA 1IQMA 1T8NA 1UK3A 1SC8U 2WYGA 5GCHF 1P11E 3ELAH 1D3PB 3DHKH 2VWOA 1GI3A 3K2UA 2PKSC 5GXPA 1HXEH 4YOIA 1JXPA 1UVPA 1ARBA 3BTWE 3PRDA 2G55A 1O35A 2KAIB 3TK6A 2FX6A 1GCTC 3ESTA 4D7FA 3T27A 2QV1A 2QXIA 4QT8C 3VGCB 3FAOA 4AG1A 1MU6B 4B75A 1ZOMA 1GJ7B 2BDAA 2HPPH 3A83A 1NZQH 1FUJA 1EB2A 2F9UA 2OK5A 3ZZ7A 3T2NA 1NY22 2WPKS 3UFAA 1OP8A 1TNGA 3RXBA 4DY7B 1MTNC 2Y5GA 1SQOA 3TNTA 1ZR0A 2QXHA 3KN2A 1O5AB 4INHA 3LGTA 5AHGH 4B6FA 2OBOA 2PV9B 3TJNA 2BD3A 2Y5FA 1OWIA 3RXQA 1AFQB 5C17A 8ESTE 5BPEA 3PRBA 1KXFA 5JBAS 2A4RA 4IMZA 1H8IH 2RA3A 2ZTYA 1O32A 4LXBH 4THNH 2BD2A 3RXCA 2BB4A 4DJZB 1N6YA 3MNSA 1ZMLA 2J95A 4K1EA 4X2WA 6ESTA 4CRFA 2Y82A 3OEED 2ZTXA 3OYPA 3U28C 4WH8A 1MABB 3HK6B 3EDXB 1VZQH 3O8CA 3Q77A 1LHGH 2R0LA 1FLEE 2F9VA 1P04A 3KEEA 4M7GA 4WWYA 1TNLA 3SI4H 3Q3XA 2XTTB 1OWDA 1U6QA 2ZHFH 3PROA 3TH3H 2Z9KA 4YTAA 2XXLA 3BTEE 2W26A 1TWXB 1Y59T 5CHBA 3URCA 4JZIA 3A80A 4OS5A 1YPKH 5I25A 2VGCB 3T25A 1HAXB 1RIWC 2BD4A 5A8XA 1O3HA 4CRGA 4Y6DA 1Z1IA 3LH3A 2V3HH 5G4BA 3LDXH 1P10A 2BLWA 2V3OH 4XBDA 4P00A 1KTTB 4Z1MD 2O8TA 2BX4A 1UTLM 1C2MA 2STAE 4INLA 1LDTT 3GY5A 4XE4A 1PQ7A 1MMJN 1UCYH 1UTOA 2QN5T 3F1SB 3N7DA 4O9VA 2ZI2H 3BSQA 1CT0E 4NCYA 2P8OC 4JZDH 1QB6A 1NFUA 3LONA 3RLWH 1TYNA 1W0ZU 3BG4C 5T3HA 1OX1A 4FVDA 1FDPA 4AGKA 1CBWC 1SVPA 4KELA 1P2OA 4ZKNU 4RT0A 1ZPBA 1BTPA 5AF9H 3LIWA 2BYAX 1WXRA 1O5GH 1GJ6A 1P02A 1DSUA 1GBIA 2VIPA 2FDAA 2ZDLA 3MOCA 1ETRH 1GBEA 3JZ2B 1E38B 1ANDA 1LKAA 1ZGIA 3SNEA 1V2VT 3TITA 2W3KA 2WV5A 1IOEA 1V3XA 3U9AH 2F9OA 5C1YA 4BXWA 4U01A 1JIRA 4A1VA 2ZU3A 3F0OA 2XBXA 3VGCC 1A0JA 4I8KA 1NFXA 1QY6A 2GCHF 2KCOA 4MPUA 1UHBA 2Y7ZA 4RT1A 2BQWB 2UWLA 3KQBA 4XFQA 1P2QA 3ZZDA 2VH0A 4I7YH 2BTCE 5HKKD 1CHOF 4D76A 3H7TA 3A8DA 1UVTH 2WPMS 2RDEA 1PPGE 4BAQB 2ZZUH 3K6ZA 3T62A 1EJNA 1FI8A 1AUTC 1AFQC 3I29A 1UJ1A 3SU0A 1XMNB 5EQQA 1ID5H 1WYKA 1QFKH 1TMUH 4KGAA 1GJAB 1LVMA 3N7OA 5HYOA 5A09A 3TK5A 5FPYA 4JYVH 2J4IA 1A5IA 1H8ED 1A0LA 2WV9A 1ELBA 3UOPA 1W0YH 4HI3A 1V6DA 4GHTA 1O2JA 1Y3WA 2OLGA 1HLTH 1LMWB 2HRVA 1C1TA 4Q2KA 3WWFA 4MG3A 1ZSLA 1EB1H 3LGVA 2G5NA 3SNCA 4AB9A 1S6LA 2C4FH 1OYTH 2HALA 4KKDA 4WVPE 1GHAG 3UB0A 4FUFA 1S0RA 1S82A 1D3DB 3E3TA 2HNTE 1AMHA 2WV4A 2YNBA 1SHYA 1CGHA 2GV7A 1FN8A 1KIGH 1V2JT 2QAAA 2ALVA 4Y0ZE 3MH7A 8KME2 3D65E 4FUCA 1UW7A 4MNVA 4UE7H 4FVBA 1IQEA 5IK2D 1O2UA 2FOGA 3KGPA 2H5CA 1NRRH 3K9XB 4X1SU 3KQEA 1J16A 4KTSA 2PFEA 3FVFB 2SGAA 1EUFA 1SL3A 1RTLA 1K1OA 5IDKA 3W95A 2GTBA 4AZ2B 5A0BA 4Q4LA 3UQOA 4LZ4B 3PMHB 1TLDA 1F5KU 1TABE 1C1NA 4WMDA 1SGEE 2A32A 4FU9A 5DP3A 2AHME 4FUEA 4Z0KA 3E1XB 2WPHS 2NU4E 3B23B 1EZXC 2O8WA 3U1IB 1L1NA 3GCHB 2AMPA 3BTGE 1OWKA 1FY5A 1GL0E 3OE7D 4AGJA 2ZEBA 2G4TA 1ABIH 3ZIAD 1GI9B 1XUIA 1BTYA 1FJSA 3M7QA 5DN6D 3H7OA 1QQ4A 4AYVB 1C2DA 2BXUH 3VB6A 3Q3KA 5C1UA 3UNQA 1J15A 1GGDB 1UTJA 2WUCA 2FS8A 1QRWA 5HIYA 4X6MA 4AYYB 2O8LA 1QL9A 1TB6H 1GWAA 2Z3CA 1GJ8B 1TPAE 2ZGCA 2ZFSA 2HNTF 2ZU4A 4JZ1A 4OM9A 3RU4D 3TGJE 1IHTH 1Z8RA 4BTUB 4MQAA 2BVRH 1K0HA 1TX7A 1TQ7B 2BQ6B 3LJOA 3GY2A 2Z9GA 2A4OA 3M3VA 2WPJS 2WPIS 3V12A 2ZDNA 4X6OA 4ZHLU 1EAWA 5FHTA 1BZXE 2JH6D 7LPRA 3D62A 1ZHMA 3DSPA 3ZZCA 5F8XA 4BAKB 5LPEA 1F0UA 1YC0A 2OINA 1D3QB 2QF5A 5I46H 4XBCA 3RLYH 1BHXF 1GHBG 3MO6A 2QYIA 3M7UA 1GBLA 1HB0B 3H5CB 2R2MB 3NUMA 2OUAA 1SBWA 5FBIA 3NCLA 3TJUA 2GD4B 4XSKU 1TBRH 1C9PA 1F2SE 5DGJA 3VB4A 2KCAA 1NT1A 1DLEA 1W3CA 3FANA 3M3TA 2TRMA 5A0CA 2STBE 2J98B 2OD3B 2QF3A 3PB1E 5LGOA 1CO7E 2FIRH 1VGCB 3EYDA 3RXIA 3UTUH 2QE7D 3M3SA 1ZTJA 2J92A 1C5PA 1C5XB 4IN2A 1H9IE 2NU3E 1BRUP 3RXAA 1Y5BT 1ZYOA 1IQKA 5DP7A 1GBAA 3ZVBA 3CS7A 5DKMA 3UWJH 4ASHA 4A92A 1K1JA 3V13A 2ZF0H 2GX4A 3S9BA 3MU8A 2FEQH 3F2FA 2H6MA 5TCCA 4Q7ZA 4K5ZA 3B9FH 1NU7B 2WINI 4B2BA 4MPWA 4BNRA 1DS2E 3ZZ4A 1THPB 1NPMA 4ZROA 1ZGVA 1XM1A 2H9HA 1IQJA 3RXHA 2ZDAH 1NRNH 2Q6DA 4X8VH 4GLYA 1HAGE 1BMMH 4FUIA 1V2KT 3E0NB 1FPHH 1H1BA 3ZVAA 1EQ9A 1O2WA 2J34A 1A4WH 1JWTA 2UUYA 4IS5A 3ZYEA 2HLCA 1GI6A 1MTSA 2FLRH 1EP5A 3EGKH 5FXLA 1O2LA 7GCHG 2WSSD 1GDUA 1JBUH 5HXFA 1P05A 2TIOA 4I33A 2QXJA 3HK3B 1AHTH 1YWUA 4I31A 1NBME 4NSVA 3OTPA 5ESTE 3FZZA 3NWUA 3SU2A 2PW8H 1MH0A 1C2KA 4YOGA 1T4UH 2G52A 1FNIA 1O3MA 2DUCA 2QA9E 2K8IA 2WPDD 2XBVA 1UCYK 3LH1A 1NFYA 1GGDC 1O5FH 1TBZH 3FN8A 3RMNH 1C5WB 3V3MA 1C4U2 1DOJA 5CMXH 4VGCB 2PKSB 3SGQE 1V2MT 4ABJA 4CHAB 5E0HA 2LP6A 1TALA 3F68H 2HGTH 3EA7A 1A3EH 1GMCF 3GICB 1NBMD 1SFIA 3M35A 5FCKA 4WF8A 2UWOA 1NRQH 3ZZ6A 1ZSJA 1WSSH 2C8WB 4B74A 2AS9A 4K69A 5FBEA 4IBLH 1C2LA 2ZG0H 1SGRE 2PUXB 3ZVEA 1ZPCA 1SGIB 4ABIA 1CGIE 4MPXA 1F92A 1LPKB 1TMBH 2ZPRA 3FP6E 1DWDH 4Q80A 2AYWA 1ELFA 5HGGA 3AW0A 1Z6JH 3EA8A 4ZUHA 1HAVB 1YPHE 1O2TA 1GBTA 2F43B 4FXGH 1TA6A 4MNYA 2BDGA 4INKA 1FY8E 3QN7A 1GJDB 3CP7A 2ZHDA 2BVSH 5C5OA 1SQAA 1VGCC 2ESTE 1PJPA 3PYHA 2Y5HA 1ZJKA 1CSOE 2H5DA 2SNVA 1F0RA 2FWWA 1A0HB 1DLKB 3SHAH 1TFXA 1GHXH 2XC5A 3ODFA 1JOUB 1G32B 1WTHD 3OY5U 2FI3E 3STIA 1IQGA 3SJOA 1W7XH 2TGPZ 1BBRE 3ZZ3A 1SGQE 1O3NA 1C2JA 4NWLA 9LPRA 3B8JA 1YPEH 3NXPA 1F0SA 4JCNA 1RXPA 4F48B 1AN1E 1G2LA 3MTYA 1HAYB 1DT2A 3GY4A 1BRAA 2ANKH 4IGDA 2QCYA 1B0EA 2XNIA 2PLXA 1FV9A 1GHWH 3QWCH 1P2KA 1RIWB 1GMDG 2FM2A 4IMQA 1EFRD 2R0KA 2BOHB 2AMDA 2HNTC 5EODA 2ODYB 1KXCA 5EPYA 4TYDA 5IYTA 3ZZBA 5B6OA 1O3DA 5AFYH 4Y76A 4K8BA 3MH4A 1DSTA 2C90B 5FL7D 2ZFQH 3A88A 1ELDE 3OAAD 1YCPH 3M5OA 1QB9A 3A81A 3OSYA 2VINA 2V3MA 2PR3A 4FUGA 1WQVH 1TIOA 2Y80A 4BOHA 2VIWA 2P8OB 1SGFG 1O3KA 1TAWA 2WZQA 2Z7FE 1HAIH 2XC0A 1SMFE 4HFPB 3GCTG 1RD3B 4LK4A 1H9HE 1AD8H 1QGFA 2ZIQH 1EJAA 3BN9A 1J14A 2G5VA 3LKWA 3DT0H 3LGUA 2XOKD 5C3NA 5SGAE 1HJ9A 2ULLA 3M61U 3RXLA 2BQ7B 3AVZA 3I78A 4VGCC 1T32A 4CHAC 2Z6BD 2IJD1 3HPTB 3M5MA 1AY6H 1UTPA 1IQHA 3SJKA 4X2VA 7KMEH 3ATLA 1GI5A 4ZAEA 3RU4T 1MU8B 1O5CB 2CF8H 2VB0A 1ZPZA 1NC6A 3PTBA 2RFKC 3VXFH 1C1OA 2QC2A 1N8OB 2BZAA 5DJ7A 2BLQA 3E8LA 5JBTA 4HGCA 3C1KA 4H42U 4OS2A 1BJVA 1HXFH 5A2MH 2AERH 5DP5A 5C1XA 5B6LA 2EY4C 4B73A 1L2EA 4O97A 2J9NA 3PLBA 1XX9A 1O30A 4GCHF 2XCNA 1GVZA 2RDLA 3AASA 3T28A 1KTSB 2J5UA 3BTKE 1HAOH 1W2KH 4AB8A 5EGMA 2WYJA 3R0FA 1TGTA 1O2NA 3MFJA 2BDHA 1O39A 4A7IB 2ILNA 3KL6A 3L6PA 4D9RA 5J4SA 3BEFB 3EA9A 1GBMA 1DXPA 1BRBE 1J17T 2LELA 1RTFB 4X0WU 1P09A 2GCTB 4SGBE 1E36B 2FOEA 1AKSB 1V2NT 6GCHF 5EQRA 1XKAC 5DP4A 1GPZA 1YLDA 5C67A 1UMAH 3S7HB 1ZRKA 1WCZA 1O3BA 1TA2A 5EU8A 3A89A 3RM2H 3A85A 3P92A 5A8YA 1T8LA 1CVWH 1YM0A 4UD9H 1QR3E 1Z71A 1KXBA 5CE1A 4WXIA 1AVXA 2GT7A 3SW2B 2GT8A 5FAHA 4MLFB 5E8EH 1AWHB 4KTUA 3DSGA 4NZQA 3QO6A 1O31A 3GYLB 1F5RA 1HAHH 3CS0A 4P02A 2FP7B 2A5KA 1FZZA 4DIHH 3V7TA 1XVMA 4AFQA 1DVAH 2ZECA 1C1VH 4DGJA 1K21H 1RGQA 3U69H 3BV9B 4HZHA 3KQCA 1YPMH 5HM2A 1QIXB 3KF2A 2F9PA 2XNDD 1C2HA 2M2AA 2EI6A 1DXWA 2XBYA 3P70B 1C5NH 2M5TA 2A7JA 3PWBA 3M37A 4OS1A 2PKAB 2RCEA 3RXTA 2O9QA 1KDQA 1A5HA 1BJUA 1SGFA 1WUNH 1MKXK 1SGCA 1Z8IB 1COWD 3T5FH 1KLTA 3ZV9A 1K1MA 3OX7U 3TGKE 1S5SA 2D26C 2ZO3H 2Q6FA 3HGNA 4RI0A 1LVBA 1UTMA 1BA8B 4A1TA 1J8AA 2XRCA 1NESE 1AI8H 1SHHB 3HKJB 1AO5A 2W6JD 1GHZA 1O2IA 1P2MA 1WTGH 3BTQE 4CR9A 3P8GA 4WXVA 1N1LA 4Y8XA 3STJA 1A1RA 4NIWA 1O2GH 3HKIB 3SUEA 1V2QT 5CHAC 4I32A 2AFQB 2J2UA 4E06H 4ZCNA 2C8ZB
chains in the Genus database with same CATH topology
1JMOH 1SGDE 1EXFA 1N8OC 5T6GA 1ZMJA 4CRAA 1SLWB 2SGQE 2A4QA 1AIXH 2V35A 3RXOA 5HM9A 1AQ7A 3ATWA 4BAHB 1NS3A 1KY9A 3P8OA 1CT2E 5PTPA 2GKVE 1IQFA 5DO4H 1XXDA 1Z1JA 1TGBA 1FAKH 1LCYA 3SV6A 3NPSA 2VIQA 4WH6A 1OWEA 5L30H 3SQHE 1ZHRA 1OP0A 2A2QH 2OCVB 2Z9LA 2QF0A 4NA9H 2BM2A 5DP6A 1AVGH 1P0SH 1Z7KA 2VIDA 3A7WA 2OC8A 1O5DH 1QJ7B 1WQSA 8GCHG 4K60A 1QA7A 1Z8JB 2RA0A 1C5UA 4RSPA 3A87A 1UTNA 2BD7A 4I8HA 1XUGA 1V2ST 1EPTB 2DE8A 2GCTC 1P9UA 4X6NA 1K22H 3E16B 1GI7B 1UK4A 1DITH 3P6ZB 2QGRA 3FP7E 4Z6AH 1DE7H 2GDDA 1HYLA 2NU2E 4ZHAA 2V6NA 4X8UH 1LQEA 3SJ9A 1D9IA 2ZTZA 4AOQA 3SJ8A 4DW2U 1OOKB 2FZZA 3SV2H 1MQ5A 1FMGA 1YPHC 2VWLA 1QL7A 1H9LB 3A7VA 1V2WT 3RXSA 4MTBA 3RMMH 2EC9H 5T6DA 1GVLA 3T26A 1GMHF 1O2VA 1BBRH 1O3AA 4H6TA 4MNWA 1UVSH 2ZGJA 2AIQA 1BTUA 1S85A 1ELAA 3EQ0H 1IQLA 2ZCLP 2OC7A 2IJOB 1EZQA 2P3UB 1AFEH 4YLQH 4ISNA 2ZHWH 2SGEE 1A3BH 1C4Y2 1Y3XA 2FOAA 3WY8A 3BEIB 2D2DA 1G9IE 1SGTA 4Q7XA 2ANYA 2TBSA 5LPFA 1IAUA 2Z3DA 2B8OH 5C5NA 1ELTA 3IITA 3L33A 1TMTH 5AFZH 4NG9H 3ATIA 2VVCA 1KXEA 1P2IA 3TJVA 2OP9A 3MHWU 2FOCA 1T7CA 4A5TS 1FY4A 1LPZB 1BCUH 2ZKSA 3SGAE 2VIOA 3SORA 3V0XA 1AE5A 2XW9A 1P06A 1C5MD 3CENA 1P03A 1WAYB 1FY1A 5EW1H 2A0QB 3I77A 1Y3YA 1SLUB 5F8TA 4X1QU 1C2FA 3HATH 1O2MA 2VVUA 1GJ5H 1LHCH 2HPQH 5DPAA 1THRH 3PMAB 1O3LA 1P57B 2XYAA 2G00A 4B71A 1MTUA 4ZH8A 1ORFA 4JK6A 4D9QA 3A8BA 2R2WU 1HIAA 2ZQ1A 2FYQA 5TCAA 2AMQA 1MD8A 3E0PB 3LC5A 1GJ9B 1QQUA 2JH0D 1BDAA 1FN6A 1OSSA 2LPRA 3SV7A 1ABJH 2GZ9A 1G3CA 2ZCKP 3SV8A 3E6PH 5K7RA 4ISHH 3SGBE 4X6PA 1N6XA 1A2CH 5GCHG 1NN6A 1BITA 3A8CA 1EPTC 3W94A 1XUKA 3UREA 1XVOA 1HCGA 1O2ZA 1O3EA 2GVFA 3SU1A 1ZJDA 4UDWH 2ZU2A 3MH6A 3M7TA 1PQAA 1LKBA 4NA7A 1GI0A 1CQQA 1FIWA 2VWMA 1CU1A 1MBQA 4JMYA 3OTJE 4Y7AA 2AEIH 4E7NA 2OBQA 3BTFE 2P16A 1QL8A 1VITF 2CN0H 5JBCS 4Y8YA 2UUJB 3Q00A 4BAMB 1HBTH 1JRTA 2R3YA 4O3TA 5DP8A 1CA0C 1BTXA 1O33A 1UVOA 1OPHB 3RXRA 3TLOA 1O34A 5DG6A 1UHBB 1TX8A 3P95A 2FOHA 2A7HA 1H8DH 3MH5A 1SFQB 4E7RG 3LGYA 7ESTE 2JKHA 3E91A 4CH8B 1A61H 3TNSA 1HJAB 1SOZA 2FPZA 5H4IB 2ZFTA 3S9AA 1OP2A 4NIXA 3ZZ9A 1WV7H 2OTVA 3RXVA 2FI5E 1GCDA 4IC5A 4X1PU 2KAIA 1SLVB 2B7DH 2P59A 1O3PB 5GPIB 3UNRA 1C5YB 4NGAH 3S7KB 2Y6TA 4GHQA 5F03A 4SGAE 2O8MA 1SOTA 1BMNH 2H9EH 3OY6U 1W7GH 4MPVA 3GY7A 2RG3A 5EXMA 1OS8A 1S84A 2BD9A 1TGSZ 1UCYE 4FU8A 4X8TH 1C5ZB 2VNTA 3U1JB 1RJXB 3VFEA 1VJ9U 2ODQA 2P94A 1YYY1 5AVDA 1MCTA 1BB0B 1NU9A 1L1JA 2ANMH 3A7TA 3LU9B 5FX5A 4NFEA 3RM0H 1C2IA 2HOBA 3ATKA 1SGYE 3ZVFA 1ETTH 2GZ7A 2SGPE 4ZKRU 1Z8GA 4CBNA 4NZLA 3ITIA 2FOMB 2VVVA 4H6SB 2IOTA 1O3CA 2CHAB 1P2NA 2CXVA 3UR9A 1SB1H 1MUEB 2AH4X 3P8FA 3A8AA 1BMLA 1UVUH 1P8VC 2SGDE 4KP0A 1O2XA 4CBOA 4ESTE 2ZU5A 3BIUH 1UTKA 2PHBA 2D8WA 3UNSA 1V2TT 4B2AA 3A86A 1G30B 5EG4A 1TPSA 3TH2H 4DOQA 1O2YA 1WBGB 4HTCH 2Q1JA 1EAIA 4ISIH 1C1RA 1BUIA 1KLJH 3RMLH 1VR1H 3AW1A 2XWAA 4RKOB 3UIRA 3BIVH 1DY8A 1Y3UA 3E90B 2OQ5A 2BY5X 4YT7H 3U8RH 2UUFB 1MAYA 3MNBA 2GCHG 1AWFH 1MAXA 1EATA 3BTHE 3A7YA 2A45B 1UK2A 1FXYA 1HUTH 2EA3A 2PTNA 3KCGH 1Y8TA 1MZDA 5JB9S 2BY7X 1CHOG 1TX6A 4NA8A 3S0NA 1Z6EA 2BY9X 1EAUA 3PMJA 4U30A 3BTME 2FO9A 1KLIH 1WOFA 1NROH 4OGYA 3RXKA 3ZVCA 5K0HA 2ZDKA 4UEHH 1W12U 3KHVA 2GMTC 1ELCA 3BTTE 1ZRBA 3RXEA 1T4VH 1MD7A 3SU6A 1HJAC 1S83A 4X2YA 1LHFH 1C5TA 1PYTC 4YM9A 3MNCA 1BTZA 3F9GA 1Q31A 3M36A 1EOLA 1AB9B 3PWCA 1W11U 3MO9A 2JH5D 1L4ZA 2CGAA 2ZFFH 1G37A 4K1SA 1S81A 4UFEH 2BDYA 3VB5A 4GVUA 1KXDA 3RXPA 4ZKOU 2TGTA 3RC4A 1GBDA 4GAWA 2F91A 3O8DA 1YPLH 4YLUA 4IC6A 3KQDA 3GCNA 4BAOB 4IN1A 4Y8ZA 1GVKB 1HAPH 2V0BA 1OWHA 4PROA 1NFWA 3UUZA 5L2YH 3EAJA 1GI8B 1W10U 3MNXA 5JB8S 3M5NA 4AG2A 2GGVB 3A7XA 2BD8A 2YOLA 2AGGX 3SBKA 2CJIA 1GG6B 2ZA5A 1NM6A 3SQEE 1CE5A 4XBBA 5EW2H 4WY3A 1ESTA 3U8TH 1K1PA 2B9LA 2ASUB 3QTOH 4BTTB 1GJ4H 1VITH 1F5LA 1TRMA 1C1PA 2DE9A 5CHAB 2BXTH 1SGPE 3IG6B 3SO3A 3Q3YA 2CHAC 2Y81A 3RC5A 5LPRA 4UFGH 4H4FA 3VB7A 4RKJB 1EP6A 1PQ5A 3RXFA 1C5OH 1GHBF 1PPCE 1DUAA 2O8UA 3RXUA 1TNJA 5E0JA 3RUOA 1SI5H 3BEUA 4J1YA 5LH8A 3UWIA 4UFFH 1MTVA 2ANWA 4JYUH 3VEQB 1E34B 4KTCA 4OGXA 2F3CE 4OS7A 3QUMP 4NIVA 2CF9H 1XUHA 4UFDH 4ISOA 2OC1A 4I8JA 1O2RA 1ZZZA 3SI3H 3SU4A 1F7ZA 1W14U 1O3FA 2GV6A 2FOBA 1NRSH 3MU0A 1EJMA 2JETB 1TE0A 1EAXA 2HWLB 4K2YA 1NTPA 3DUXH 4ABDA 3URDA 1FONA 4LZ1H 3F9FA 2W7SA 1O3OA 2FOFA 1GHYH 3MU1A 1V2RT 1P3CA 3K6YA 1O5BB 4Y7BA 3TU7H 1FY3A 1LO6A 2EI8A 2ZCHP 1L0ZA 2NU1E 6CHAC 4ABHA 1CHGA 2W3IA 1V2LT 2R9PA 1HV7A 1AU8A 3SUDA 2ZP0H 1PPFE 4Q7YA 2G4UA 1TRYA 1PPBH 1AUJA 2FXRA 3TK9A 4D8NA 1TNIA 1IQIA 1B5GH 1AB9C 3JZ1B 1UO6A 4X2XA 4UONA 1QCPA 2XWBI 1OXGA 1ZHPA 4WJG2 7GCHF 1BRCE 1O2PA 1QJ6B 4NSYA 4I8LA 2PGBB 5JBBS 4F49A 2PWXA 1MBMA 3LOXA 3P8NA 4DIIH 1ELEE 2OQUA 1D6WA 2FTMA 4FUBA 3FP8E 1ZMNA 2PTCE 5BRRE 3QZRA 1ACBE 2F9NA 3GOVB 2Z94A 3QGNB 2BY6X 3G01A 4ZXYH 1O3JA 2XC4A 5HMAA 3RDZA 2VWNA 1VITG 3F6UH 2SGFE 3QTVH 1O2KA 1GBBA 1T8OA 2A4GA 2ZC9H 5TJXA 3TPIZ 2TGDA 3QGJA 1C1UH 1AZZA 2R3UA 3OU0A 4TWWA 1GG6C 2ZHEH 3LGWA 3HGPA 4YT6H 5E2OA 2Z3EA 1K2I1 3RXMA 1H4WA 5E0GA 3U98H 1YPJH 3Q76A 1SPJA 2SNWA 4OS6A 2NU0E 1DY9A 1K9OE 2LNCA 3MU4A 1O3GA 1BT7A 2VIVA 3KNXA 2P3TB 2VU8E 3VXEH 1CGJE 3VB3A 1O2OA 4RN6A 3PV4A 1RFNA 2HVXA 1ELGA 1HJ8A 1XKBC 1IHSH 1MZAA 2WPLS 2FS9A 1P3EA 2OC0A 1O0DH 2A7CA 2A1DB 4ABGA 4Y71A 1D3TB 4LOYH 1GJCB 2UUKB 1YPGH 1YBWA 3A7ZA 3SNAA 3A84A 3SUGA 4DVAU 2BVXH 4AORA 2ZGXH 4CH2B 4TY6A 1HNEE 1W13U 3UOUA 3F9HA 1B0FA 2C8XB 9ESTA 4IW4E 4NWKA 5JPMH 2JETC 4X1NU 5FCRA 4ZHMU 4DG4A 1ZSKA 1GBFA 1AGJA 1ZLRA 2P93A 2B0FA 5FPSA 3MWIU 3L3TA 1K1IA 1LTOA 3PTNA 2H9TH 3BF6H 5FPTA 3GISB 3SN8A 4B76A 3GYMA 3RXDA 1GMCG 3UPEA 1SLXB 3RP2A 4NFFA 4DURA 1FAXA 1E0FD 3PLKA 4CRBA 1DPOA 1GI1A 5JYIA 1V2UT 1HDTH 4MDSA 1GMDF 1EOJA 1XUFA 3MO3A 1LVYA 1YP9A 3C27B 4K8YA 5C20A 1O2QA 3SOSA 1SSXA 4ABEA 1DFPA 3ZYDA 3P17H 1CA0B 2A5IA 2BLOA 1C9TA 1PQ8A 1CA8B 1YGCH 4XDEA 1OKXA 2I6QA 1M9UA 1K28D 2CV3A 1P12E 1FPCH 1FQ3A 1HGTH 1PYTD 3GCTF 1E37B 4E05H 1HRTH 1DWBH 2GDEH 2NWNA 2VGCC 3TGIE 5DK1A 1G36A 1LHDH 1QRZA 1KSNA 1C1WH 1AVWA 3BTDE 1T8MA 1BOQA 4DCDA 1BTHH 5EQSA 1BIOA 1TGNA 3SJIA 3PM3A 2PSXA 3QX5H 4U32A 5GDSH 1QJ1B 1DUEA 2SFAA 2J38A 1MKWH 2THFB 3F9EA 1BMAA 1V2PT 3A82A 4DT7B 1W8BH 1LHEH 1IQNA 4CRCA 5F6MA 1HAVA 3DD2H 1PFXC 3RU4E 3SNBA 3LT3A 2F9BH 3GY8A 1YCPK 1BTWA 2FLBH 3KIDU 3ZZ5A 2G81E 1HPGA 1A5GH 1C2EA 1GBCA 3AAUA 1V2OT 1A46H 4CRDA 1G3BA 3TJOA 1QNJA 1QTFA 1MCVA 3QK1A 4AFSA 3MI4A 4D7GA 5GIBA 3DFJA 5ESBA 2VJ1A 4JZFH 3MYWA 1YLCA 2ZGHA 2YNAA 3SNDA 1G3EA 3RMOH 3T29A 5L2ZH 3AAVA 1TOCB 1NRPH 4FUDA 4GPGA 2C3SA 2PSYA 5GWZA 1GBJA 1PPHE 2ODPA 3DFLA 3FZDA 4WMFA 1WU1A 1L1GA 3RXGA 2BDCA 1C1SA 3LGIA 4F4OC 1OYQA 1CT4E 2PGQB 1XXFA 1AE8H 1DWEH 2I6SA 1Y5AT 4YO9A 3NK8A 1KDQB 2FODA 3ODDA 4Y79A 2ZDVH 2ZU1A 4YZUA 3ENSB 3UQVA 1GL1A 4TPYA 2FESH 3GY3A 3RXJA 1GDNA 4J2YB 2G8TA 1C5LH 1GDQA 2F83A 1UTQA 2G51A 5EXNA 1TRNA 3D49H 2IPHA 1BQYA 1TPOA 3GDSA 4GCHG 4FUJA 1MTWA 5EXLA 1O37A 2ZGBH 2ZFPH 4U2WA 2FTLE 5ETXA 4ABFA 2GMTB 1GHVH 3SUFA 2QIQA 1GI2A 1VJAU 4CREA 4TWYA 4AFZA 1TGCA 1GBHA 1NO9H 5EPNA 1ESBA 1O5EH 1DICA 4ABBA 1O38A 3IWMA 1Y3VA 4FU7A 2BHGA 4MVNA 1QA0A 1P01A 6GCHG 1TNKA 2EI7A 3ZZAA 1O36A 1QBOA 2AGIX 1EKBB 5C2ZA 1DM4B 1Y5UT 2UWPA 1GBKA 3PO1B 1MKXH 2CMYA 4ISLA 1QB1A 2EEKA 3M5LA 4BTIB 1LQDB 1KYNA 3SU5A 5ABWA 1EZSC 3S69A 3SV9A 4B1TA 1C5VA 1LPGB 4AN7A 1TBQH 5EOKA 1TOMH 4ZXXH 1B7XB 2BY8X 2PUQH 3EE0B 2GP9B 1AZ8A 2TGAA 1E35B 1P9SA 1ETSH 1XUJA 8LPRA 5T6FA 1ANEA 3GCHC 2A31A 2C93B 1C1MA 3TIUA 2ZDMA 1O2HA 3ZV8A 2BOKA 2D1JA 2BDIA 1EASA 1AKSA 2FX4A 4GUXA 4GSOA 3O8BA 4R8TB 5A8ZA 1BHXB 2BD5A 1D6RA 1FIZA 5GJ4B 1PPZA 1SG8B 1S0QA 2W7UA 1C5RA 4A6LA 8GCHF 1MQ6A 3NZIA 1GJBB 5FX6A 2C8YB 1VCPA 1O2SA 1QRXA 1RS0A 3LJJA 4MNXA 2IN2A 1A7SA 1PPEE 3GDVA 3MMGA 3U8OH 4JZEH 1GCTB 2J94A 1KXAA 1ARCA 1DANH 4X8SH 4JYTA 2ZNKH 1ESAA 2Z9JA 3S9CA 1YKTA 3R3GB 2ZHQH 1INCA 1DX5M 1JRSA 3DA9B 4OS4A 3K65B 5E2PA 1G3DA 2BX3A 1GHAF 2OXSA 3ZZ8A 1K1LA 3QZQA 1SQTA 2XCFA 1MTNB 4TY7A 2Z9IA 1HFDA 3TH4H 1Q3XA 5DP9A 1RTKA 2FMJA 4AX9H