1SQOA

Substituted 2-naphthamidine inhibitors of urokinase
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
245
structure length
245
Chain Sequence
b'IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
molecule tags Hydrolase
source organism Homo sapiens
publication title Interaction with the S1beta-pocket of urokinase: 8-heterocycle substituted and 6,8-disubstituted 2-naphthamidine urokinase inhibitors.
pubmed rcsb
total genus 57
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sqoA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sqoA01
5C20A 1ESBA 3MU5A 3Q76A 2NU2E 1LMWB 3QGNB 1VITG 1W10U 2G5VA 4I31A 1J17T 4FUBA 2FOFA 2R2WU 3GDUA 4IGDA 5JDUB 1YPHE 3NWUA 1RD3B 2ZCHP 1UVOA 1KLTA 3PMAB 1FDPA 4KELA 2OUAA 1W7XH 4UDWH 1IQNA 3ATKA 1EPTC 4Q7YA 1SGYE 1KLIH 3N7OA 1UTJA 5LPEA 1QA0A 3A8AA 4RKOB 1HXEH 2GZ7A 3NZIA 4WVPE 1P12E 1SGNE 1KDQB 1CGIE 1HJAC 1RRKA 1LHDH 1ORFA 1QB9A 1CA0C 4E7RG 8LPRA 1EPTB 5JB9S 2XNIA 3F9HA 4LOYH 4TWWA 1ZHRA 1G3DA 3KHVA 3GYLB 3GYMA 1SGFG 4CREA 3SU0A 2W7SA 1GMHG 3VXEH 1FIWA 3ZZ8A 1TOMH 1O2RA 4R8TB 3BTKE 4DG4A 1GI3A 4Q7ZA 4Y7BA 1ANCA 2Y7ZA 3GY5A 2BZ6H 5DG6A 5GDSH 4BAHB 1UVUH 4UFGH 1AHTH 1W3CA 3M5LA 2OCVB 5K0HA 2CGAA 3ZZDA 2G51A 1HAXB 1VGCC 1QNJA 1GHAG 1HYLA 1Y3YA 2QAAA 3KEEA 4BAMB 4YT7H 3ZZBA 2FS9A 2GD4B 4YTAA 3SJKA 1VCPA 1A0HB 2ZP0H 1CHOF 1ELVA 1XUJA 4THNH 4PROA 2BXUH 2A5AA 2SGPE 2F9BH 5A09A 3IG6B 3MO3A 1SHYA 5HMAA 3P70B 4GSOA 1B5GH 1GI5A 3MU8A 2FODA 1TNGA 1BQYA 1H8DH 1AMHA 1FONA 1FN6A 4X2XA 2O8MA 3KQBA 1GL1A 4NFEA 4QT8C 4I8GA 4XSKU 4X6OA 1K1OA 1C5QA 1D3QB 2THFB 4IN2A 3KIDU 5JBCS 2FWWA 1EX3A 4YM9A 5FHTA 1ZHPA 1HIAB 1LO6A 1C2GA 1GBEA 2GTBA 1TAWA 3P8OA 4D8NA 3BTDE 4CH2B 1GBBA 1V2LT 1D9IA 1C9PA 3M36A 4H42U 1ARBA 4YOIA 1GMCG 1CU1A 1QBOA 1W0YH 4B74A 1H4WA 2F3CE 1GHBF 3ZVGA 1GBDA 1K2I1 1LVBA 2H5CA 2VIWA 3SV6A 2STAE 4ZAEA 4B75A 5JYIA 1C1RA 2F91A 2WPLS 2P8OC 1BZXE 3SGQE 1CGHA 1EOJA 3GY4A 3SU5A 1DY9A 1C9TA 1ZSKA 1E37B 2GT8A 1P06A 2ZFSA 4YT6H 2SNWA 1F5KU 2QXJA 2WV5A 5TJXA 2QF0A 1O2OA 1SGIB 1GDUA 1P04A 4OS7A 2BD5A 1P57B 2P8OB 3SU2A 2BDBA 1DXWA 4XDEA 1O3JA 3QWCH 1J16A 3GDVA 3GY6A 2M5TA 3RXHA 3A88A 1P9UA 1GHXH 4NA8A 1TBQH 3M7QA 2A31A 1O2GH 3BSQA 2G55A 1OP2A 3TJNA 4YLUA 1GVKB 1Y5UT 1QB6A 2YNBA 1YBWA 2JKHA 1YYY1 2DE8A 5ABWA 1O2JA 3RXGA 2OD3B 4FU9A 4IBLH 1D3DB 1EAXA 1TPOA 3TK9A 1ZPCA 4VGCB 1V2KT 1O3IA 2H2ZA 3Q3YA 3TH3H 3BEFB 3U1IB 4GHQA 2UUKB 2CMYA 4MTBA 3SNDA 1F92A 2XC5A 1K9OE 1PPHE 1UTPA 1HAPH 2JH5D 2VVVA 4Z0KA 3ZZ6A 1BHXF 3IITA 1ZOMA 3NK8A 4I33A 1A0LA 2XCFA 1IQHA 1GJ5H 1LPGB 1C2FA 1OX1A 5ESTE 1EB2A 2PGQB 3RP2A 1J14A 1KXAA 4CRFA 3TGKE 1TNKA 1VGCB 2GVFA 4I8HA 5LH8A 2EI7A 2G5NA 3A86A 4ABBA 1C5XB 1QJ6B 1ZTJA 1ZSJA 2TPIZ 1JOUB 5AFZH 5C67A 1E34B 4X6MA 3QGJA 3DD2H 1S6FA 3RXPA 3SJ8A 1XKAC 2Z9KA 3SOSA 1GJDB 1VCWA 2FXRA 1GI6A 1QBVH 4MQAA 2ESTE 1TGTA 2ZU2A 4CR9A 2R3YA 1PPEE 2BDAA 1W13U 3MU4A 5C1UA 2QA9E 2KAIA 2WUBA 1AO5A 3MWIU 3NPSA 4NIWA 3F1SB 2AFQB 1FLEE 2H6MA 3OY5U 1EZQA 1SI5H 1GBJA 3S9BA 1LVMA 5EG4A 5C5OA 4ABGA 3LGYA 4NGAH 2BDCA 5FX6A 3TH2H 5FXLA 1RGQA 1UHBA 4WXIA 4YLQH 1C5RA 1EZUC 1PQAA 3MNSA 1WTHD 3A7YA 1P2IA 4JZDH 2O8TA 1BRCE 1BTYA 1A1RA 4Y8ZA 2BD7A 1K28D 5FCKA 1GHAF 4KTUA 1HGTH 2Z7FE 1ARCA 3K6ZA 1XXDA 2ZQ2A 1SGTA 1OSSA 1YLCA 3VB3A 1NESE 1ETTH 2GKVE 3TITA 4CBOA 5T6DA 4MPUA 1T4VH 4R0IA 4B2BA 3PO1B 4OGYA 1IHSH 3RXRA 1DITH 4MLFB 4TYDA 2CN0H 3O8BA 1B0EA 3RXUA 1MKWK 5JBTA 1VJ9U 2K1QA 2ZU4A 5EU8A 3RUOA 2A4QA 3KNXA 3BG4C 3E90B 3ZZ9A 3RM2H 3TIUA 3A8BA 3PO1C 2Q6GA 1GPZA 4FUEA 1NT1A 1RJXB 1GI1A 1FV9A 1HNEE 2QV1A 2FYQA 2ZFPH 3BTFE 2ANYA 3A7XA 4XBCA 3O8DA 4RN6A 3GOVB 3RXKA 3DA9B 1Z8RA 3F6UH 1ELFA 2GCHF 5FAHA 1YCPK 1HCGA 2F9UA 1IQGA 4DIIH 2QC2A 1P2QA 1NRPH 5I25A 2ZECA 3PWCA 5E0GA 3U98H 1RTKA 1RS0A 3T29A 1UTQA 2GMTB 3K2UA 1EB1H 4SGAE 2BM2A 1TPSA 3LC5A 1LHFH 2ZFFH 4O9VA 3ZVDA 2XYAA 4OS6A 2EEKA 4H6TA 4O3TA 1GHVH 3U69H 3ODDA 1UK4A 3ZZ5A 1T7CA 4U32A 1S82A 1C2LA 1P10A 2GMTC 4Y7AA 4FVDA 2C8WB 2RG3A 1JRSA 1O2HA 1O3MA 3SHAH 3O8CA 1H9IE 2ZFQH 3KCGH 1BRUP 4I32A 1XUIA 8ESTE 1M9UA 2FMJA 1HDTH 1PQ5A 1G2MA 4FVBA 2PV9B 4ABJA 4HZHA 1GHYH 2XRCA 2V35A 5J4SA 5GCHG 1BUIA 1DUAA 1BBRE 2ALPA 1P05A 3H7OA 2J95A 4CRBA 1EQ9A 1BOQA 1F0SA 1SQAA 1DLEA 1W7GH 1QRWA 1C5UA 2WPKS 3GISB 3P8GA 1ID5H 1X7AC 2ZGBH 1GHWH 1MTVA 3RU4T 2FOCA 4NZQA 2ODPA 3I29A 1UHBB 1YCPH 4FUHA 5AHGH 4BNRA 1Y3UA 4MNVA 5EPYA 3R0FA 1FY3A 2Z9IA 4TWYA 2BD2A 4FUCA 2QN5T 1HLTH 2ZGJA 3SU1A 1GI8B 1FXYA 1T8OA 1XUGA 2AMPA 4MNWA 4KP0A 1PJPA 3A89A 4X2YA 2WINI 1EJNA 1ABJH 2ZWLH 1C1SA 3BTEE 1BA8B 3T62A 1JMOH 1O2LA 1SL3A 3BN9A 2WPMS 5DPAA 3ZYDA 1P2OA 5HM2A 1SLVB 2A2QH 3A8DA 2YOLA 1VZQH 1HAZB 3M5NA 1UJ1A 1QHRB 5J4QA 2ULLA 5EODA 1YKTA 2B5TB 1N6XA 1GBFA 3RXIA 4K2YA 3SHCH 2Y7XA 1UVTH 3UWJH 1NN6A 3QDZB 3UPEA 3T26A 1LHGH 1EATA 3T25A 2Z3CA 3I78A 1GJ9B 2Q1JA 2GV7A 3AAUA 2QF3A 3NCLA 4H6SB 1C2KA 2VVCA 2LPRA 1O3CA 3TNSA 4M7GA 2PTCE 3HATH 1O2ZA 2ZPSA 3P92A 4HFPB 4GHTA 3W95A 4UONA 1Y3WA 3ZYEA 3OYPA 1O2MA 1UO6A 3QLPH 1VCQA 1K1LA 4FUFA 1D3PB 5GJ4B 3PMBB 2XBXA 2ZU3A 1SGQE 5HXFA 3FP7E 2QXGA 3ZVAA 4TY7A 3BTGE 2NU0E 1QJ1B 3D23A 4JK6A 1OP0A 1MUEB 1XUKA 1EAWA 1Y59T 4F49A 3RC6A 1IQEA 1K1NA 1CQQA 2QGRA 1G32B 1C2HA 3A7WA 1RTFB 3ITIA 1TGCA 4B76A 4ZROA 1AD8H 1KIGH 1TQ0B 3D62A 1C1PA 4X1QU 5DP3A 4B71A 1C1NA 2VIPA 1KDQA 1BJUA 5DKMA 1OP8A 3QX5H 1F5LA 3KQDA 2HGTH 2V3HH 3UNSA 2CV3A 2OC8A 1ZRBA 3GDSA 3SUDA 1NPMA 3RM0H 2BB4A 3UWIA 4XBDA 4BANB 1DWCH 3ZZCA 5A8ZA 5E0JA 3KGPA 1P0SH 3CS7A 4U2WA 1V3XA 1NROH 2FZZA 3V0XA 1HB0B 3GCHC 1TNHA 2WPJS 2BD4A 2QCYA 2TGAA 3BEIB 4WXVA 4ESTE 3MNCA 1ESAA 1IQIA 3F68H 5EXLA 1G36A 2XCNA 2HNTF 3ESTA 1P2NA 1HAVA 1XUFA 4JCNA 2UUJB 1ETSH 1CE5A 2CHAB 4O03A 5LPFA 3A87A 3RXMA 4X8SH 1FZZA 1T8NA 3EGKH 3GY8A 1TNIA 4WMEA 3NKKA 3ZVFA 4FXGH 2PR3A 2A4OA 2W7UA 5F8XA 1ELGA 2IJOB 3BTWE 4DIHH 2PKSC 3B8JA 4ISHH 1QRZA 1ZJDA 4X1PU 1BJVA 2I6SA 4NA7A 1O3AA 2FOGA 1V2MT 1EPTA 1ACBE 5CHAB 3CP7A 2AEIH 2ODYB 1ESTA 1LHCH 1AVGH 2BQ6B 3BTTE 3HK3B 1HRTH 1AI8H 4JYUH 2GT7A 1ELDE 3SV7A 1RIWC 3A80A 1S83A 4ZXXH 1TABE 4MNXA 1TBZH 1J15A 2P95A 2BLVA 5FCRA 1UTMA 1GG6B 1BRBE 3I77A 2Z3DA 2D2DA 2FIRH 2BVRH 4LK4A 2G4UA 1K1PA 1PYTC 2SGQE 4NSVA 3K9XB 1SQTA 4D9RA 2GCTC 2G52A 3U8RH 1AVXA 2Y82A 1MAXA 2B0FA 3LGVA 4LZ4B 1T32A 2ZTXA 4K69A 4A7IB 2ZTYA 2O8UA 1NRSH 1BTUA 1GCTC 1UTOA 1KXDA 3HGNA 4IMQA 2A2XH 1S0QA 3M3TA 1P3EA 1FY1A 1SMFE 1XUHA 1O5DH 2FLRH 3A82A 1SBWA 1A4WH 4NWLA 1C5TA 2AH4X 4MG3A 1THSH 1GBHA 1GCTB 1O2YA 4A1XA 1A61H 2BDGA 2VWLA 2Z6BD 1C5MD 1SGPE 5F8TA 1HAYB 2A7CA 2H9TH 1RFNA 1DM4B 1MZDA 5F8ZA 4AORA 4DCDA 4K3JA 1TGNA 1Z8GA 1OWHA 1GJ6A 5FPYA 3UQOA 2ZDKA 1ZRKA 3V12A 3SV8A 5T3HA 2PW8H 5LGOA 1G3BA 1EAUA 3UTUH 1AE8H 3TPIZ 7LPRA 1C1UH 3E8LA 1JIMA 1CA8B 1GMHF 1LVOA 1WOFA 3EA7A 5EQRA 2W26A 1Y8TA 3NXPA 5A0CA 1QTFA 1PPCE 1DWBH 1TRNA 5DO4H 2BHGA 4U30A 2OQ5A 1MMJN 1THRH 3UFAA 1C4V2 3T2NA 2F9PA 2ZGXH 1EJAA 4AZ2B 3MNXA 4GAWA 4J1YA 2RCEA 1DPOA 2HNTE 2WUCA 1O3PB 3K65B 4WF8A 1O31A 3SJ9A 4D76A 1YPJH 4XOJA 1L1NA 1G37A 1TNLA 2WYJA 1U6QA 5F03A 4RSPA 4B2CA 1OWEA 2OBQA 1ANBA 1ZGVA 1V2TT 5BRRE 3MTYA 1Y3XA 2OC0A 3P8FA 1GI4A 3S0NA 3FFGA 1JBUH 1AQ7A 1BRAA 2O8WA 2ZHQH 4DGJA 4FUIA 3MU1A 2CXVA 1O35A 1P2MA 2IOTA 1BTXA 2KAIB 3GCTG 4AN7A 3LGIA 1GCDA 4E06H 4Y79A 2ALVA 3MH5A 1QB1A 1BMNH 3Q00A 2GZ9A 1XM1A 2C8ZB 1YC0A 1KTTB 1BTZA 1P01A 4BAKB 3T5FH 1CBWB 2ODQA 1Z6EA 2QYIA 1Z71A 3M7UA 3MMGA 3A7TA 1GBKA 1W0ZU 3ATWA 1NY22 3EQ0H 1TMTH 5PTPA 3VFEA 1TWXB 2VB0A 1WU1A 1WAYB 3FVFB 1KYNA 1GBIA 3NUMA 5BPEA 3HPTB 3FP8E 1K22H 4ZKRU 2GCTB 1GJCB 2PGBB 1HPGA 2HPPH 1NFYA 1AUJA 1B0FA 5JPMH 5CE1A 1VITF 1YM0A 3GY2A 1MAYA 2VGCC 2AYWA 1O2PA 4UEHH 2WPIS 5C3NA 1D3TB 1XVMA 5I46H 3FAOA 4ISNA 3M35A 3VGCB 2BZAA 1NRQH 3RC4A 1P02A 2XTTB 4ZMAH 3PLPA 1IQKA 3TU7H 1GBAA 4ZHMU 1TONA 1LPZB 1Z1IA 1K1JA 1Z6JH 1O5AB 1O0DH 2F9VA 1NU7B 3RXCA 2Q6FA 3U1JB 3A85A 1H8IH 3E1XB 1K21H 1DY8A 1GDQA 2SFAA 2Y80A 4AB8A 4GCHG 2OBOA 4ASHA 2PHBA 1QIXB 2BY9X 3P8NA 2PKAA 2VH0A 4MVNA 1HV7A 1IOEA 1C1QA 2G4TA 2ZDVH 4I8KA 5FX5A 2FOMB 2P94A 5DP9A 5L30H 4AOQA 4INKA 2QXHA 2BX3A 3AVZA 1AB9B 1O2VA 1DANH 3F9GA 3SU6A 1HFDA 6GCHF 1FY8E 2BVSH 4OS4A 5A2MH 1HJ8A 1BTWA 2XW9A 3F9FA 2ZU5A 3BIUH 4JYTA 1L1JA 3AAVA 5GCHF 4D9QA 1HIAA 1LDTT 1OXGA 2XBWA 5L2ZH 4AG2A 3RXJA 1ZLRA 4X0WU 3TNTA 2PTNA 4HTCH 3P95A 4B73A 1ETRH 1GBMA 1O3KA 2JETC 3LOXA 5EGMA 3SW2B 3TK6A 2ILNA 2ZPRA 1ELTA 2XBVA 1CHGA 1AUTC 5TCCA 3LKWA 1OPHB 2CF8H 2ZTZA 1SQOA 1MCVA 1LCYA 1OWJA 2ZDLA 2ZDNA 1V2JT 1H9LB 4ABDA 3DUXH 4I8LA 2FI4E 2EI6A 3PM3A 1C1OA 1GBCA 4GPGA 4AB9A 4YO9A 2PKAB 3W94A 2FTMA 1DSUA 1RTLA 1UTLM 1O2QA 1QJ7B 1HJAB 1C5NH 3UOPA 2Y5HA 3SV2H 2BD8A 1ZZZA 3LT3A 2O8LA 1UTNA 3L33A 1SOZA 3E0PB 2ZEBA 3FANA 3QUMP 2ZHEH 1GMCF 4NCYA 1UCYE 4OS1A 3ENSB 1SOTA 2OQUA 1SR5C 3C27B 1V2ST 1O3EA 1WBGB 4FUJA 3ATIA 5AF9H 2R0KA 4ZUHA 1W12U 4O97A 1SHHB 1C2MA 1T31A 1ZYOA 1WV7H 3AW0A 3RXQA 1DFPA 1IQLA 5K7RA 1IHTH 1O5CB 4FU8A 4ABIA 1ABIH 3MO6A 4O3UA 1LHEH 1HXFH 1A5IA 1FY5A 2LNCA 2ZO3H 1A3EH 3UR6A 2GCHG 2AMDA 1BB0B 2F83A 1O3HA 2J94A 9LPRA 1AFEH 1O37A 3RC5A 1EP6A 1GBLA 4WH6A 5JB8S 1TMBH 2GX4A 2H9HA 3SNEA 3S9AA 2UWPA 2ZCKP 4X6PA 5B6OA 2BOHB 3RU4E 3JZ2B 1OWIA 3SZNA 1O2UA 1YPKH 3OX7U 1A3BH 1CO7E 1GVLA 4BAOB 1G2LA 1W8BH 1SGDE 1P11E 2GDDA 3ZVBA 1HAIH 4ZKNU 2ZG0H 1ZPZA 4IMZA 3M5MA 1C5YB 4NSYA 4AYVB 7KMEH 2FDAA 1CSOE 4JYVH 1NFWA 4AGKA 1ZMNA 4LZ1H 6ESTA 4AFUA 1CT4E 1ZHMA 3BF6H 3SJOA 2AGGX 4WH8A 1TGSZ 4X8VH 1PQ8A 2Z94A 4OS5A 1XVOA 2FOHA 3BTQE 4BOHA 5C5NA 5FPTA 1MQ5A 1EUFA 1AB9C 1QRXA 2SGFE 3O8RA 5C1YA 8GCHF 1TA6A 5ETXA 2R3UA 1F7ZA 1P09A 3TJVA 3UNQA 1C1WH 1DS2E 2EC9H 1O3GA 1O2TA 1LVYA 1UVSH 2BMGB 3RMMH 1AZ8A 1C5ZB 4CH8B 1O3LA 1ZJKA 1ANEA 2BY6X 2VU8E 2ZIQH 1P2KA 3EA8A 4NIVA 1TLDA 2FX4A 4A1TA 1TPPA 1LKBA 1V2PT 1DWEH 4ISLA 3E91A 1XMNB 1J8AA 1C4U2 1GL0E 1C5WB 1YPHC 1O2IA 2R9PA 1MU6B 3SJIA 5E8EH 1H9HE 3AW1A 1S6HA 1TRYA 4ABFA 1GJBB 2DE9A 5LPRA 5T6GA 1O3NA 1O30A 1CA0B 1NZQH 4Q2KA 1SSXA 3MH7A 3PTNA 3ZV8A 3EYDA 1L1GA 3BTME 2C8YB 8KME2 3LJJA 3TK5A 3BIVH 4FUGA 1EKBB 1TFXA 3S7HB 2J92A 4ZKSU 4A1VA 2B7DH 4CHAC 1MD8A 4AFSA 1F0RA 3VB7A 3RLWH 2PWXA 1NFXA 3BTHE 4FU7A 2PFEA 7GCHG 1D4PB 3GY7A 1AN1E 1IAUA 1L4DA 1ZMJA 4VGCC 1T4UH 3RXTA 3OY6U 2ZGCA 4CHAB 5FBEA 3A81A 3QO6A 3OSYA 1DOJA 2FI5E 5A0BA 1TE0A 3BEUA 2A5IA 2VH6A 2QIQA 2W3IA 4YZUA 3RXFA 4TPIZ 1XXFA 2BX4A 4AGJA 1FUJA 4D7FA 2FYRA 4Y10E 3M3VA 5C1XA 3KQCA 1YPEH 1SGRE 1SGEE 2XBYA 5EOKA 2BQ7B 9ESTA 4WWYA 2FS8A 1KXFA 1Z8JB 4UE7H 2Q6DA 1O3FA 4BTTB 2W3KA 4ZKOU 1DT2A 3LH3A 1QA7A 4U01A 2ANMH 4IW4E 4ABHA 2HOBA 2ZCLP 1B7XB 5DP4A 4Y6DA 4WY3A 3SN8A 3F9EA 1GJ4H 1A2CH 3LDXH 2BY8X 3VXFH 3QK1A 2FP7B 4AX9H 1FAXA 2HVXA 1DUEA 1YGCH 3GICB 5E2OA 1Z1JA 1S0RA 2ASUB 4XE4A 1TBRH 3V3MA 3A83A 1BMAA 1BTHH 1XKBC 2BLOA 1TQ7B 1MTWA 1O2XA 1P03A 4K1TA 1AKSA 3QTOH 7GCHF 3E0NB 2FESH 2AIPA 4DT7B 4X6NA 4X8UH 4KKDA 2ZHWH 3STIA 2FPZA 1GI7B 1AGJA 2NWNA 2Z9JA 5DGJA 3U8TH 1EASA 1UCYK 3ELAH 2A45B 3UR9A 4X1SU 2ZHDA 1HAVB 3BG4B 1TIOA 4KTCA 3RXOA 2FM2A 5DP8A 1GWAA 4AFQA 1YP9A 2A4RA 3C1KA 1TGBA 3PMHB 2VJ1A 1SGCA 1D6WA 2A4GA 4A6LA 4CBNA 2HWLB 1G30B 1O34A 3EDXB 1N8OB 2D8WA 3RMNH 1MQ6A 3SNBA 4LXBH 4A5TS 1MTUA 2ZU1A 1SGFA 1FNIA 3LH1A 1BHXB 1O3BA 1AY6H 1C5VA 2Y5GA 1N8OC 1Z8IB 3S9CA 1FN8A 2BLWA 3LIWA 2A5KA 1V2WT 2FEQH 2PSXA 1UCYH 2D26C 3DHKH 3PTBA 2GZ8A 3RXAA 2TBSA 1N1LA 4JK5A 1QL8A 5E0HA 2V6NA 5T6FA 2J38A 4JZ1A 2BLQA 1S81A 3SUGA 5ESBA 2WPHS 2TGTA 2VNTA 1FMGA 1WQVH 1Y3VA 1N6YA 6CHAC 1QL7A 2A32A 3RXSA 3E16B 1MKXH 3SUFA 5EW2H 1ELEE 2BD9A 1K1MA 3GCNA 3STJA 1D6RA 2RA0A 2Z9LA 1INCA 2C4FH 4IN1A 1P8VC 1T8MA 3DFJA 6CHAB 1QY6A 5EW1H 1ZMLA 5GIBA 4WMDA 3RXVA 3SUEA 2AMQA 3BV9B 3PYHA 5C2ZA 2ZDAH 2BDHA 2AIQA 4Y76A 1GBTA 2R2MB 4X1RU 1ELBA 6LPRA 3AASA 1VJAU 5AFYH 8GCHG 3URCA 3PROA 1PQ7A 1Y5AT 3RXDA 3V13A 1MKWH 3EE0B 1SLWB 1BITA 3M3SA 1MH0A 2B8OH 1MTNB 2ZGHA 3SBKA 1FAKH 4YESB 1AZZA 2J4IA 2J34A 1C1TA 3TLOA 1BBRK 1V2OT 1T8LA 2JH0D 3VB6A 2VIQA 1AE5A 4DY7B 5EQQA 1C5PA 3ZZ3A 4ABAA 1PPGE 3LU9B 4K8BA 4MPXA 1O33A 5EQSA 1MTNC 1O5FH 2OLGA 5DP6A 4NFFA 1OOKB 3LGTA 1SLUB 2C90B 3Q3XA 3ZVCA 1O2WA 3SU4A 4RKJB 1ZTKA 3T28A 1GJ7B 1O3DA 1O5GH 3P17H 2Z3EA 1KXCA 1O2SA 3FZZA 2IPHA 5FPSA 4ZH8A 1C1MA 2NU3E 4B2AA 2A1DB 4JZIA 1K1IA 1FIZA 4I8JA 1NRNH 1VR1H 4XFQA 2AERH 1NFUA 1ZPBA 1TB6H 2RDLA 4TPYA 4K5ZA 2QXIA 2HLCA 3QTVH 3HGPA 4Y71A 1A5HA 1PPFE 1S84A 3VEQB 1GJ8B 1MTSA 3TJOA 3BG8A 3LC3A 2SGAA 4A92A 1S5SA 5H4IB 1O2KA 5EXMA 3TJUA 3B9FH 1SB1H 2OTVA 4Y11E 4E7NA 3MOCA 5IYTA 2IN2A 4J2YB 4FUDA 2TGPZ 3V7TA 1G3EA 2F9OA 4CRGA 2VWOA 1Q3XA 1G9IE 2VVUA 1E35B 1C2EA 3SO3A 1C4Y2 1MU8B 1LPKB 2C93B 1C5LH 3S7KB 1V2QT 3RLYH 3MU0A 1QGFA 4AFZA 1IQJA 3QZQA 1TNJA 1A7SA 1DDJA 3R3GB 4IC5A 5A8YA 3Q3KA 4YOJA 3RXBA 1S85A 1RIWB 4BXWA 3HKJB 1SFQB 1F2SE 1V2VT 2OXSA 2QY0B 3ZV9A 1HAGE 4Q80A 1F0TA 4CRDA 4KTSA 2XXLA 2SNVA 3VB5A 1GG6C 5F6MA 1A0JA 4IC6A 4MDSA 3UY9A 4DVAU 2GV6A 2VWNA 1MBQA 4NA9H 4K1EA 4K60A 1QL9A 1V2RT 1TX7A 1NC6A 4YOGA 1BMLA 1MZAA 2P16A 3VPKA 3KQEA 1Q31A 4JZFH 1W14U 1QCPA 1OS8A 2BDYA 1MCTA 3SGAE 2A7HA 3OU0A 5DP7A 2P3UB 1EP5A 3GCTF 2VIOA 3MFJA 2XC0A 3M5OA 3MH4A 2AGEX 1MBMA 4DW2U 2HALA 1C2IA 3MYWA 4K8YA 1NS3A 1KLJH 2ZA5A 1JIRA 1LKAA 1FJSA 4X2WA 5GXPA 5JBAS 1THPB 3ATMA 2GDEH 1O2NA 1C2JA 2BTCE 2C3SA 2D1JA 1DSTA 1AVWA 1P3CA 1JXPA 2AGIX 3GCHB 4Q7XA 3URDA 1C5OH 1E38B 4XBBA 2PUXB 4CRCA 5DP5A 3GY3A 1CGJE 1NO9H 3G01A 3D49H 1AIXH 2FTLE 4BXSA 2EI8A 3OTJE 4AYYB 4X1NU 3U9AH 3PB1E 2CHAC 1GI0A 2BDIA 2FLBH 3K6YA 5GPIB 3ATLA 1O32A 3ZZAA 5AVDA 1O5EH 1LQEA 3RU4D 1KSNA 1OKXA 2H1UA 4X2VA 1SC8U 1TALA 3MO9A 4SGBE 1QFKH 1CT2E 3CS0A 3SORA 2P3TB 2PKSB 3SI4H 1E0FD 1HAOH 3IWMA 1SLXB 1WCZA 3MHWU 2ZZUH 4B1TA 1UMAH 1GMDF 1F5RA 1IQMA 3L3TA 2I6QA 1TPAE 3LGWA 4CRAA 1DLKB 4H4FA 4ZXYH 4GCHF 4JZEH 4JMYA 1EAIA 3M7TA 3PLBA 2UWLA 3UIRA 2ZNKH 4MNYA 1YPGH 2XWAA 1O39A 1C5SA 3GCOA 1KTSB 3RMOH 2XWBI 3B23B 4WJG2 1C2DA 1L2EA 2YNAA 2B9LA 3EA9A 2WV4A 1QURH 1UTKA 2JH6D 2G8TA 1TOCB 1CBWC 5CHAC 1FPHH 1OYTH 2ZFTA 4GLYA 2TIOA 5A0AE 3TH4H 1EJMA 1KXBA 1HUTH 4MPVA 2G00A 4INLA 3TGJE 2W5EA 1SFIA 3FZDA 1L4ZA 1OYQA 1GGDB 1WSSH 2VINA 5FBIA 4NIXA 3HK6B 3PMJA 1W2KH 3UNRA 1BT7A 1J9CH 3DFLA 1ZR0A 3M37A 1NTPA 1ZSLA 1P2JA 3E3TA 4GUXA 3PLKA 1HBTH 3S69A 3SU3A 4OS2A 2AS9A 1PYTD 2PUQH 1UK2A 3UREA 3LONA 1MD7A 3SV9A 3KF2A 5HYOA 3H7TA 2C8XB 3UQVA 2FOEA 2NU4E 1EXFA 1YLDA 2PLXA 1CT0E 2CF9H 1TYNA 1RXPA 2XC4A 1P9SA 2F9NA 2ZFRH 2P93A 4UD9H 1ANDA 2FOBA 2BXTH 2GP9B 2TGDA 1PPBH 2GGVB 3RXLA 1E36B 5L2YH 4DJZB 4BTUB 4AG1A 1EOLA 1UVPA 4ZHAA 2ZKSA 2SGDE 1XX9A 1TA2A 1FPCH 1HJ9A 2EA3A 5HGGA 1SVPA 2A0QB 1YF4A 2DUCA 7ESTE 4NWKA 3JZ1B 1AU8A 2Y5FA 3Q77A 2OINA 1BBRH 1F0UA 1GHZA 4UFDH 1ZTLA 2HRVA 2PSYA 3A8CA 1QR3E 4F4OC 1LQDB 2ZI2H 1O36A 3QZRA 1QQ4A 3VB4A 3U8OH 1A5GH 2OC7A 1QBNA 1TRMA 2ZC9H 3PWBA 1BCUH 2V3OH 4UFEH 4ISIH 5G4BA 5HM9A 3TGIE 2FO9A 3H5CB 1C1VH 1WUNH 4NG9H 4WMFA 4Y0YE 2G81E 4CR5A 3PV4A 2J2UA 3A7VA 1MKXK 1PPZA 1DE7H 5SGAE 3EAJA 4X8TH 1A46H 1DVAH 1KY9A 2JETB 4NZLA 1QQUA 3QN7A 4MPWA 1ELAA 2FX6A 1DX5M 1CHOG 3MI4A 4GVUA 3CENA 1DWDH 1GDNA 2J9NA 1O3OA 2OC1A 1CVWH 2BY5X 2H5DA 1EZSC 5JBBS 2OP9A 2UUYA 1GJAB 3SQEE 3ZZ4A 1WQSA 5CMXH 1GVZA 1JRTA 5E2PA 2ZDMA 3MNBA 3L6PA 1FI8A 2P59A 3SQHE 2FI3E 3LJOA 5EPNA 2ANWA 4K1SA 5DJ7A 1JWTA 3A84A 1EZXC 5L6NH 2ZPQA 3M61U 2H9EH 4ABEA 1SG8B 2Z9GA 3RDZA 1KXEA 2SGEE 3D65E 4Z6AH 4KGAA 3UOUA 1DICA 2WYGA 3LGUA 3KN2A 1O38A 2VGCB 4Y8XA 3SI3H 1GGDC 1YCPM 4TY6A 1GHBG 2CJIA 5GWZA 2HPQH 2VIVA 1Y5BT 2Y6TA 6GCHG 2R0LA 2Y81A 3VGCC 3MH6A 1BDAA 1BIOA 1H1BA 1OWKA 4HGCA 1V2NT 1TX8A 2UWOA 4IS5A 1YPLH 1ZGIA 3T27A 3SNAA 1AKSB 1BMMH 1NU9A 4BAQB 2RA3A 3KL6A 1V6DA 4NIYA 3TVJB 4BTIB 1DXPA 4E05H 4I7YH 2BYAX 1GI2A 3LPRA 4DOQA 2UUFB 2BVXH 3ZZ7A 4D7GA 4Y8YA 1W11U 3RXEA 3DT0H 3P6ZB 5TCAA 1LTOA 1AFQB 3E6PH 1ELCA 3WY8A 4INHA 2V0BA 1NM6A 1BTPA 1FQ3A 1SPJA 1TMUH 1AWHB 2HNTC 1PFXC 2VIDA 1WYKA 4HI3A 4ISOA 1L0ZA 1NRRH 1UK3A 2BD3A 3SGBE 1GMDG 1OWDA 2STBE 2P3FH 3HKIB 5DK1A 4Y0ZE 1Z7KA 1AFQC 3FP6E 5IDKA 1HAHH 2BQWB 2ZF0H 3ZVEA 1Q2WA 2FOAA 4UFFH 1VITH 1G3CA 5EXNA 1FY4A 2BOKA 2VWMA 1V2UT 1AWFH 3UUZA 2BY7X 2ANKH 4DURA 3RMLH 1O5BB 1IQFA 2ZHFH 1YPMH 4OGXA 5A8XA 2TRMA 1GI9B 1WTGH 4ZHLU 2O9QA 2ZQ1A 3SNCA 3A7ZA 1TX6A 3ODFA 2NU1E 2A7JA
chains in the Genus database with same CATH superfamily
5C20A 5DSFA 1ESBA 3MU5A 3Q76A 2NU2E 1LMWB 3QGNB 1VITG 1W10U 2AHME 2G5VA 4I31A 1J17T 4FUBA 2FOFA 2R2WU 3GDUA 4IGDA 5JDUB 4Q4LA 1YPHE 3NWUA 1RD3B 2ZCHP 3N99A 1UVOA 1KLTA 3PMAB 1FDPA 4KELA 2OUAA 1W7XH 4UDWH 1IQNA 3ATKA 1EPTC 4Q7YA 1SGYE 1KLIH 3N7OA 1UTJA 5LPEA 1QA0A 3A8AA 4RKOB 1HXEH 2GZ7A 3NZIA 4WVPE 1P12E 1SGNE 1KDQB 1CGIE 1HJAC 1RRKA 1LHDH 1ORFA 1QB9A 1CA0C 4E7RG 8LPRA 1EPTB 5JB9S 2XNIA 3F9HA 4LOYH 4TWWA 1ZHRA 1G3DA 3KHVA 3GYLB 3GYMA 1SGFG 4CREA 3SU0A 2W7SA 1GMHG 3VXEH 1FIWA 3ZZ8A 1TOMH 3AK5A 1O2RA 2KZ4A 4R8TB 3BTKE 4DG4A 1GI3A 4Q7ZA 4Y7BA 1ANCA 2Y7ZA 3GY5A 2BZ6H 5DG6A 5GDSH 4BAHB 1UVUH 4UFGH 1AHTH 1W3CA 4M9FA 3M5LA 2OCVB 5K0HA 2CGAA 3ZZDA 2G51A 1HAXB 1VGCC 1QNJA 1GHAG 1HYLA 1Y3YA 2QAAA 3KEEA 4BAMB 4YT7H 3ZZBA 2FS9A 2GD4B 4YTAA 3SJKA 1VCPA 2EQNA 1A0HB 2YMSB 2ZP0H 1CHOF 1ELVA 1XUJA 4THNH 4PROA 2BXUH 2A5AA 2SGPE 2F9BH 2JJ2D 3IG6B 3MO3A 5A09A 1SHYA 5HMAA 3P70B 4GSOA 1B5GH 3OE7D 1GI5A 3MU8A 2FODA 1TNGA 1BQYA 1H8DH 1AMHA 1FONA 1FN6A 4X2XA 2O8MA 3KQBA 1GL1A 4NFEA 4QT8C 4I8GA 1E1RD 4XSKU 4X6OA 1K1OA 1C5QA 1D3QB 2THFB 4IN2A 3KIDU 5JBCS 2FWWA 1EX3A 4YM9A 2K0QA 5FHTA 1ZHPA 1HIAB 1LO6A 1C2GA 1GBEA 2GTBA 1TAWA 3P8OA 4D8NA 3BTDE 4CH2B 1GBBA 1V2LT 1D9IA 1C9PA 3M36A 4H42U 1ARBA 4YOIA 1GMCG 1CU1A 1QBOA 1W0YH 4B74A 1H4WA 2F3CE 1GHBF 3ZVGA 1GBDA 1K2I1 1LVBA 2H5CA 2VIWA 3SV6A 2STAE 4ZAEA 4B75A 5JYIA 1C1RA 2F91A 2WPLS 2P8OC 1BZXE 3SGQE 1CGHA 1EOJA 3GY4A 3SU5A 1DY9A 1W0KD 1C9TA 1ZSKA 1E37B 2GT8A 1P06A 2ZFSA 4YT6H 2SNWA 1F5KU 2QXJA 2WV5A 3WWFA 5TJXA 2QF0A 1O2OA 1SGIB 1GDUA 1P04A 4OS7A 2BD5A 1P57B 2P8OB 3SU2A 2BDBA 1DXWA 4XDEA 1O3JA 3QWCH 1J16A 3GDVA 3GY6A 2M5TA 3RXHA 3A88A 1P9UA 1GHXH 4NA8A 1TBQH 3M7QA 2LELA 2A31A 1O2GH 3BSQA 3ZIAD 2KM0A 2G55A 1OP2A 3TJNA 4YLUA 1GVKB 1Y5UT 1QB6A 2YNBA 1YBWA 2KCOA 2JKHA 1YYY1 2DE8A 5ABWA 1O2JA 3RXGA 2OD3B 4FU9A 4IBLH 1D3DB 1EAXA 1TPOA 3TK9A 1ZPCA 4VGCB 1V2KT 1O3IA 2H2ZA 3Q3YA 3WW7A 3TH3H 3BEFB 3U1IB 4GHQA 2UUKB 2CMYA 4MTBA 3SNDA 1F92A 2XC5A 1K9OE 1PPHE 1UTPA 1HAPH 2JH5D 2VVVA 4Z0KA 3ZZ6A 1BHXF 3IITA 1ZOMA 3NK8A 4I33A 1A0LA 2XCFA 1IQHA 1GJ5H 1LPGB 1C2FA 1OX1A 5ESTE 1EB2A 2PGQB 3RP2A 1J14A 1KXAA 4CRFA 3TGKE 1TNKA 1VGCB 2GVFA 4I8HA 5LH8A 2EI7A 2G5NA 3A86A 4ABBA 1C5XB 1QJ6B 1ZTJA 1ZSJA 2TPIZ 1JOUB 5AFZH 5C67A 1E34B 4X6MA 3QGJA 3DD2H 1S6FA 3RXPA 3SJ8A 1XKAC 2Z9KA 3SOSA 1GJDB 1VCWA 2FXRA 1GI6A 1QBVH 4MQAA 2ESTE 1TGTA 2WPDD 2ZU2A 4CR9A 2R3YA 1PPEE 2BDAA 1W13U 3MU4A 5C1UA 2QA9E 2KAIA 2WUBA 1SQRA 1AO5A 3MWIU 3NPSA 4NIWA 3F1SB 2AFQB 1FLEE 2H6MA 3OY5U 1EZQA 1SI5H 1GBJA 3S9BA 1LVMA 5EG4A 5C5OA 4ABGA 3LGYA 2HLDD 4NGAH 2BDCA 5FX6A 3TH2H 5FXLA 1RGQA 1UHBA 4WXIA 4YLQH 1C5RA 1EZUC 1PQAA 3MNSA 1WTHD 3A7YA 1P2IA 4JZDH 2O8TA 1BRCE 1BTYA 4P00A 1A1RA 4B6FA 4Y8ZA 2BD7A 1K28D 5FCKA 1GHAF 3VG8A 4KTUA 1HGTH 2Z7FE 1ARCA 2F43B 3K6ZA 1XXDA 2ZQ2A 1SGTA 1OSSA 1YLCA 3VB3A 1NESE 1ETTH 2GKVE 3TITA 4CBOA 5T6DA 4MPUA 1T4VH 4R0IA 4B2BA 3F2GA 3PO1B 4OGYA 1IHSH 3RXRA 1DITH 4MLFB 4TYDA 2CN0H 3O8BA 1B0EA 3RXUA 1MKWK 5JBTA 1VJ9U 2K1QA 2ZU4A 5EU8A 3RUOA 2A4QA 3KNXA 3BG4C 3E90B 3ZZ9A 3RM2H 3TIUA 3A8BA 3PO1C 2Q6GA 1GPZA 1OHHD 4FUEA 1NT1A 1RJXB 1GI1A 1FV9A 1HNEE 2QV1A 2FYQA 2ZFPH 3BTFE 2ANYA 3A7XA 4XBCA 1YLNA 3O8DA 4RN6A 3GOVB 3RXKA 3DA9B 1Z8RA 3F6UH 1ELFA 5HIYA 2GCHF 5FAHA 1YCPK 4ZCNA 1HCGA 2F9UA 1IQGA 4DIIH 2QC2A 1P2QA 1NRPH 5I25A 2ZECA 3PWCA 5E0GA 3U98H 1RTKA 1RS0A 3T29A 1UTQA 2GMTB 3K2UA 1EB1H 4SGAE 2BM2A 1TPSA 3LC5A 1LHFH 2ZFFH 4O9VA 3ZVDA 2XYAA 4OS6A 2EEKA 4H6TA 4O3TA 4XRNA 1GHVH 1NBME 3U69H 3ODDA 1UK4A 3ZZ5A 1T7CA 4U32A 1S82A 5EJ1A 1C2LA 1P10A 2GMTC 4Y7AA 4FVDA 2C8WB 2RG3A 1JRSA 1O2HA 1O3MA 3SHAH 3O8CA 1H9IE 2ZFQH 1MABB 3KCGH 1BRUP 4I32A 1XUIA 8ESTE 1M9UA 2FMJA 1HDTH 1PQ5A 1G2MA 4FVBA 2PV9B 4ABJA 3F0OA 4HZHA 4RT0A 1GHYH 2XRCA 2V35A 5J4SA 5GCHG 1BUIA 4P02A 1DUAA 1BBRE 2ALPA 1P05A 3H7OA 2J95A 4CRBA 1EQ9A 1BOQA 1F0SA 1SQAA 1DLEA 1W7GH 1QRWA 1C5UA 2WPKS 3GISB 4TT3D 3P8GA 1ID5H 1X7AC 2ZGBH 1GHWH 1MTVA 3RU4T 2FOCA 4NZQA 2ODPA 3I29A 1UHBB 1YCPH 4FUHA 5AHGH 4BNRA 1Y3UA 4MNVA 5EPYA 3R0FA 1FY3A 2Z9IA 4TWYA 2BD2A 2KR7A 4FUCA 2QN5T 1HLTH 2ZGJA 3SU1A 1GI8B 1FXYA 1T8OA 1XUGA 2AMPA 4MNWA 4KP0A 1PJPA 2XNDD 3A89A 4X2YA 2WINI 1EJNA 1ABJH 2ZWLH 1C1SA 3BTEE 1BA8B 3T62A 1JMOH 1O2LA 1SL3A 3BN9A 2WPMS 5DPAA 3ZYDA 1P2OA 5HM2A 1SLVB 2A2QH 3A8DA 2YOLA 1VZQH 1HAZB 3M5NA 1UJ1A 1QHRB 5J4QA 2ULLA 5EODA 1YKTA 2GJGA 2KCAA 2B5TB 1N6XA 1GBFA 3RXIA 4K2YA 3SHCH 3F3BA 2Y7XA 1UVTH 3UWJH 1NN6A 3QDZB 3UPEA 3T26A 1LHGH 1EATA 3U28C 3T25A 2Z3CA 3I78A 1GJ9B 2Q1JA 2GV7A 3AAUA 2QF3A 3NCLA 4H6SB 1C2KA 2VVCA 2LPRA 1O3CA 3TNSA 4M7GA 2PTCE 4B6EA 3HATH 1O2ZA 2ZPSA 2J5UA 3P92A 4GHTA 3DSGA 4HFPB 1Y3WA 3W95A 4UONA 3ZYEA 3OYPA 1O2MA 1UO6A 3QLPH 1VCQA 1K1LA 4FUFA 1D3PB 5GJ4B 3PMBB 2XBXA 2ZU3A 1SGQE 2KCYA 5HXFA 2J98A 3FP7E 2QXGA 3ZVAA 4TY7A 3BTGE 2NU0E 1UW7A 1QJ1B 3D23A 4JK6A 1OP0A 1MUEB 2EY4C 1XUKA 1EAWA 1Y59T 4F49A 3RC6A 2F4LA 1IQEA 1K1NA 1CQQA 2V3MA 2QGRA 1G32B 1C2HA 3A7WA 1E1QD 1RTFB 3ITIA 1TGCA 4B76A 4ZROA 1AD8H 1KIGH 1TQ0B 1S6LA 3D62A 1C1PA 4X1QU 5DP3A 4B71A 1C1NA 2VIPA 1KDQA 2L74A 1BJUA 5DKMA 1OP8A 3QX5H 1F5LA 3KQDA 2HGTH 2V3HH 3UNSA 2CV3A 2OC8A 1ZRBA 3GDSA 3SUDA 1NPMA 3RM0H 2BB4A 3UWIA 4XBDA 4BANB 1DWCH 3ZZCA 5A8ZA 5FL7D 5E0JA 2W6JD 3KGPA 1P0SH 3CS7A 4U2WA 1V3XA 1NROH 2FZZA 3V0XA 1HB0B 2HVYB 3GCHC 1TNHA 2WPJS 2BD4A 2QCYA 2TGAA 3BEIB 4WXVA 4ESTE 3MNCA 1ESAA 1IQIA 3F68H 5EXLA 1G36A 2XCNA 1KMHB 2HNTF 3FOAA 3ESTA 1P2NA 1HAVA 1XUFA 4JCNA 2UUJB 1ETSH 1CE5A 2CHAB 4O03A 5LPFA 3A87A 3RXMA 3NRLA 4X8SH 1FZZA 1T8NA 3EGKH 3GY8A 1TNIA 4WMEA 3NKKA 3ZVFA 4FXGH 3PV2A 2PR3A 2A4OA 2W7UA 5F8XA 1ELGA 2IJOB 3BTWE 4DIHH 2PKSC 3B8JA 4ISHH 1QRZA 1ZJDA 4X1PU 1BJVA 2I6SA 3F0PA 4NA7A 1O3AA 2FOGA 1V2MT 1EPTA 1ACBE 5CHAB 3CP7A 2AEIH 2ODYB 1ESTA 1LHCH 1AVGH 2BQ6B 3BTTE 3HK3B 1HRTH 1AI8H 4JYUH 2GT7A 1ELDE 5EJLA 3SV7A 1RIWC 2JJ1D 3A80A 1S83A 4ZXXH 1TABE 2RDEA 4MNXA 1TBZH 1J15A 2P95A 2BLVA 5FCRA 1UTMA 1GG6B 1BRBE 3I77A 2Z3DA 2D2DA 2FIRH 2BVRH 4LK4A 2G4UA 1K1PA 1PYTC 2SGQE 4NSVA 3K9XB 1SQTA 4D9RA 2GCTC 4FETA 2G52A 3U8RH 1AVXA 3DCLA 2Y82A 1MAXA 2B0FA 3LGVA 4LZ4B 1T32A 2ZTXA 4K69A 4A7IB 2ZTYA 2O8UA 1NRSH 1BTUA 1GCTC 1UTOA 1KXDA 3HGNA 4IMQA 2A2XH 1S0QA 3M3TA 1P3EA 1FY1A 1SMFE 1XUHA 1O5DH 2FLRH 3A82A 1SBWA 1A4WH 4NWLA 1C5TA 2AH4X 4MG3A 1THSH 1GBHA 1GCTB 1O2YA 4A1XA 1A61H 2BDGA 2VWLA 2Z6BD 1C5MD 1SGPE 5F8TA 2V7QD 5CDFE 1HAYB 2A7CA 2H9TH 1RFNA 1DM4B 1MZDA 5F8ZA 4AORA 4DCDA 4K3JA 1TGNA 1Z8GA 1OWHA 1GJ6A 5FPYA 3UQOA 2ZDKA 1ZRKA 3V12A 3SV8A 5T3HA 4F55A 2PW8H 5LGOA 1G3BA 1EAUA 3UTUH 1AE8H 3TPIZ 7LPRA 1C1UH 3E8LA 1JIMA 1CA8B 1GMHF 1LVOA 1WOFA 1EFRD 3EA7A 3W1EA 5EQRA 2W26A 1Y8TA 3NXPA 5A0CA 1QTFA 1PPCE 1DWBH 1TRNA 5DO4H 2BHGA 4U30A 2OQ5A 1MMJN 1THRH 3UFAA 4Z1MD 1C4V2 3T2NA 1WXRA 2F9PA 2ZGXH 1EJAA 4AZ2B 3MNXA 4GAWA 4J1YA 2RCEA 1DPOA 2HNTE 2WUCA 1O3PB 3K65B 4WF8A 1O31A 3SJ9A 4D76A 1YPJH 4XOJA 1L1NA 1G37A 1TNLA 2WYJA 1U6QA 5F03A 4RSPA 4B2CA 1BMFD 1OWEA 2OBQA 1ANBA 1ZGVA 1V2TT 5BRRE 3MTYA 1Y3XA 2OC0A 3P8FA 1GI4A 3S0NA 3FFGA 1JBUH 1AQ7A 1BRAA 2O8WA 2ZHQH 4DGJA 4FUIA 3MU1A 2CXVA 1O35A 1P2MA 2IOTA 1BTXA 2KAIB 3GCTG 4ACBA 4AN7A 3LGIA 1GCDA 4E06H 4Y79A 2ALVA 3MH5A 1QB1A 1BMNH 3Q00A 1VKYA 2GZ9A 1XM1A 2C8ZB 1YC0A 1KTTB 1BTZA 1NBMD 1P01A 4BAKB 2WZQA 3T5FH 1CBWB 2ODQA 1Z6EA 2QYIA 1Z71A 3M7UA 3MMGA 3A7TA 1GBKA 1W0ZU 3ATWA 1NY22 3EQ0H 1TMTH 5PTPA 3VFEA 1TWXB 2VB0A 1WU1A 1WAYB 3FVFB 1KYNA 1GBIA 3NUMA 5BPEA 3HPTB 3FP8E 1K22H 4ZKRU 2GCTB 1GJCB 2PGBB 1HPGA 2HPPH 1NFYA 1AUJA 1B0FA 5C17A 5JPMH 5CE1A 1VITF 1YM0A 3GY2A 1MAYA 2VGCC 2AYWA 1O2PA 4UEHH 2WPIS 5C3NA 3KYFA 1D3TB 1XVMA 5I46H 3FAOA 4ISNA 3M35A 3VGCB 2BZAA 1NRQH 3RC4A 1P02A 2XTTB 4ZMAH 3PLPA 1IQKA 3TU7H 1GBAA 4ZHMU 1TONA 1LPZB 1Z1IA 1K1JA 1Z6JH 1O5AB 1O0DH 2F9VA 1NU7B 3RXCA 1H8ED 2Q6FA 3U1JB 3A85A 5KEDA 1H8IH 3E1XB 1K21H 1DY8A 1GDQA 2SFAA 2Y80A 4AB8A 3DSPA 4GCHG 2OBOA 4ASHA 2PHBA 1QIXB 2BY9X 3P8NA 2PKAA 2VH0A 4MVNA 1HV7A 1FX0B 1IOEA 1C1QA 2G4TA 2ZDVH 4I8KA 4AC9A 5FX5A 2FOMB 2P94A 5DP9A 2M2AA 5L30H 3OEHD 4AOQA 4INKA 2QXHA 2BX3A 3AVZA 2VBCA 1AB9B 1O2VA 1DANH 3F9GA 3SU6A 1HFDA 6GCHF 1FY8E 2BVSH 4OS4A 5A2MH 3F2HA 1HJ8A 1BTWA 2XW9A 3F9FA 2ZU5A 3BIUH 4JYTA 1L1JA 3F2FA 3AAVA 5GCHF 4D9QA 1HIAA 1LDTT 1OXGA 2XBWA 5L2ZH 4AG2A 3RXJA 1ZLRA 4X0WU 3TNTA 2PTNA 4HTCH 3P95A 4B73A 1ETRH 1GBMA 1O3KA 2JETC 3LOXA 5EGMA 3SW2B 3TK6A 2ILNA 2ZPRA 1ELTA 2XBVA 1CHGA 1AUTC 5TCCA 3LKWA 1OPHB 2CF8H 2ZTZA 1SQOA 1MCVA 1LCYA 1OWJA 2ZDLA 2ZDNA 1V2JT 1H9LB 4ABDA 3DUXH 4I8LA 2FI4E 2EI6A 3PM3A 1C1OA 1GBCA 3FKSD 4GPGA 4AB9A 4YO9A 2PKAB 3W94A 2FTMA 1DSUA 1RTLA 1UTLM 1O2QA 1QJ7B 1HJAB 1C5NH 3UOPA 2Y5HA 3SV2H 2BD8A 1ZZZA 3LT3A 2O8LA 1UTNA 3L33A 3PV5A 1SOZA 3E0PB 2ZEBA 3FANA 3QUMP 2ZHEH 1GMCF 4NCYA 1UCYE 4TSFD 4OS1A 3PRBA 3ENSB 1SOTA 2OQUA 1SR5C 3C27B 2YMSC 1V2ST 1O3EA 1WBGB 4FUJA 3ATIA 5AF9H 2R0KA 4ZUHA 1W12U 4O97A 1SHHB 1C2MA 1T31A 1ZYOA 4ACAA 1WV7H 3AW0A 3RXQA 1DFPA 3OFND 1IQLA 5K7RA 1IHTH 1O5CB 4FU8A 4ABIA 1ABIH 3MO6A 4O3UA 1LHEH 1HXFH 1FY5A 1A5IA 2LNCA 2ZO3H 1A3EH 3UR6A 2GCHG 2AMDA 1BB0B 2F83A 1O3HA 2J94A 9LPRA 1AFEH 1O37A 3RC5A 1EP6A 1GBLA 4WH6A 5JB8S 1TMBH 2GX4A 2H9HA 3SNEA 3S9AA 2UWPA 2L6OA 2ZCKP 4X6PA 5B6OA 2BOHB 3RU4E 3JZ2B 1OWIA 3SZNA 1O2UA 1YPKH 3OX7U 5DN6D 2JDID 1A3BH 1CO7E 1GVLA 4BAOB 1G2LA 1W8BH 1SGDE 1P11E 2GDDA 3ZVBA 1HAIH 4ZKNU 2ZG0H 1ZPZA 4IMZA 3M5MA 1C5YB 4NSYA 4AYVB 7KMEH 2IJD1 2FDAA 1CSOE 4JYVH 1NFWA 4AGKA 1ZMNA 4LZ1H 6ESTA 4AFUA 1CT4E 1ZHMA 3BF6H 3SJOA 2AGGX 4WH8A 3WWBA 1TGSZ 4X8VH 1PQ8A 2Z94A 4OS5A 1XVOA 2FOHA 3BTQE 4BOHA 5C5NA 5FPTA 1MQ5A 1EUFA 1AB9C 1QRXA 2SGFE 3O8RA 5C1YA 8GCHF 1TA6A 5ETXA 2R3UA 1F7ZA 1P09A 2YMSD 3TJVA 1C1WH 3UNQA 1DS2E 2EC9H 1O3GA 1O2TA 1LVYA 1UVSH 2BMGB 3RMMH 1AZ8A 1C5ZB 4CH8B 1O3LA 1ZJKA 1ANEA 2BY6X 2VU8E 2ZIQH 1P2KA 1SKYE 3EA8A 4NIVA 1TLDA 2FX4A 4ASUD 4A1TA 1TPPA 1LKBA 1V2PT 1DWEH 4ISLA 3E91A 1XMNB 1J8AA 1C4U2 1GL0E 1C5WB 1YPHC 1O2IA 2R9PA 1MU6B 3SJIA 5E8EH 4I86A 1H9HE 3AW1A 1S6HA 1TRYA 4ABFA 1GJBB 2DE9A 5LPRA 5T6GA 1O3NA 1O30A 1CA0B 1NZQH 4Q2KA 1SSXA 3DSOA 3FN8A 3MH7A 3PTNA 3ZV8A 3EYDA 1L1GA 3BTME 2C8YB 8KME2 3LJJA 3TK5A 3BIVH 4FUGA 1EKBB 1TFXA 3S7HB 2J92A 4ZKSU 4A1VA 2B7DH 4CHAC 1MD8A 5EIYA 4AFSA 1F0RA 3VB7A 3RLWH 2PWXA 5HKKD 1NFXA 3BTHE 4FU7A 2PFEA 7GCHG 1D4PB 3GY7A 1AN1E 1IAUA 1L4DA 1ZMJA 4VGCC 1T4UH 3RXTA 3OY6U 2ZGCA 4CHAB 5FBEA 3A81A 3QO6A 3OSYA 3UB0A 1DOJA 2FI5E 5A0BA 3SZEA 1TE0A 3BEUA 4RT1A 2A5IA 2VH6A 2QIQA 2W3IA 4YZUA 3RXFA 4TPIZ 1XXFA 5C0TA 2BX4A 4AGJA 1FUJA 4D7FA 2FYRA 4Y10E 3M3VA 5C1XA 3KQCA 1H8HD 1YPEH 1SGRE 5CHBA 1SGEE 2XBYA 5EOKA 2BQ7B 9ESTA 4WWYA 2FS8A 1KXFA 1Z8JB 4UE7H 2Q6DA 1O3FA 4BTTB 2W3KA 4ZKOU 1DT2A 3KYGA 3LH3A 1QA7A 4U01A 2ANMH 4IW4E 4ABHA 2HOBA 2ZCLP 1B7XB 5DP4A 4Y6DA 4WY3A 3SN8A 3F9EA 1GJ4H 1A2CH 3LDXH 2BY8X 3VXFH 3FO8D 3QK1A 2FP7B 4AX9H 1FAXA 2HVXA 1DUEA 1YGCH 3GICB 5E2OA 1Z1JA 1S0RA 2ASUB 4XE4A 1TBRH 3V3MA 3A83A 1BMAA 1BTHH 1XKBC 2BLOA 1TQ7B 1MTWA 1O2XA 1P03A 4K1TA 1AKSA 3QTOH 7GCHF 3E0NB 2FESH 2AIPA 4DT7B 4X6NA 2JIZD 4X8UH 4KKDA 2ZHWH 3STIA 2FPZA 1GI7B 1AGJA 2NWNA 2Z9JA 5DGJA 3U8TH 1EASA 1UCYK 3ELAH 2A45B 3UR9A 4X1SU 2ZHDA 1HAVB 3BG4B 1TIOA 4KTCA 3RXOA 2FM2A 5DP8A 1GWAA 2WV9A 4AFQA 3OTPA 1YP9A 2A4RA 3C1KA 1TGBA 3PMHB 2VJ1A 1SGCA 1D6WA 2A4GA 4A6LA 4CBNA 2HWLB 4XD7D 1G30B 1O34A 3EDXB 1N8OB 2D8WA 2J98B 3RMNH 2OK5A 1MQ6A 3SNBA 4LXBH 4A5TS 1MTUA 2ZU1A 1SGFA 1FNIA 3LH1A 1BHXB 1O3BA 1AY6H 1C5VA 1N8OC 1Z8IB 2Y5GA 3S9CA 1FN8A 2BLWA 3LIWA 2A5KA 1V2WT 3N7DA 2FEQH 1W0JD 1UCYH 2D26C 2PSXA 3DHKH 2GZ8A 3PTBA 3RXAA 2TBSA 1N1LA 4JK5A 1QL8A 5E0HA 2V6NA 5T6FA 2J38A 4JZ1A 2BLQA 1S81A 3SUGA 5ESBA 2WPHS 2TGTA 2VNTA 1FMGA 1WQVH 1Y3VA 1N6YA 6CHAC 1QL7A 2A32A 3RXSA 3E16B 1MKXH 3SUFA 5EW2H 1ELEE 2BD9A 1K1MA 3GCNA 3STJA 1D6RA 2RA0A 2Z9LA 3EE7A 1INCA 2C4FH 4IN1A 1P8VC 1T8MA 3DFJA 6CHAB 1QY6A 5C0UA 5EW1H 1ZMLA 5GIBA 4WMDA 3RXVA 3SUEA 2AMQA 3BV9B 3PYHA 5C2ZA 2ZDAH 2BDHA 2AIQA 4Y76A 1GBTA 2R2MB 4X1RU 4F48B 1ELBA 6LPRA 3AASA 1VJAU 5AFYH 8GCHG 3URCA 3PROA 1PQ7A 1Y5AT 3RXDA 3V13A 1MKWH 3EE0B 1SLWB 1BITA 3M3SA 1MH0A 2B8OH 5HIZA 1MTNB 2ZGHA 3SBKA 1FAKH 4YESB 1AZZA 2J4IA 2J34A 1C1TA 3TLOA 1BBRK 1V2OT 1T8LA 2JH0D 3VB6A 2VIQA 1AE5A 4DY7B 5EQQA 1C5PA 3ZZ3A 4ABAA 1PPGE 3LU9B 4K8BA 4MPXA 1O33A 2IPQX 5EQSA 1MTNC 1O5FH 2OLGA 5DP6A 4NFFA 1OOKB 3LGTA 1SLUB 2C90B 3Q3XA 3ZVCA 2KFWA 1O2WA 3SU4A 2WHXA 4RKJB 1ZTKA 3T28A 1YWUA 1GJ7B 1O3DA 1O5GH 3P17H 2Z3EA 1KXCA 1O2SA 3FZZA 2IPHA 5KGOA 5FPSA 4ZH8A 1C1MA 2NU3E 4B2AA 2A1DB 4JZIA 1K1IA 1FIZA 4I8JA 5KECA 1NRNH 1VR1H 4XFQA 5IK2D 2AERH 2RFKC 1NFUA 1ZPBA 1TB6H 2RDLA 4TPYA 3OEED 2QXIA 4K5ZA 2HLCA 3QTVH 3HGPA 4Y71A 1A5HA 1PPFE 1S84A 3VEQB 1GJ8B 1MTSA 3TJOA 3BG8A 3LC3A 2SGAA 4A92A 1S5SA 5H4IB 1O2KA 5EXMA 3TJUA 3B9FH 1SB1H 2OTVA 4Y11E 4E7NA 3MOCA 5IYTA 2IN2A 4J2YB 1E79D 4FUDA 2TGPZ 3V7TA 1G3EA 2F9OA 4CRGA 2VWOA 1Q3XA 1G9IE 2VVUA 1E35B 1C2EA 3SO3A 1C4Y2 1MU8B 1LPKB 2C93B 1C5LH 3S7KB 1V2QT 3RLYH 3MU0A 1QGFA 4AFZA 1IQJA 3QZQA 1TNJA 1A7SA 1DDJA 3R3GB 4IC5A 5A8YA 3Q3KA 4YOJA 2QF4A 3RXBA 1S85A 1RIWB 4BXWA 3HKJB 1SFQB 1F2SE 1V2VT 2OXSA 2QY0B 3ZV9A 1HAGE 4Q80A 1F0TA 4CRDA 4KTSA 2XXLA 2SNVA 3VB5A 1GG6C 5F6MA 1A0JA 4IC6A 4MDSA 3UY9A 4DVAU 2GV6A 2VWNA 5GNDA 1MBQA 4NA9H 4K1EA 4K60A 1QL9A 1V2RT 1TX7A 1NC6A 4YOGA 1BMLA 1MZAA 2P16A 3GS9A 3VPKA 3KQEA 1Q31A 4JZFH 1W14U 1QCPA 1OS8A 2BDYA 1MCTA 3SGAE 2A7HA 3OU0A 5DP7A 2P3UB 1EP5A 3GCTF 2VIOA 3MFJA 2XC0A 3M5OA 3MH4A 2AGEX 1MBMA 4DW2U 2HALA 1C2IA 3MYWA 4K8YA 1NS3A 2W6ID 1KLJH 5B6LA 2ZA5A 1JIRA 1LKAA 1FJSA 4X2WA 5GXPA 5JBAS 1THPB 3ATMA 2GDEH 2J97A 1O2NA 1C2JA 2BTCE 2C3SA 2D1JA 1DSTA 1AVWA 1P3CA 1JXPA 2AGIX 2WSSD 3GCHB 4Q7XA 3URDA 1C5OH 1E38B 4XBBA 2PUXB 4CRCA 5DP5A 3GY3A 1CGJE 1NO9H 3G01A 3D49H 2KX4A 4HG6A 1AIXH 2FTLE 4BXSA 2EI8A 3OTJE 4AYYB 4X1NU 3U9AH 3PB1E 4Q63A 2CHAC 1GI0A 2BDIA 1QZ8A 2FLBH 3K6YA 5GPIB 3ATLA 1O32A 5EJZA 3ZZAA 5AVDA 1O5EH 1LQEA 3RU4D 1KSNA 1OKXA 2H1UA 4X2VA 3SYJA 3MQKC 1SC8U 1TALA 3MO9A 4SGBE 1QFKH 1CT2E 3CS0A 3SORA 2P3TB 2PKSB 3SI4H 1E0FD 1HAOH 3IWMA 1SLXB 1WCZA 3MHWU 5F53A 2ZZUH 4B1TA 1UMAH 2CK3D 1GMDF 1F5RA 1IQMA 3L3TA 2I6QA 1TPAE 3LGWA 4CRAA 1DLKB 4H4FA 4ZXYH 4GCHF 4JZEH 4JMYA 1EAIA 1K0HA 3M7TA 3PLBA 2UWLA 3UIRA 2ZNKH 4MNYA 1YPGH 2XWAA 1O39A 1C5SA 3GCOA 1KTSB 3RMOH 2XWBI 3B23B 4WJG2 1C2DA 1L2EA 2YNAA 2B9LA 3EA9A 2WV4A 1QURH 1UTKA 2JH6D 2G8TA 1TOCB 1CBWC 5CHAC 1FPHH 1OYTH 2ZFTA 4GLYA 2TIOA 5A0AE 3TH4H 1EJMA 1KXBA 1HUTH 4MPVA 2G00A 4INLA 3TGJE 2W5EA 1SFIA 3FZDA 1COWD 1L4ZA 2LP6A 1OYQA 1GGDB 1WSSH 2VINA 5FBIA 4NIXA 3HK6B 3PMJA 1W2KH 3UNRA 1BT7A 1J9CH 3DFLA 1ZR0A 3M37A 1NTPA 1ZSLA 1P2JA 3E3TA 4GUXA 3PLKA 1HBTH 3S69A 3SU3A 4OS2A 2AS9A 1PYTD 2PUQH 1UK2A 3UREA 3LONA 1MD7A 3SV9A 3KF2A 5HYOA 3H7TA 2C8XB 3UQVA 2FOEA 2NU4E 1EXFA 1YLDA 2PLXA 1CT0E 2CF9H 1TYNA 1RXPA 2XC4A 1P9SA 2F9NA 2ZFRH 2P93A 4UD9H 1ANDA 2FOBA 2BXTH 2GP9B 2TGDA 1WDIA 1PPBH 2GGVB 3RXLA 1E36B 5L2YH 4DJZB 4BTUB 4AG1A 2K8IA 1EOLA 1UVPA 4ZHAA 2ZKSA 2SGDE 1XX9A 1TA2A 1FPCH 1HJ9A 4DT4A 2EA3A 5HGGA 1SVPA 2A0QB 2XOKD 1YF4A 2DUCA 7ESTE 4NWKA 3JZ1B 1AU8A 2Y5FA 3Q77A 2OINA 1BBRH 1F0UA 1GHZA 4UFDH 1ZTLA 2HRVA 2PSYA 3A8CA 1QR3E 4F4OC 1LQDB 2ZI2H 1O36A 3QZRA 1QQ4A 2KCPA 3VB4A 3U8OH 1A5GH 2PP6A 5T1VA 2OC7A 1QBNA 1TRMA 2ZC9H 3PWBA 1BCUH 2V3OH 4UFEH 4ISIH 5G4BA 5HM9A 3TGIE 2FO9A 3H09A 3H5CB 1C1VH 1WUNH 4NG9H 4WMFA 4Y0YE 2G81E 4CR5A 3PV4A 2J2UA 3A7VA 1MKXK 1PPZA 1DE7H 5SGAE 3EAJA 4X8TH 1A46H 1DVAH 1KY9A 2JETB 4NZLA 1QQUA 3QN7A 4MPWA 1ELAA 2FX6A 1DX5M 1CHOG 3MI4A 4GVUA 3CENA 1DWDH 1GDNA 2J9NA 1O3OA 2OC1A 1CVWH 2H5DA 2BY5X 1EZSC 5JBBS 2OP9A 2UUYA 3CNRA 1GJAB 3SQEE 3ZZ4A 1WQSA 5CMXH 1GVZA 3UAIC 1JRTA 4RI0A 5E2PA 2ZDMA 4OM9A 3MNBA 3L6PA 1FI8A 2P59A 3SQHE 2FI3E 3LJOA 5EPNA 2ANWA 2QF5A 4K1SA 5DJ7A 1JWTA 3A84A 3PRDA 1EZXC 5L6NH 4YXWD 2ZPQA 3M61U 2H9EH 4ABEA 1SG8B 2Z9GA 3RDZA 1KXEA 1YY3A 3N7EA 2SGEE 3D65E 4Z6AH 4KGAA 3UOUA 1DICA 2WYGA 3LGUA 3KN2A 1O38A 2VGCB 4Y8XA 3SI3H 1GGDC 1YCPM 4TY6A 1GHBG 2CJIA 5GWZA 2HPQH 2VIVA 1Y5BT 2Y6TA 6GCHG 2R0LA 2Y81A 3VGCC 3MH6A 4FOUC 1BDAA 1BIOA 1H1BA 1OWKA 4HGCA 1V2NT 1TX8A 2UWOA 4IS5A 1YPLH 1ZGIA 3T27A 3SNAA 1AKSB 1BMMH 1NU9A 4BAQB 2RA3A 3OAAD 3KL6A 1V6DA 4NIYA 3TVJB 4BTIB 1DXPA 4E05H 4I7YH 2BYAX 3KQ5A 1GI2A 3LPRA 4DOQA 2UUFB 2BVXH 3ZZ7A 4D7GA 4Y8YA 1W11U 3RXEA 3DT0H 3P6ZB 5TCAA 1LTOA 1AFQB 3E6PH 1ELCA 3WY8A 4INHA 2V0BA 1NM6A 1BTPA 1FQ3A 1SPJA 1TMUH 1AWHB 2HNTC 1PFXC 2VIDA 1WYKA 4HI3A 4ISOA 1L0ZA 1NRRH 1UK3A 2BD3A 3SGBE 1GMDG 1OWDA 2STBE 2P3FH 3HKIB 5DK1A 4Y0ZE 1Z7KA 1AFQC 3FP6E 5IDKA 1HAHH 2BQWB 2ZF0H 3ZVEA 1Q2WA 2FOAA 4UFFH 5C94A 1VITH 1G3CA 5EXNA 1FY4A 2BOKA 2VWMA 1V2UT 1AWFH 3UUZA 2BY7X 2ANKH 4DURA 3RMLH 1O5BB 1IQFA 2ZHFH 1YPMH 4OGXA 5A8XA 2TRMA 1GI9B 1WTGH 4ZHLU 2O9QA 2ZQ1A 3SNCA 3A7ZA 2QE7D 1TX6A 3ODFA 2NU1E 2A7JA
chains in the Genus database with same CATH topology
5C20A 1ESBA 3MU5A 3Q76A 2NU2E 1LMWB 3QGNB 1VITG 1W10U 2G5VA 4I31A 1J17T 4FUBA 2FOFA 2R2WU 3GDUA 4IGDA 5JDUB 1YPHE 3NWUA 1RD3B 2ZCHP 1UVOA 1KLTA 3PMAB 1FDPA 4KELA 2OUAA 1W7XH 4UDWH 1IQNA 3ATKA 1EPTC 4Q7YA 1SGYE 1KLIH 3N7OA 1UTJA 5LPEA 1QA0A 3A8AA 4RKOB 1HXEH 2GZ7A 3NZIA 4WVPE 1P12E 1SGNE 1KDQB 1CGIE 1HJAC 1RRKA 1LHDH 1ORFA 1QB9A 1CA0C 4E7RG 8LPRA 1EPTB 5JB9S 2XNIA 3F9HA 4LOYH 4TWWA 1ZHRA 1G3DA 3KHVA 3GYLB 3GYMA 1SGFG 4CREA 3SU0A 2W7SA 1GMHG 3VXEH 1FIWA 3ZZ8A 1TOMH 1O2RA 4R8TB 3BTKE 4DG4A 1GI3A 4Q7ZA 4Y7BA 1ANCA 2Y7ZA 3GY5A 2BZ6H 5DG6A 5GDSH 4BAHB 1UVUH 4UFGH 1AHTH 1W3CA 3M5LA 2OCVB 5K0HA 2CGAA 3ZZDA 2G51A 1HAXB 1VGCC 1QNJA 1GHAG 1HYLA 1Y3YA 2QAAA 3KEEA 4BAMB 4YT7H 3ZZBA 2FS9A 2GD4B 4YTAA 3SJKA 1VCPA 1A0HB 2ZP0H 1CHOF 1ELVA 1XUJA 4THNH 4PROA 2BXUH 2A5AA 2SGPE 2F9BH 5A09A 3IG6B 3MO3A 1SHYA 5HMAA 3P70B 4GSOA 1B5GH 1GI5A 3MU8A 2FODA 1TNGA 1BQYA 1H8DH 1AMHA 1FONA 1FN6A 4X2XA 2O8MA 3KQBA 1GL1A 4NFEA 4QT8C 4I8GA 4XSKU 4X6OA 1K1OA 1C5QA 1D3QB 2THFB 4IN2A 3KIDU 5JBCS 2FWWA 1EX3A 4YM9A 5FHTA 1ZHPA 1HIAB 1LO6A 1C2GA 1GBEA 2GTBA 1TAWA 3P8OA 4D8NA 3BTDE 4CH2B 1GBBA 1V2LT 1D9IA 1C9PA 3M36A 4H42U 1ARBA 4YOIA 1GMCG 1CU1A 1QBOA 1W0YH 4B74A 1H4WA 2F3CE 1GHBF 3ZVGA 1GBDA 1K2I1 1LVBA 2H5CA 2VIWA 3SV6A 2STAE 4ZAEA 4B75A 5JYIA 1C1RA 2F91A 2WPLS 2P8OC 1BZXE 3SGQE 1CGHA 1EOJA 3GY4A 3SU5A 1DY9A 1C9TA 1ZSKA 1E37B 2GT8A 1P06A 2ZFSA 4YT6H 2SNWA 1F5KU 2QXJA 2WV5A 5TJXA 2QF0A 1O2OA 1SGIB 1GDUA 1P04A 4OS7A 2BD5A 1P57B 2P8OB 3SU2A 2BDBA 1DXWA 4XDEA 1O3JA 3QWCH 1J16A 3GDVA 3GY6A 2M5TA 3RXHA 3A88A 1P9UA 1GHXH 4NA8A 1TBQH 3M7QA 2A31A 1O2GH 3BSQA 2G55A 1OP2A 3TJNA 4YLUA 1GVKB 1Y5UT 1QB6A 2YNBA 1YBWA 2JKHA 1YYY1 2DE8A 5ABWA 1O2JA 3RXGA 2OD3B 4FU9A 4IBLH 1D3DB 1EAXA 1TPOA 3TK9A 1ZPCA 4VGCB 1V2KT 1O3IA 2H2ZA 3Q3YA 3TH3H 3BEFB 3U1IB 4GHQA 2UUKB 2CMYA 4MTBA 3SNDA 1F92A 2XC5A 1K9OE 1PPHE 1UTPA 1HAPH 2JH5D 2VVVA 4Z0KA 3ZZ6A 1BHXF 3IITA 1ZOMA 3NK8A 4I33A 1A0LA 2XCFA 1IQHA 1GJ5H 1LPGB 1C2FA 1OX1A 5ESTE 1EB2A 2PGQB 3RP2A 1J14A 1KXAA 4CRFA 3TGKE 1TNKA 1VGCB 2GVFA 4I8HA 5LH8A 2EI7A 2G5NA 3A86A 4ABBA 1C5XB 1QJ6B 1ZTJA 1ZSJA 2TPIZ 1JOUB 5AFZH 5C67A 1E34B 4X6MA 3QGJA 3DD2H 1S6FA 3RXPA 3SJ8A 1XKAC 2Z9KA 3SOSA 1GJDB 1VCWA 2FXRA 1GI6A 1QBVH 4MQAA 2ESTE 1TGTA 2ZU2A 4CR9A 2R3YA 1PPEE 2BDAA 1W13U 3MU4A 5C1UA 2QA9E 2KAIA 2WUBA 1AO5A 3MWIU 3NPSA 4NIWA 3F1SB 2AFQB 1FLEE 2H6MA 3OY5U 1EZQA 1SI5H 1GBJA 3S9BA 1LVMA 5EG4A 5C5OA 4ABGA 3LGYA 4NGAH 2BDCA 5FX6A 3TH2H 5FXLA 1RGQA 1UHBA 4WXIA 4YLQH 1C5RA 1EZUC 1PQAA 3MNSA 1WTHD 3A7YA 1P2IA 4JZDH 2O8TA 1BRCE 1BTYA 1A1RA 4Y8ZA 2BD7A 1K28D 5FCKA 1GHAF 4KTUA 1HGTH 2Z7FE 1ARCA 3K6ZA 1XXDA 2ZQ2A 1SGTA 1OSSA 1YLCA 3VB3A 1NESE 1ETTH 2GKVE 3TITA 4CBOA 5T6DA 4MPUA 1T4VH 4R0IA 4B2BA 3PO1B 4OGYA 1IHSH 3RXRA 1DITH 4MLFB 4TYDA 2CN0H 3O8BA 1B0EA 3RXUA 1MKWK 5JBTA 1VJ9U 2K1QA 2ZU4A 5EU8A 3RUOA 2A4QA 3KNXA 3BG4C 3E90B 3ZZ9A 3RM2H 3TIUA 3A8BA 3PO1C 2Q6GA 1GPZA 4FUEA 1NT1A 1RJXB 1GI1A 1FV9A 1HNEE 2QV1A 2FYQA 2ZFPH 3BTFE 2ANYA 3A7XA 4XBCA 3O8DA 4RN6A 3GOVB 3RXKA 3DA9B 1Z8RA 3F6UH 1ELFA 2GCHF 5FAHA 1YCPK 1HCGA 2F9UA 1IQGA 4DIIH 2QC2A 1P2QA 1NRPH 5I25A 2ZECA 3PWCA 5E0GA 3U98H 1RTKA 1RS0A 3T29A 1UTQA 2GMTB 3K2UA 1EB1H 4SGAE 2BM2A 1TPSA 3LC5A 1LHFH 2ZFFH 4O9VA 3ZVDA 2XYAA 4OS6A 2EEKA 4H6TA 4O3TA 1GHVH 3U69H 3ODDA 1UK4A 3ZZ5A 1T7CA 4U32A 1S82A 1C2LA 1P10A 2GMTC 4Y7AA 4FVDA 2C8WB 2RG3A 1JRSA 1O2HA 1O3MA 3SHAH 3O8CA 1H9IE 2ZFQH 3KCGH 1BRUP 4I32A 1XUIA 8ESTE 1M9UA 2FMJA 1HDTH 1PQ5A 1G2MA 4FVBA 2PV9B 4ABJA 4HZHA 1GHYH 2XRCA 2V35A 5J4SA 5GCHG 1BUIA 1DUAA 1BBRE 2ALPA 1P05A 3H7OA 2J95A 4CRBA 1EQ9A 1BOQA 1F0SA 1SQAA 1DLEA 1W7GH 1QRWA 1C5UA 2WPKS 3GISB 3P8GA 1ID5H 1X7AC 2ZGBH 1GHWH 1MTVA 3RU4T 2FOCA 4NZQA 2ODPA 3I29A 1UHBB 1YCPH 4FUHA 5AHGH 4BNRA 1Y3UA 4MNVA 5EPYA 3R0FA 1FY3A 2Z9IA 4TWYA 2BD2A 4FUCA 2QN5T 1HLTH 2ZGJA 3SU1A 1GI8B 1FXYA 1T8OA 1XUGA 2AMPA 4MNWA 4KP0A 1PJPA 3A89A 4X2YA 2WINI 1EJNA 1ABJH 2ZWLH 1C1SA 3BTEE 1BA8B 3T62A 1JMOH 1O2LA 1SL3A 3BN9A 2WPMS 5DPAA 3ZYDA 1P2OA 5HM2A 1SLVB 2A2QH 3A8DA 2YOLA 1VZQH 1HAZB 3M5NA 1UJ1A 1QHRB 5J4QA 2ULLA 5EODA 1YKTA 2B5TB 1N6XA 1GBFA 3RXIA 4K2YA 3SHCH 2Y7XA 1UVTH 3UWJH 1NN6A 3QDZB 3UPEA 3T26A 1LHGH 1EATA 3T25A 2Z3CA 3I78A 1GJ9B 2Q1JA 2GV7A 3AAUA 2QF3A 3NCLA 4H6SB 1C2KA 2VVCA 2LPRA 1O3CA 3TNSA 4M7GA 2PTCE 3HATH 1O2ZA 2ZPSA 3P92A 4HFPB 4GHTA 3W95A 4UONA 1Y3WA 3ZYEA 3OYPA 1O2MA 1UO6A 3QLPH 1VCQA 1K1LA 4FUFA 1D3PB 5GJ4B 3PMBB 2XBXA 2ZU3A 1SGQE 5HXFA 3FP7E 2QXGA 3ZVAA 4TY7A 3BTGE 2NU0E 1QJ1B 3D23A 4JK6A 1OP0A 1MUEB 1XUKA 1EAWA 1Y59T 4F49A 3RC6A 1IQEA 1K1NA 1CQQA 2QGRA 1G32B 1C2HA 3A7WA 1RTFB 3ITIA 1TGCA 4B76A 4ZROA 1AD8H 1KIGH 1TQ0B 3D62A 1C1PA 4X1QU 5DP3A 4B71A 1C1NA 2VIPA 1KDQA 1BJUA 5DKMA 1OP8A 3QX5H 1F5LA 3KQDA 2HGTH 2V3HH 3UNSA 2CV3A 2OC8A 1ZRBA 3GDSA 3SUDA 1NPMA 3RM0H 2BB4A 3UWIA 4XBDA 4BANB 1DWCH 3ZZCA 5A8ZA 5E0JA 3KGPA 1P0SH 3CS7A 4U2WA 1V3XA 1NROH 2FZZA 3V0XA 1HB0B 3GCHC 1TNHA 2WPJS 2BD4A 2QCYA 2TGAA 3BEIB 4WXVA 4ESTE 3MNCA 1ESAA 1IQIA 3F68H 5EXLA 1G36A 2XCNA 2HNTF 3ESTA 1P2NA 1HAVA 1XUFA 4JCNA 2UUJB 1ETSH 1CE5A 2CHAB 4O03A 5LPFA 3A87A 3RXMA 4X8SH 1FZZA 1T8NA 3EGKH 3GY8A 1TNIA 4WMEA 3NKKA 3ZVFA 4FXGH 2PR3A 2A4OA 2W7UA 5F8XA 1ELGA 2IJOB 3BTWE 4DIHH 2PKSC 3B8JA 4ISHH 1QRZA 1ZJDA 4X1PU 1BJVA 2I6SA 4NA7A 1O3AA 2FOGA 1V2MT 1EPTA 1ACBE 5CHAB 3CP7A 2AEIH 2ODYB 1ESTA 1LHCH 1AVGH 2BQ6B 3BTTE 3HK3B 1HRTH 1AI8H 4JYUH 2GT7A 1ELDE 3SV7A 1RIWC 3A80A 1S83A 4ZXXH 1TABE 4MNXA 1TBZH 1J15A 2P95A 2BLVA 5FCRA 1UTMA 1GG6B 1BRBE 3I77A 2Z3DA 2D2DA 2FIRH 2BVRH 4LK4A 2G4UA 1K1PA 1PYTC 2SGQE 4NSVA 3K9XB 1SQTA 4D9RA 2GCTC 2G52A 3U8RH 1AVXA 2Y82A 1MAXA 2B0FA 3LGVA 4LZ4B 1T32A 2ZTXA 4K69A 4A7IB 2ZTYA 2O8UA 1NRSH 1BTUA 1GCTC 1UTOA 1KXDA 3HGNA 4IMQA 2A2XH 1S0QA 3M3TA 1P3EA 1FY1A 1SMFE 1XUHA 1O5DH 2FLRH 3A82A 1SBWA 1A4WH 4NWLA 1C5TA 2AH4X 4MG3A 1THSH 1GBHA 1GCTB 1O2YA 4A1XA 1A61H 2BDGA 2VWLA 2Z6BD 1C5MD 1SGPE 5F8TA 1HAYB 2A7CA 2H9TH 1RFNA 1DM4B 1MZDA 5F8ZA 4AORA 4DCDA 4K3JA 1TGNA 1Z8GA 1OWHA 1GJ6A 5FPYA 3UQOA 2ZDKA 1ZRKA 3V12A 3SV8A 5T3HA 2PW8H 5LGOA 1G3BA 1EAUA 3UTUH 1AE8H 3TPIZ 7LPRA 1C1UH 3E8LA 1JIMA 1CA8B 1GMHF 1LVOA 1WOFA 3EA7A 5EQRA 2W26A 1Y8TA 3NXPA 5A0CA 1QTFA 1PPCE 1DWBH 1TRNA 5DO4H 2BHGA 4U30A 2OQ5A 1MMJN 1THRH 3UFAA 1C4V2 3T2NA 2F9PA 2ZGXH 1EJAA 4AZ2B 3MNXA 4GAWA 4J1YA 2RCEA 1DPOA 2HNTE 2WUCA 1O3PB 3K65B 4WF8A 1O31A 3SJ9A 4D76A 1YPJH 4XOJA 1L1NA 1G37A 1TNLA 2WYJA 1U6QA 5F03A 4RSPA 4B2CA 1OWEA 2OBQA 1ANBA 1ZGVA 1V2TT 5BRRE 3MTYA 1Y3XA 2OC0A 3P8FA 1GI4A 3S0NA 3FFGA 1JBUH 1AQ7A 1BRAA 2O8WA 2ZHQH 4DGJA 4FUIA 3MU1A 2CXVA 1O35A 1P2MA 2IOTA 1BTXA 2KAIB 3GCTG 4AN7A 3LGIA 1GCDA 4E06H 4Y79A 2ALVA 3MH5A 1QB1A 1BMNH 3Q00A 2GZ9A 1XM1A 2C8ZB 1YC0A 1KTTB 1BTZA 1P01A 4BAKB 3T5FH 1CBWB 2ODQA 1Z6EA 2QYIA 1Z71A 3M7UA 3MMGA 3A7TA 1GBKA 1W0ZU 3ATWA 1NY22 3EQ0H 1TMTH 5PTPA 3VFEA 1TWXB 2VB0A 1WU1A 1WAYB 3FVFB 1KYNA 1GBIA 3NUMA 5BPEA 3HPTB 3FP8E 1K22H 4ZKRU 2GCTB 1GJCB 2PGBB 1HPGA 2HPPH 1NFYA 1AUJA 1B0FA 5JPMH 5CE1A 1VITF 1YM0A 3GY2A 1MAYA 2VGCC 2AYWA 1O2PA 4UEHH 2WPIS 5C3NA 1D3TB 1XVMA 5I46H 3FAOA 4ISNA 3M35A 3VGCB 2BZAA 1NRQH 3RC4A 1P02A 2XTTB 4ZMAH 3PLPA 1IQKA 3TU7H 1GBAA 4ZHMU 1TONA 1LPZB 1Z1IA 1K1JA 1Z6JH 1O5AB 1O0DH 2F9VA 1NU7B 3RXCA 2Q6FA 3U1JB 3A85A 1H8IH 3E1XB 1K21H 1DY8A 1GDQA 2SFAA 2Y80A 4AB8A 4GCHG 2OBOA 4ASHA 2PHBA 1QIXB 2BY9X 3P8NA 2PKAA 2VH0A 4MVNA 1HV7A 1IOEA 1C1QA 2G4TA 2ZDVH 4I8KA 5FX5A 2FOMB 2P94A 5DP9A 5L30H 4AOQA 4INKA 2QXHA 2BX3A 3AVZA 1AB9B 1O2VA 1DANH 3F9GA 3SU6A 1HFDA 6GCHF 1FY8E 2BVSH 4OS4A 5A2MH 1HJ8A 1BTWA 2XW9A 3F9FA 2ZU5A 3BIUH 4JYTA 1L1JA 3AAVA 5GCHF 4D9QA 1HIAA 1LDTT 1OXGA 2XBWA 5L2ZH 4AG2A 3RXJA 1ZLRA 4X0WU 3TNTA 2PTNA 4HTCH 3P95A 4B73A 1ETRH 1GBMA 1O3KA 2JETC 3LOXA 5EGMA 3SW2B 3TK6A 2ILNA 2ZPRA 1ELTA 2XBVA 1CHGA 1AUTC 5TCCA 3LKWA 1OPHB 2CF8H 2ZTZA 1SQOA 1MCVA 1LCYA 1OWJA 2ZDLA 2ZDNA 1V2JT 1H9LB 4ABDA 3DUXH 4I8LA 2FI4E 2EI6A 3PM3A 1C1OA 1GBCA 4GPGA 4AB9A 4YO9A 2PKAB 3W94A