1SQOA

Substituted 2-naphthamidine inhibitors of urokinase
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interaction with the S1beta-pocket of urokinase: 8-heterocycle substituted and 6,8-disubstituted 2-naphthamidine urokinase inhibitors.
pubmed rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Urokinase-type plasminogen activator
total genus 57
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sqoA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sqoA01
5TCAA 1INCA 1YGCH 3GICB 5F8XA 4NA9H 2G00A 1SI5H 1QR3E 1ZHRA 2VVVA 3OTJE 1PPEE 2VIWA 1C1QA 1EXFA 1T8NA 1O2UA 4UD9H 1EZSC 4Y79A 3OSYA 2FEQH 1O31A 2F3CE 1QL9A 3MNBA 4ISHH 1SMFE 4X1RU 3RMLH 4ZMAH 1P09A 2ASUB 2D2DA 3BTGE 5F8TA 3H7OA 4ZROA 3SU1A 4B76A 3T28A 5HGGA 7GCHG 1DUAA 3L6PA 1AFQC 1SLUB 1P9UA 2NWNA 3A7ZA 1P10A 2A45B 3BIVH 5BPEA 2F9NA 4B1TA 1C2KA 1SGCA 2ZGXH 1UVUH 4MPWA 5E0HA 1ID5H 5HM2A 1ELAA 1IQLA 1HDTH 3MFJA 2F91A 4U01A 1C5YB 2Q6GA 1Z6JH 1LHDH 1TNJA 3SV8A 1NFXA 2ZPQA 2Y5HA 3ODFA 1AHTH 1IQGA 1K9OE 1T8LA 2BLVA 2D26C 2IOTA 3M5MA 2HLCA 2QA9E 1FZZA 2UWPA 1BBRE 4IN1A 3V3MA 2QYIA 1GJAB 4GHTA 3GOVB 1PYTD 2GKVE 3ATLA 1GCTC 1FI8A 1GBFA 2FESH 2ESTE 3SZNA 1RTFB 3MO3A 1QY6A 4AG2A 2BZ6H 3A85A 3KNXA 3E1XB 1DXPA 1WCZA 3TNSA 1DFPA 1Y3YA 1CQQA 3IWMA 4K60A 1GVKB 1H9HE 5PTPA 5C5NA 3BSQA 5BRRE 2CMYA 2GCTC 1PPZA 2SNVA 1XKAC 1GHZA 5CE1A 1TGBA 1B7XB 1C5UA 1FIWA 1S0QA 1O5CB 2ZFSA 2G5NA 4NFEA 1FY3A 1J17T 3CS7A 4UEHH 2OC8A 2DE8A 2NU4E 3E6PH 3JZ1B 1SPJA 2GD4B 2GMTB 2H1UA 1YBWA 3TIUA 5JPMH 1BBRH 4DVAU 4Y7BA 1OYTH 3BN9A 4MDSA 4A92A 1SFQB 3VB6A 1XKBC 1G3BA 1VR1H 2LPRA 3P6ZB 3VB4A 3O8RA 2TIOA 3HGNA 4O9VA 5DJ7A 2C8YB 2JETC 1UMAH 2PUXB 2HVXA 1UHBA 1GJ4H 3GISB 2ALPA 2ZNKH 1EAWA 4MG3A 1VGCB 3AVZA 1PFXC 4IW4E 3RXVA 2A4RA 2BD4A 2FOFA 2BDAA 2J95A 2GVFA 3ZZCA 3RP2A 2FX4A 1LDTT 4R0IA 1HPGA 3RMNH 5HYOA 3SUEA 1P0SH 3LOXA 3ZVCA 2BDBA 1AO5A 4CH2B 3R3GB 4CRBA 2Z9JA 3A7XA 2RCEA 1DLKB 1DM4B 1MTWA 1GBDA 2ZDVH 2ZPSA 3KL6A 1GMDG 3ZZ7A 2QGRA 3LJOA 1IQFA 1MCTA 4HGCA 4IGDA 5F03A 4Y8XA 2FYRA 2ZU2A 2BMGB 1MKXH 4MNYA 3NKKA 4Q7YA 1SGEE 2ZWLH 1VGCC 4LK4A 3KF2A 3PV4A 2VINA 4VGCC 5GJ4B 2C8XB 3PWBA 1QB1A 5FBIA 2ZU4A 3PMAB 2A1DB 4Q80A 1EQ9A 2BVRH 1GMDF 1LKAA 1SGFA 3BEFB 4UFFH 1O3BA 1SFIA 1ZZZA 3P70B 3T26A 3U1JB 1GBCA 1YPGH 4ZHMU 5TCCA 1RD3B 1MMJN 2ZHWH 1QA0A 1BRAA 2ZGJA 5HXFA 3UR9A 4THNH 4WH8A 3P8GA 3CP7A 3SW2B 2EA3A 5JBAS 4ISOA 1LHFH 3D49H 3U98H 4LZ1H 1C5MD 1Q31A 1P2IA 1XMNB 4DY7B 1V2NT 5AVDA 4XBCA 3Q3KA 1GBMA 1O5GH 1CE5A 3RXGA 3SJIA 1T4UH 1IQMA 2XC4A 1QBNA 3PMHB 3MU4A 2FX6A 2SGFE 2C4FH 3MHWU 1KXDA 2V3HH 4RKJB 1KDQA 4I8HA 1ELFA 4RSPA 4KELA 1TONA 1GVLA 1GI4A 2I6SA 3R0FA 5CHAC 1GL1A 1DWEH 2J9NA 4OS2A 3ZZAA 1YF4A 2OD3B 2ZDAH 1G9IE 1RXPA 3BEUA 1IHTH 4AFQA 4X0WU 3PB1E 3QZRA 4D9QA 2ZFRH 2XBYA 3FZDA 1Y5AT 1OWKA 1SLVB 2GGVB 2VNTA 3E3TA 1UTMA 4H42U 3L3TA 3VB5A 1DY8A 1UTOA 3MWIU 4X6MA 1O2WA 1TBRH 3PYHA 2A31A 1WAYB 2PR3A 4MQAA 2WV5A 4Y76A 4XFQA 1FAXA 1GCDA 2ZCKP 1A7SA 4X8TH 1YP9A 4CR5A 1F0TA 2HWLB 4YT7H 2VWMA 2BY7X 1N1LA 1ETRH 3KEEA 1OOKB 5L6NH 4GCHG 2Y82A 1Z8IB 5DP8A 1TX6A 3LGIA 1TB6H 1KTSB 1T7CA 2FS9A 1IHSH 2BTCE 3QZQA 4FUEA 4Y7AA 1LVYA 2KAIA 1BRBE 2BD7A 2R0KA 1DDJA 2ZGCA 2FODA 1MTNB 1QRWA 5GXPA 3VEQB 3ATWA 1PQ5A 1Z7KA 5J4QA 5HM9A 1NN6A 2P8OB 3SNDA 1ESTA 2BDCA 2A7HA 1S84A 3B8JA 3F9GA 3RUOA 3RM2H 1YPHE 2BDIA 2AH4X 4FUJA 3K9XB 4F4OC 1BCUH 1TWXB 2IPHA 2ANYA 1V2TT 2TGTA 3SU2A 7KMEH 2J38A 3SU0A 1F92A 3TH4H 7GCHF 1ELTA 1Z1JA 3LONA 2PSYA 4JK5A 1PJPA 1KY9A 1QGFA 4ABGA 3AASA 4CRAA 3E0NB 4LOYH 2VB0A 1UVPA 3RXUA 1SQOA 2CJIA 5A0CA 4X8UH 2BX3A 2TPIZ 1C1MA 1V2KT 2FTLE 3BIUH 2FOBA 1BQYA 2HNTF 1BTXA 3SJ9A 3UWJH 2FZZA 3P95A 4FUDA 1C5VA 1W14U 1DVAH 2CXVA 1UTKA 1LVOA 1G32B 2AYWA 1FJSA 3BTDE 1YPKH 5JB8S 4JMYA 1GG6B 1MU6B 4KTCA 1V2JT 4U2WA 4D76A 2G55A 3S9CA 3EGKH 2G4UA 2QCYA 4ZHAA 4MPVA 1QCPA 3STIA 1EZXC 2R9PA 4AB9A 2OUAA 3UWIA 1QURH 1HAGE 1C1RA 3PO1B 4NIXA 4CREA 2XRCA 1GHVH 1UTLM 2R3UA 3E8LA 3K2UA 3ZYEA 2AFQB 3SGAE 2BM2A 1BDAA 1N6XA 1IQNA 3SGBE 2A7CA 3ZYDA 1A3BH 1GHBG 4WMDA 4X1SU 2R2MB 3BG4B 6ESTA 1T8OA 3EYDA 1C2DA 4OGXA 1QL8A 3GDVA 3RXRA 1E38B 1AFEH 3TVJB 2QXHA 2BY5X 1FY1A 5DO4H 2H9TH 5LPRA 1YCPH 1O5FH 1A0LA 3OX7U 1GHXH 2V6NA 4AZ2B 1P2MA 2O9QA 2J4IA 1TA6A 1NFUA 3KN2A 1Z6EA 2OC0A 1D3TB 5FXLA 2A5AA 3RXEA 2SFAA 1C1OA 1NT1A 3GCTG 5LPFA 3UNRA 1CHOG 1P2JA 3DD2H 2HPPH 3NCLA 1IQIA 1GHAF 3GCNA 1W8BH 2Y81A 1SGIB 4ZXYH 4FUIA 2VIPA 1GBAA 2ZU1A 1F2SE 1S5SA 2TGPZ 1A2CH 1Y5UT 3RXDA 2WYGA 1D6RA 5C2ZA 2F9BH 2ZQ2A 1KXEA 2CV3A 1O38A 1EB1H 1L1GA 3LT3A 3HK3B 3FANA 1BBRK 1HRTH 5K0HA 1ANDA 3MH4A 3A89A 1A1RA 1GI9B 3V0XA 4IC6A 3S9AA 3B23B 4TYDA 4ZKRU 2A5KA 5C3NA 4BTUB 2BD2A 4B2CA 3ZZ8A 5E2PA 1SQTA 2Y5FA 1LTOA 1E37B 1WBGB 1TABE 1DANH 3A7YA 3HKJB 2GCHF 4K1TA 4A5TS 1GDQA 5JB9S 1DY9A 1GJ5H 3A7TA 1AD8H 1NRQH 1QA7A 1P2QA 1UVSH 2ZA5A 3MYWA 1V3XA 4AORA 2NU0E 1DXWA 1VJAU 1GI0A 2G52A 3SQHE 1TQ7B 4WH6A 2BD5A 1O5BB 1AKSA 4FU9A 1UTQA 1V2RT 1VCPA 4CHAC 5CMXH 5GIBA 4GVUA 4K8YA 3UIRA 1CBWB 4B2AA 1WTHD 5EPYA 3ZVBA 4D7FA 1O2GH 1TRMA 1HXEH 3G01A 3RXFA 4DT7B 3SJ8A 3KHVA 3BG4C 2OLGA 1VJ9U 2O8UA 3ATKA 2BYAX 3MO9A 2FP7B 1BTPA 1QTFA 1MKXK 1HAYB 3TK9A 1B5GH 1FN8A 1H1BA 3BTME 3RLWH 5AF9H 3SU4A 2ANMH 2PHBA 1BMLA 2ZCHP 5JBBS 3GCHC 3PLBA 1HAXB 1K1IA 3SU5A 4BAMB 3CS0A 5EQQA 1LPGB 3PM3A 1SOZA 1O2YA 3PWCA 4CRFA 4FUGA 1JBUH 4ZKOU 1HBTH 1OWHA 2BD8A 4YOIA 1EP5A 2GMTC 1NPMA 1G30B 5GCHF 2BOHB 3NK8A 1TFXA 1BTUA 2D1JA 4NZQA 5ETXA 3U8OH 5J4SA 3EA9A 4IS5A 4DGJA 2Y7XA 1AGJA 5C5OA 3KQEA 1GHWH 4H4FA 3C1KA 1FDPA 1IQEA 4JK6A 3UUZA 1E35B 5E2OA 4WY3A 4R8TB 2WPLS 1GJ8B 2UWOA 3SV9A 2AIPA 4ZHLU 1EOJA 3ODDA 3SO3A 3TK6A 1AE5A 3M7UA 1UVOA 1C9PA 1SHHB 1KIGH 2ANWA 3RMOH 1HYLA 2QXIA 4ABAA 3I29A 2OP9A 1A0HB 2BXUH 1C1NA 1SB1H 2ZFTA 1MD8A 1C5ZB 1B0FA 1FY8E 5HMAA 2BDHA 4NA7A 1HNEE 1O3CA 4HTCH 3F68H 3BF6H 1ZGVA 1HAHH 2OC7A 4X2YA 1K1NA 2QAAA 3L33A 4K1EA 3EAJA 3UNQA 3FP7E 1ZHMA 1BHXF 3BTQE 5GDSH 1AQ7A 2EI8A 3TH3H 1OX1A 2R3YA 3KQCA 1Z8JB 1EASA 5DP6A 3ZVAA 2FI5E 4DCDA 2FOHA 1C1PA 3N7OA 2EEKA 1W10U 1S6HA 1WSSH 1CO7E 1C1TA 2PKSB 1RGQA 4TPYA 2ODYB 3QTVH 3U9AH 1O5AB 5TJXA 4B74A 7ESTE 3S9BA 1EOLA 8ESTE 1GI6A 2QF0A 1BOQA 2VWLA 3DA9B 4BTTB 1W13U 3AW1A 2AEIH 4I33A 1AVXA 1LPKB 2C8ZB 1ABIH 1G36A 4KGAA 1A5GH 4K2YA 1C1SA 2FWWA 1BRUP 1CSOE 1BHXB 4ABHA 4KP0A 5I46H 4TWWA 2P95A 1O3KA 1N6YA 1C5OH 3TU7H 1K21H 2GCTB 3T29A 4NGAH 3TJVA 1O2IA 1J8AA 2ALVA 3M37A 2CF9H 2GV7A 1LO6A 5DPAA 1GMHG 4Y11E 1YC0A 1O3LA 2ZDKA 1P03A 1OYQA 2FI3E 5EXLA 3LC5A 1EB2A 2BQ7B 2R2WU 1MTUA 2CHAB 8GCHF 1OSSA 1W7GH 4WMEA 1F0UA 1C4Y2 4UONA 4E05H 1GBTA 3UNSA 3MU5A 2VU8E 1CHOF 1VZQH 3EDXB 2STAE 3GCTF 1TOMH 4MPXA 1TNLA 1O2QA 4NIVA 4ZH8A 1GPZA 1K1OA 2FMJA 3QLPH 3QO6A 5A2MH 1HJAB 1ZRKA 1O3PB 1P2NA 4X2XA 1SGFG 2OXSA 3RXMA 9ESTA 3ZZ9A 2FLRH 1WYKA 1Y3WA 4XBDA 4VGCB 1P05A 5I25A 1NRPH 3DUXH 4DURA 3SQEE 1C1VH 2SNWA 1QB9A 1VITH 2CN0H 1GVZA 2F9VA 1O2MA 1FY5A 4AN7A 2G4TA 5H4IB 1GHBF 1W7XH 5T6GA 3RC4A 1UJ1A 2ZP0H 3QGNB 1L2EA 2RA0A 1XUJA 2GT7A 2W3IA 3TJNA 1ZYOA 4FVBA 3FAOA 1ANCA 2XWAA 1RTKA 1OP0A 1B0EA 1FUJA 1ZR0A 4I8LA 2QV1A 1NC6A 1NY22 4KTUA 4Y71A 2A2XH 3PLPA 1NRRH 1V6DA 1DX5M 3UTUH 1OP2A 4OS6A 3RXKA 1AKSB 2O8TA 2ZTYA 2F9UA 1GL0E 3ITIA 1ZSKA 2O8WA 1TX8A 1VITG 2W26A 1SR5C 4X1PU 3RXIA 2AMPA 1AN1E 1IAUA 2ZG0H 2B0FA 4ABBA 4OS1A 3U8TH 2BQ6B 3A8AA 3LIWA 2FS8A 1L4DA 2ZFFH 3A84A 3D65E 4A6LA 2BXTH 4AX9H 5A0AE 1GJ7B 2VIQA 3NXPA 1L0ZA 3LPRA 1N8OC 1IQJA 1TRNA 4K1SA 2EI7A 3SU3A 2HOBA 1BB0B 2DUCA 2Q6FA 3ESTA 1A3EH 4FUHA 2BD9A 4FUCA 2Z6BD 1DUEA 2GDDA 3A8BA 1GJDB 1CT2E 2WV4A 1HB0B 2C8WB 3VXEH 3UR6A 3P8FA 1O33A 1CHGA 2RA3A 3A87A 5EOKA 4UFGH 1CVWH 2KAIB 4HFPB 4ZUHA 1N8OB 3LH3A 4MNWA 3TK5A 4IMZA 4X2VA 2VGCC 1KXAA 4RKOB 2TGAA 4WVPE 2OBOA 2IJOB 1NESE 3ZZ5A 1QL7A 1YPJH 1GHAG 1G3CA 5EQRA 2HPQH 2BD3A 5JBTA 3STJA 4BAQB 2XCFA 2JH0D 1OWIA 3CENA 4LXBH 2PKSC 1A0JA 1DS2E 1ZTLA 2FOGA 4BOHA 1FONA 4X6PA 2V35A 1CGHA 2I6QA 3SJOA 1OP8A 2UUKB 3PMJA 3TNTA 3BTKE 1MQ5A 2C90B 1PPHE 3GY6A 4X2WA 1KLIH 2NU2E 3T25A 3MU0A 1ACBE 1AFQB 1LHGH 4TY7A 5EODA 2Z9GA 2G8TA 1SQAA 5SGAE 5LGOA 3M35A 3SV6A 1YPMH 5F6MA 2RG3A 2ZU3A 2SGDE 2XTTB 1O2OA 4Y0YE 1HLTH 2PTNA 5AHGH 2BDGA 1KDQB 1THSH 1TALA 3ZZ3A 4INLA 1IQHA 1JOUB 3LJJA 1P3CA 1EAUA 1O39A 1A5HA 3SNAA 2PGQB 1OWEA 2PTCE 5ABWA 4WXIA 1G2LA 2VGCB 1O36A 3EE0B 1FQ3A 1C1WH 1P57B 1PYTC 1Y59T 4BAHB 1TGTA 2VVUA 3SNEA 5EU8A 8KME2 1CA0B 1TE0A 2WPIS 5FPYA 1MKWH 3GY4A 1SVPA 3RXTA 3UQOA 1BIOA 4JZFH 1S6FA 3D23A 3RXBA 1GMCF 1ZSJA 1EZQA 3OYPA 4CRCA 2ZHQH 2GDEH 1E0FD 3RXQA 1KXCA 3TLOA 1SGYE 1J16A 1O2LA 1F5LA 3E91A 1PPBH 2GZ7A 1ANBA 1O3OA 2C93B 2VH0A 1SGQE 2ZFQH 2HGTH 2GP9B 4Z6AH 1GWAA 1O3EA 1QNJA 2PV9B 1NU7B 1P2KA 3ATIA 1GI1A 4BANB 1GI5A 4I8GA 3ZVGA 1MQ6A 4H6TA 4NWLA 3SN8A 1C5QA 1UK3A 2JKHA 2V3OH 4FVDA 1TA2A 1S83A 4GHQA 3VXFH 1CU1A 1CGJE 3LC3A 2ZDLA 2UUYA 1J14A 1ETTH 1ZHPA 4A1VA 2P3UB 1EX3A 4Q7XA 2J2UA 4Y8ZA 2A4GA 3GY5A 3LGYA 3E90B 1Y3XA 4ISIH 2HNTC 2Z3DA 3ZZ6A 5CHAB 5LPEA 1NZQH 4AFUA 3LGVA 2HALA 2OBQA 3S0NA 3SUGA 1EJMA 2YOLA 4U32A 4GCHF 4ZKSU 1O2RA 1HGTH 2VWOA 3MI4A 5LH8A 1AZZA 5DP4A 3ZVDA 1FPHH 2BY8X 4LZ4B 2W5EA 1SGRE 1UHBB 1OS8A 4I8KA 1SLXB 1LQDB 3F1SB 1O30A 1HAOH 2GZ9A 4AYVB 1SGNE 4FU8A 2AMDA 1C2EA 4CRGA 3KQDA 1AB9C 1TMTH 5T6DA 2F9PA 4ABEA 5IYTA 4RN6A 1QJ6B 4ZKNU 1GDUA 2FM2A 1SGPE 2NU1E 3LDXH 3ATMA 5A8ZA 2WINI 2Y5GA 2A4QA 1SLWB 4AOQA 4B75A 3GDSA 1TMBH 3S7HB 3ZZBA 4FXGH 3LGUA 3T27A 2DE9A 1C4V2 4Z0KA 1O3AA 1W12U 1DICA 1JMOH 1O34A 3LU9B 5L30H 1F0SA 4YLUA 1P8VC 1C2JA 2A2QH 1K1LA 3GY2A 3UOUA 2SGPE 4K5ZA 2B5TB 3NZIA 4ABDA 6GCHF 2PKAA 5FPSA 1GGDB 1EJNA 2JETB 1O5EH 4OGYA 4AYYB 1RIWC 1GBKA 1S82A 1CT0E 2B7DH 3MU8A 3Q3YA 3V13A 2Y80A 3DT0H 2UWLA 3VB3A 4XDEA 1KTTB 5DP3A 1WQVH 1P9SA 2W3KA 1QJ1B 2F9OA 2GZ8A 5B6OA 2H9HA 3NUMA 2H2ZA 2TBSA 3MH5A 4ZAEA 3RMMH 2VIDA 1MTSA 1MD7A 1K28D 1RS0A 3RXJA 1TIOA 1H4WA 1MH0A 3A83A 4IN2A 4NFFA 1PQAA 2PWXA 3P92A 4UFEH 1ZTJA 1Z8RA 3PTNA 1MZAA 1C5LH 3RXOA 2ILNA 1XX9A 1ARCA 4JZEH 2FTMA 1D3PB 1KLJH 3T5FH 1GI3A 2OC1A 5JDUB 1VCQA 1CT4E 3MNXA 3URDA 1CA8B 3F9HA 2A5IA 1YYY1 1J9CH 1ELEE 2AIQA 1O2JA 1UK2A 1AE8H 5DP5A 4M7GA 5DG6A 3AAVA 4BNRA 1QFKH 1GI7B 1JRTA 5A09A 1TGCA 1QBVH 9LPRA 1TBZH 1XXFA 2ZFPH 1EAXA 3OY5U 1EATA 1O37A 1GMCG 1RTLA 3BTHE 2Y6TA 1ARBA 1EUFA 1SBWA 1GDNA 1VCWA 2FPZA 4NSYA 1P11E 1ZPCA 3SU6A 1V2PT 1IOEA 2WYJA 1F7ZA 3ELAH 1Y3UA 3NWUA 1SGDE 3SUFA 6GCHG 4WWYA 2GV6A 3RXSA 2ZHFH 3RDZA 5FX5A 4KTSA 4NSVA 1MCVA 2O8MA 4I31A 3MH6A 6CHAB 1HFDA 4O97A 4CBNA 3U8RH 3GY3A 1NTPA 3M7QA 1UCYH 2GTBA 1C9TA 2PSXA 1ELDE 1TQ0B 1V2MT 3RU4T 1TNKA 3QX5H 1D9IA 2RDLA 4YM9A 1ELCA 5E0JA 2XXLA 3A80A 2FDAA 4CBOA 5ESBA 1V2QT 4X1NU 1THRH 4J2YB 3BEIB 4INKA 3PLKA 1D3DB 4CHAB 1AVWA 1PQ7A 1C5TA 2FIRH 2ZZUH 3M3VA 5EXMA 4ESTE 1HJ9A 1BITA 1SL3A 2OTVA 1GBJA 1T8MA 3SI4H 3HK6B 2STBE 4XOJA 4MNXA 4JYTA 1SSXA 3FP6E 1FN6A 2ODPA 3FZZA 1ZMNA 5FCKA 5E8EH 1O2NA 1K2I1 4O3TA 3E16B 3A82A 5A0BA 3TJOA 5EQSA 2FO9A 2F83A 3A8CA 1A5IA 1XVMA 2FOMB 1TGNA 3PO1C 1TPAE 1KXBA 2Z7FE 2FLBH 1WTGH 1GCTB 1YCPK 3QWCH 4NCYA 5C67A 3K6ZA 3M61U 4JCNA 1BJUA 2XCNA 1FNIA 1NROH 1SHYA 2P93A 2Z3EA 1XUGA 3M5LA 2ZDMA 3EA8A 1T4VH 1V2VT 1O3MA 1ZPBA 3M3TA 1FIZA 2QIQA 1WOFA 1OWDA 3AAUA 2ZEBA 6LPRA 3LGTA 1WUNH 3HATH 1AU8A 3TH2H 2P94A 1YPLH 4E7NA 1O3GA 1H8IH 2QF3A 3TGIE 2OCVB 1Y8TA 4INHA 3SI3H 3RXLA 1QIXB 1GBLA 1ZMLA 4K8BA 1YLCA 2VIVA 3ZZ4A 1NFYA 2QXJA 1THPB 3QK1A 1P06A 1WQSA 1DITH 1MTVA 2BHGA 4ISNA 2CHAC 1XUIA 1A4WH 3MH7A 1XXDA 2GX4A 3EA7A 3RXCA 4X1QU 5JBCS 2ODQA 1YKTA 1FV9A 3FP8E 3SHAH 1VITF 1LVBA 3RXPA 5AFYH 3SJKA 1AIXH 4DJZB 2ZGBH 2VVCA 3E0PB 3O8BA 3VB7A 4D8NA 1M9UA 4AB8A 2Y7ZA 1D3QB 2G81E 2IN2A 5DKMA 3P17H 4BTIB 4CRDA 1BTZA 2PKAB 5C1YA 1F5RA 1ELGA 2P16A 2VWNA 2EI6A 1G3DA 1ZJKA 1DWDH 4AG1A 2XBXA 2Z3CA 1NU9A 2ANKH 2ZDNA 1O2XA 4PROA 1BTYA 1AUTC 1YCPM 4ABIA 3RLYH 1EPTB 1GJ9B 1LKBA 4BAKB 3DFJA 3NPSA 2AMQA 5E0GA 1FY4A 3DFLA 1HIAA 2VIOA 3B9FH 3MMGA 1RRKA 4D7GA 1O3HA 4JZ1A 4DW2U 1C5WB 3KGPA 2AS9A 1QRXA 4I32A 4WMFA 2V0BA 4WJG2 2PLXA 1Q3XA 4MTBA 3T2NA 1DPOA 2XC0A 1FAKH 1ELBA 3SBKA 4JZDH 2J94A 1MUEB 4NZLA 1GJCB 4IMQA 4XE4A 1TNIA 1PPGE 1KXFA 3H5CB 3MNCA 4GPGA 1Y5BT 1C1UH 3QTOH 5AFZH 1O3JA 2BDYA 4FUFA 1WU1A 5ESTE 3RXHA 1MAYA 3AW0A 4MVNA 3H7TA 2XWBI 1W0YH 1EZUC 2SGAA 1YPHC 4Y10E 2AGIX 4Q7ZA 3GDUA 3UOPA 5DK1A 1NRNH 4GLYA 1XUHA 3OY6U 3RC6A 2AGEX 2WPMS 2ZU5A 1FMGA 3RM0H 4K69A 4YTAA 1W3CA 2FOCA 4SGAE 4X8VH 2WPKS 1BTWA 1O2HA 3MO6A 3RXAA 4SGBE 1Q2WA 1YLDA 3SNCA 4NIYA 3HPTB 1GG6C 4BAOB 3Q00A 1O3DA 4ABJA 1MTNC 4Y8YA 3GYMA 2QC2A 4YO9A 3FFGA 1QJ7B 4TWYA 1SOTA 1BTHH 2FI4E 1C5RA 2Q1JA 3O8CA 2W7UA 1HAIH 1ZLRA 2CGAA 2Z9LA 4BXWA 4WXVA 1V2UT 3V12A 1TPOA 1O2PA 2FOEA 1GBBA 1E36B 1DLEA 4UFDH 5FCRA 1W2KH 3TGJE 1AWFH 1HUTH 2Z9KA 2ZO3H 3D62A 3O8DA 1ABJH 2BY9X 2PW8H 2P8OC 1HXFH 4H6SB 3ZV8A 3U69H 1HAPH 2ZF0H 1HCGA 2YNBA 1BMAA 2XBVA 4FUBA 5T6FA 3C27B 3PROA 1QHRB 5EW2H 3Q77A 4NG9H 3A81A 3BTWE 2ZQ1A 3KCGH 1GJBB 1LHCH 1K22H 1UTJA 5A8YA 3VPKA 2QY0B 1PPFE 1O3IA 4Y0ZE 4U30A 3ZVEA 1BMMH 3T62A 1O2VA 1O2TA 1TPPA 1JIRA 1LCYA 7LPRA 4GAWA 1BMNH 1AZ8A 1RIWB 1MBMA 1O35A 1GGDC 1A46H 2BLWA 3S69A 1UO6A 2UUFB 2BVSH 5EGMA 3EQ0H 2FXRA 1TX7A 1P02A 1ESAA 1XUKA 4TY6A 1PQ8A 3IITA 3QGJA 1UCYK 1V2OT 1HAVA 3PMBB 2HNTE 2BOKA 3W95A 3RU4E 1QB6A 8LPRA 1AMHA 2PGBB 1AWHB 1GI2A 4YLQH 1DOJA 1C2MA 3TJUA 1MKWK 2A4OA 3A88A 1HJAC 1TRYA 2BQWB 3M7TA 2P3FH 2PFEA 1V2LT 4HZHA 5GWZA 1NM6A 1BT7A 1SG8B 1ORFA 5F8ZA 3SNBA 2BLOA 4B73A 2TRMA 1C2FA 2YNAA 3M36A 1C5NH 1BA8B 1TYNA 4MPUA 8GCHG 2ZGHA 2A7JA 1FLEE 1JIMA 2XBWA 1EP6A 1CA0C 1D4PB 4Y6DA 3SORA 3P8OA 1KSNA 4B71A 2J92A 2P59A 2JH5D 3BTEE 3K6YA 2GT8A 1C2GA 1C4U2 1GMHF 1O5DH 2H6MA 4K3JA 1C5PA 4E06H 1FPCH 4JYUH 1G2MA 1MBQA 1GBHA 3BV9B 3I77A 5JYIA 5FX6A 1O3FA 1Z1IA 5EG4A 5G4BA 4IC5A 4YZUA 2Z9IA 1GI8B 2VJ1A 3OU0A 2AGGX 2QN5T 3GY8A 1O3NA 5EW1H 2WUCA 1TGSZ 1P01A 2OQ5A 2FYQA 4F49A 1U6QA 4ISLA 1DSUA 1X7AC 1KLTA 1QBOA 4OS4A 2XNIA 2QXGA 4YESB 1MZDA 3P8NA 1LMWB 4E7RG 1O2ZA 1V2WT 3K65B 1P2OA 3RU4D 3ZV9A 4O3UA 3URCA 1C2IA 4DG4A 3VFEA 2ZKSA 2LNCA 3I78A 3IG6B 1TLDA 1XUFA 4I8JA 1HAZB 1FXYA 1W0ZU 1ZPZA 2H5DA 2ULLA 5L2YH 2ZI2H 2SGEE 1EAIA 1SC8U 3BTFE 3KIDU 2BZAA 3TPIZ 4DIIH 1EPTC 3LKWA 3ZZDA 4TPIZ 4ASHA 4YOGA 1XVOA 1T32A 4J1YA 5FHTA 1ZTKA 4X6NA 1RFNA 1QRZA 5EPNA 1DE7H 1UK4A 1ZRBA 3HGPA 1F0RA 1BRCE 3PTBA 4A7IB 1L1NA 5C1UA 4ABFA 4YT6H 2B9LA 1O0DH 1NRSH 3LGWA 4FU7A 3QN7A 4AFZA 1TNHA 1UCYE 1LPZB 3F9FA 3TITA 1KYNA 1S81A 2G5VA 5A8XA 4XBBA 5DP7A 3BTTE 1OKXA 1EJAA 1XM1A 2W7SA 2HRVA 1F5KU 3ZVFA 4NWKA 1K1JA 5DP9A 1S85A 1UTPA 1BUIA 3Q3XA 2BB4A 1H9IE 2ZCLP 3M5OA 1WV7H 5EXNA 1AI8H 2ZC9H 4NA8A 5GCHG 4UDWH 1C2HA 2EC9H 3HKIB 4MLFB 1E34B 1Y3VA 1JRSA 2ZTXA 2K1QA 5GPIB 1ZGIA 1K1MA 1ESBA 1AUJA 2WPHS 1S0RA 1AB9B 2VH6A 1ETSH 1HV7A 2ZECA 2ZPRA 4DOQA 3MOCA 4B2BA 1J15A 4A1XA 1EKBB 3Q76A 5FPTA 3MNSA 1TBQH 1L4ZA 5FBEA 3A8DA 1NFWA 5C1XA 2D8WA 1NO9H 1CBWC 3DHKH 3F6UH 4DIHH 1DT2A 2ZTZA 2A32A 2BY6X 1OXGA 2C3SA 4YOJA 1PPCE 4MNVA 5T3HA 2ZHEH 1P04A 3ENSB 3SHCH 3QUMP 3GCOA 1P12E 4IBLH 1UVTH 3A7WA 1T31A 4NIWA 2J34A 3SV7A 3SGQE 4X8SH 3MTYA 1UTNA 3UPEA 2OQUA 3V7TA 1TAWA 2XC5A 2Z94A 1BJVA 1DWBH 4O03A 5IDKA 1BZXE 4BXSA 2AERH 4A1TA 4QT8C 2A0QB 1Z71A 1GHYH 4KKDA 1JXPA 4UE7H 1LVMA 1TMUH 2XYAA 1YPEH 1C2LA 3SV2H 6CHAC 1NS3A 2FOAA 4CR9A 2GCHG 4GUXA 3W94A 3UY9A 1AVGH 1GBIA 4ZXXH 5FAHA 2WUBA 1YM0A 1ANEA 1MAXA 5DGJA 1LHEH 2R0LA 1H9LB 1RJXB 1O2SA 3GY7A 2G51A 2TGDA 2ZHDA 2BX4A 4AGKA 2JH6D 1C5XB 3JZ2B 1P3EA 2H5CA 3GCHB 1ZOMA 1GBEA 1AY6H 1TPSA 3UQVA 2M5TA 2CF8H 4AFSA 3QDZB 1JWTA 3BG8A 3SOSA 3U1IB 4XSKU 1TNGA 3WY8A 1QQ4A 1Z8GA 5K7RA 4CH8B 3LH1A 1W11U 4HI3A 3VGCB 1DSTA 2OINA 4Q2KA 1GJ6A 3F9EA 2WPJS 1OPHB 4I7YH 1DWCH 4WF8A 2BLQA 3RC5A 2UUJB 2NU3E 4D9RA 1IQKA 1C5SA 1QQUA 2P3TB 3S7KB 2H9EH 4JZIA 1ZSLA 1MU8B 4OS5A 1HJ8A 1H8DH 3M3SA 4JYVH 2BVXH 2THFB 2SGQE 2ZIQH 1ZMJA 1ZJDA 2O8LA 5L2ZH 3KQBA 4GSOA 4OS7A 4X6OA 1SGTA 3MU1A 1LQEA 3A7VA 2Q6DA 1ELVA 3GYLB 2B8OH 1G37A 1D6WA 1K1PA 1O32A 3A86A 2PUQH 5C20A 1HIAB 3TGKE 3UFAA 1OWJA 3M5NA 1V2ST 2XW9A 1CGIE 3VGCC 1A61H 1EPTA 4AGJA 1O2KA 1HAVB 1L1JA 1G3EA 1TOCB 3FVFB 3UREA 3SUDA
chains in the Genus database with same CATH superfamily
5TCAA 1INCA 1YGCH 3GICB 5F8XA 1K0HA 4NA9H 2G00A 1SI5H 1QR3E 1ZHRA 2VVVA 3OTJE 1PPEE 2VIWA 1C1QA 1EXFA 1T8NA 1O2UA 4UD9H 1EZSC 2QF5A 4Y79A 3OSYA 2FEQH 1O31A 2F3CE 1QL9A 3MNBA 4ISHH 1SMFE 4X1RU 3RMLH 4ZMAH 1P09A 2ASUB 2D2DA 3BTGE 5F8TA 3H7OA 4ZROA 3SU1A 4B76A 3T28A 5HGGA 2GJGA 7GCHG 1DUAA 3L6PA 1AFQC 1SLUB 1P9UA 2NWNA 3A7ZA 1P10A 2A45B 3BIVH 5BPEA 2F9NA 4B1TA 1C2KA 1SGCA 2ZGXH 3KYFA 1UVUH 4MPWA 5E0HA 1ID5H 5HM2A 1ELAA 1IQLA 1HDTH 3MFJA 2F91A 4U01A 1C5YB 2Q6GA 1Z6JH 1LHDH 1TNJA 5F53A 3SV8A 1W0KD 1NFXA 2ZPQA 2Y5HA 3ODFA 1AHTH 1IQGA 1K9OE 1T8LA 2BLVA 2D26C 2IOTA 3M5MA 2HLCA 2QA9E 1FZZA 2UWPA 1BBRE 4IN1A 3V3MA 2QYIA 1GJAB 4GHTA 3GOVB 1PYTD 2GKVE 3ATLA 1GCTC 1FI8A 1GBFA 3OFND 2FESH 3WWBA 2ESTE 3SZNA 1RTFB 3MO3A 1QY6A 4AG2A 2BZ6H 5DN6D 3A85A 3KNXA 3E1XB 1DXPA 1WCZA 3TNSA 1DFPA 1Y3YA 1CQQA 3IWMA 4K60A 1GVKB 1H9HE 5PTPA 5C5NA 5EJ1A 3BSQA 5BRRE 2CMYA 2GCTC 1PPZA 2SNVA 1XKAC 1GHZA 5CE1A 1TGBA 1B7XB 1C5UA 1FIWA 1S0QA 1O5CB 2JJ2D 2G5NA 2ZFSA 1FY3A 1J17T 3CS7A 4NFEA 4UEHH 2OC8A 1H8HD 2DE8A 2NU4E 3E6PH 3JZ1B 1SPJA 2GD4B 2GMTB 2H1UA 1YBWA 3TIUA 5JPMH 1BBRH 1YLNA 4DVAU 4Y7BA 1OYTH 3BN9A 4MDSA 4A92A 1SFQB 3VB6A 1XKBC 2YMSD 1G3BA 1VR1H 2LPRA 3P6ZB 3VB4A 3O8RA 2TIOA 3HGNA 4O9VA 5DJ7A 2C8YB 2JETC 1UMAH 2PUXB 2HVXA 1UHBA 1GJ4H 3GISB 2ALPA 2ZNKH 1EAWA 4MG3A 1VGCB 3AVZA 1PFXC 4IW4E 3RXVA 2A4RA 2BD4A 2FOFA 2BDAA 2J95A 2GVFA 3ZZCA 3RP2A 2FX4A 1LDTT 4R0IA 1HPGA 3RMNH 5HYOA 3SUEA 1P0SH 3LOXA 3ZVCA 2BDBA 1AO5A 2YMSC 4CH2B 5C0UA 3R3GB 4CRBA 2Z9JA 3A7XA 2RCEA 1DLKB 1DM4B 1MTWA 1GBDA 2ZDVH 2ZPSA 3KL6A 1GMDG 3ZZ7A 2QGRA 3LJOA 1IQFA 1MCTA 4HGCA 4IGDA 5F03A 4Y8XA 2FYRA 2ZU2A 2BMGB 1MKXH 4MNYA 3NKKA 4Q7YA 2WHXA 1H8ED 1SGEE 5CDFE 2ZWLH 1VGCC 4LK4A 3KF2A 3PV4A 2VINA 4VGCC 5GJ4B 5EJZA 2C8XB 3PWBA 1QB1A 5FBIA 2ZU4A 3PMAB 2A1DB 4Q80A 1EQ9A 2BVRH 1GMDF 1LKAA 1SGFA 3BEFB 4UFFH 1O3BA 1SFIA 1ZZZA 2V3MA 3P70B 3T26A 3U1JB 1GBCA 1YPGH 4ZHMU 5TCCA 1RD3B 1MMJN 2ZHWH 1QA0A 1BRAA 2ZGJA 5HXFA 3UR9A 4THNH 4WH8A 3P8GA 3CP7A 3SW2B 2EA3A 5JBAS 4ISOA 1LHFH 3D49H 3U98H 4LZ1H 1C5MD 1Q31A 1P2IA 1XMNB 4DY7B 1V2NT 5AVDA 2QE7D 1MABB 4XBCA 3Q3KA 1GBMA 1O5GH 1CE5A 3RXGA 3SJIA 3F2FA 1T4UH 1IQMA 2XC4A 1QBNA 3PMHB 3MU4A 2FX6A 2SGFE 2C4FH 3MHWU 3FKSD 1KXDA 2V3HH 4RKJB 1KDQA 2QF4A 4Q63A 4I8HA 1ELFA 4RSPA 4KELA 2M2AA 1TONA 1GVLA 1GI4A 2I6SA 3R0FA 5CHAC 1GL1A 1DWEH 2J9NA 4OS2A 3ZZAA 1YF4A 2J98B 2OD3B 2ZDAH 1G9IE 1RXPA 3BEUA 1IHTH 4AFQA 4X0WU 3PB1E 3QZRA 4D9QA 5KECA 2ZFRH 2XBYA 3FZDA 1Y5AT 1OWKA 1SLVB 2GGVB 2VNTA 2EQNA 3E3TA 1UTMA 4H42U 3L3TA 3VB5A 1DY8A 1UTOA 3MWIU 4X6MA 1O2WA 1TBRH 3PYHA 2A31A 1WAYB 2PR3A 4MQAA 2WV5A 4Y76A 4XFQA 1FAXA 1GCDA 2ZCKP 1A7SA 4X8TH 1YP9A 4CR5A 1F0TA 2HWLB 4YT7H 2VWMA 2BY7X 1N1LA 1ETRH 3CNRA 3KEEA 1OOKB 5L6NH 4GCHG 2Y82A 1Z8IB 5DP8A 1TX6A 3LGIA 1TB6H 1KTSB 4TT3D 3WWFA 1T7CA 2K0QA 2FS9A 1IHSH 2BTCE 3QZQA 4FUEA 4Y7AA 1LVYA 2KAIA 1BRBE 2BD7A 2R0KA 1DDJA 2ZGCA 2FODA 1MTNB 1QRWA 5GXPA 3VEQB 3ATWA 1PQ5A 3N7EA 1BMFD 1Z7KA 2KCAA 5J4QA 5HM9A 1NN6A 2P8OB 3SNDA 1ESTA 2BDCA 2A7HA 1S84A 3B8JA 3F9GA 3RUOA 3RM2H 1YPHE 2BDIA 2AH4X 4FUJA 3K9XB 4F4OC 1BCUH 1TWXB 2IPHA 2ANYA 1V2TT 2TGTA 3SU2A 7KMEH 2J38A 3SU0A 1F92A 3TH4H 7GCHF 1ELTA 1Z1JA 3LONA 2PSYA 4JK5A 1PJPA 1KY9A 1QGFA 4ABGA 3AASA 4CRAA 3E0NB 4LOYH 2VB0A 1UVPA 3RXUA 1SQOA 2CJIA 5A0CA 4X8UH 5KEDA 2BX3A 2TPIZ 1C1MA 1V2KT 2FTLE 3BIUH 2FOBA 1BQYA 2HNTF 1BTXA 3SJ9A 3UWJH 2FZZA 3P95A 4FUDA 1NBME 1C5VA 1W14U 1DVAH 3DSOA 2CXVA 1UTKA 1LVOA 1G32B 2AYWA 1FJSA 2J5UA 3BTDE 1YPKH 5JB8S 4JMYA 1GG6B 1MU6B 4KTCA 1V2JT 4U2WA 4D76A 2G55A 1SQRA 3S9CA 3EGKH 2G4UA 2QCYA 4ZHAA 4M9FA 4MPVA 1QCPA 5FL7D 1EZXC 3STIA 2R9PA 4AB9A 2OUAA 3F2GA 3GS9A 3UWIA 1QURH 1HAGE 1C1RA 3PO1B 4NIXA 4CREA 2XRCA 1GHVH 1UTLM 2R3UA 3E8LA 3K2UA 3ZYEA 2AFQB 3SGAE 2BM2A 1BDAA 1N6XA 1IQNA 3SGBE 2A7CA 3ZYDA 1A3BH 1GHBG 4RT1A 4WMDA 4X1SU 2R2MB 2JIZD 3BG4B 6ESTA 1T8OA 3EYDA 1C2DA 4OGXA 1QL8A 3GDVA 3RXRA 1E38B 1AFEH 3TVJB 2QXHA 2BY5X 1FY1A 5DO4H 2H9TH 5LPRA 1YCPH 1O5FH 1A0LA 3OX7U 1GHXH 2V6NA 4AZ2B 1P2MA 2O9QA 2J4IA 1TA6A 4P00A 1NFUA 3KN2A 1Z6EA 2OC0A 1D3TB 5FXLA 2A5AA 3RXEA 2SFAA 1C1OA 1NT1A 3GCTG 5LPFA 3UNRA 1CHOG 1P2JA 3DD2H 2HPPH 3NCLA 1IQIA 1GHAF 3GCNA 2KCOA 1W8BH 2Y81A 4ZCNA 1SGIB 5C0TA 4ZXYH 4FUIA 2VIPA 1GBAA 2ZU1A 1F2SE 1S5SA 4XRNA 2TGPZ 1A2CH 1Y5UT 3RXDA 2WYGA 1D6RA 5C2ZA 2F9BH 2ZQ2A 1KXEA 2CV3A 2HLDD 1O38A 1EB1H 1L1GA 3HK3B 3FANA 3LT3A 1BBRK 1HRTH 5K0HA 1ANDA 3MH4A 3A89A 1A1RA 1GI9B 3V0XA 4IC6A 3S9AA 3B23B 4TYDA 4ZKRU 2A5KA 5C3NA 4BTUB 2BD2A 4B2CA 3ZZ8A 5E2PA 1SQTA 2Y5FA 1LTOA 1E37B 1WBGB 1TABE 1DANH 3A7YA 3HKJB 2GCHF 4K1TA 4A5TS 1GDQA 5JB9S 1DY9A 1GJ5H 3A7TA 1AD8H 1NRQH 1QA7A 1P2QA 1UVSH 2ZA5A 3MYWA 1V3XA 4AORA 2NU0E 1DXWA 2WV9A 1VJAU 1GI0A 2G52A 2LP6A 4FETA 3SQHE 1TQ7B 4WH6A 2BD5A 1O5BB 1AKSA 4FU9A 1UTQA 1V2RT 1VCPA 4CHAC 5CMXH 4ACBA 5GIBA 4GVUA 4K8YA 3UIRA 3ZIAD 1CBWB 4B2AA 1WTHD 5EPYA 3ZVBA 4D7FA 1O2GH 1TRMA 1HXEH 3G01A 3N99A 3RXFA 4DT7B 3SJ8A 3KHVA 5C17A 3BG4C 2OLGA 5HKKD 1VJ9U 2O8UA 3ATKA 2BYAX 3MO9A 1NBMD 2FP7B 1BTPA 1QTFA 1MKXK 1HAYB 3TK9A 2WPDD 1B5GH 1FN8A 1H1BA 3BTME 3RLWH 5AF9H 3SU4A 2ANMH 2PHBA 4ASUD 1BMLA 2ZCHP 5JBBS 3GCHC 3PLBA 1HAXB 1K1IA 3SU5A 4BAMB 3CS0A 5EQQA 1LPGB 3PM3A 1SOZA 1O2YA 3PWCA 4CRFA 4FUGA 1JBUH 4ZKOU 1HBTH 1OWHA 2BD8A 4YOIA 1EP5A 2GMTC 2KZ4A 1NPMA 1G30B 5GCHF 2BOHB 3NK8A 1TFXA 1BTUA 2D1JA 3NRLA 4NZQA 5ETXA 3U8OH 3EA9A 5J4SA 4IS5A 4DGJA 2Y7XA 1AGJA 5EIYA 5C5OA 3KQEA 1GHWH 3DSPA 4H4FA 3C1KA 1FDPA 1IQEA 4JK6A 3UUZA 1E35B 5E2OA 4WY3A 4R8TB 2WPLS 1GJ8B 2UWOA 3SV9A 2AIPA 4ZHLU 1EOJA 3ODDA 3SO3A 3TK6A 1AE5A 3M7UA 1UVOA 1C9PA 1SHHB 1KIGH 2ANWA 3RMOH 1HYLA 2QXIA 4ABAA 3I29A 2OP9A 1A0HB 2BXUH 1C1NA 1SB1H 2ZFTA 1MD8A 1C5ZB 1B0FA 1FY8E 5HMAA 2BDHA 4NA7A 1HNEE 1O3CA 4HTCH 3F68H 3BF6H 2JJ1D 4DT4A 1ZGVA 1HAHH 2OC7A 4X2YA 1K1NA 2QAAA 3L33A 4K1EA 3EAJA 3UNQA 2J97A 3FP7E 1ZHMA 1BHXF 3BTQE 5GDSH 1AQ7A 2EI8A 3TH3H 1OX1A 2R3YA 3KQCA 1Z8JB 1EASA 5DP6A 4YXWD 3ZVAA 2FI5E 4DCDA 2FOHA 1C1PA 3N7OA 2EEKA 1W10U 1S6HA 1WSSH 1CO7E 1C1TA 2PKSB 1RGQA 4TPYA 3PV5A 2ODYB 3QTVH 3U9AH 1O5AB 5TJXA 4B74A 7ESTE 3S9BA 1EOLA 8ESTE 1GI6A 2QF0A 1BOQA 2VWLA 3DA9B 4BTTB 1W13U 3AW1A 2AEIH 4I33A 1AVXA 1LPKB 2C8ZB 1ABIH 1G36A 4KGAA 1A5GH 4K2YA 4TSFD 1C1SA 2FWWA 1BRUP 1CSOE 1BHXB 4ABHA 4KP0A 5I46H 4TWWA 2P95A 1O3KA 1N6YA 1C5OH 3KQ5A 3TU7H 1K21H 2GCTB 3T29A 4NGAH 3TJVA 1O2IA 1J8AA 2ALVA 3M37A 2CF9H 2GV7A 1LO6A 5DPAA 1GMHG 4Y11E 1YC0A 3OEED 1O3LA 2ZDKA 1P03A 1OYQA 2FI3E 5EXLA 3LC5A 1EB2A 3OE7D 2BQ7B 2R2WU 1MTUA 2CHAB 8GCHF 2IPQX 1OSSA 1W7GH 4WMEA 4F55A 1F0UA 1C4Y2 2L74A 5T1VA 4UONA 4E05H 1GBTA 3UNSA 3MU5A 2VU8E 1CHOF 1VZQH 3EDXB 2STAE 3GCTF 1TOMH 4MPXA 1TNLA 1O2QA 4NIVA 4ZH8A 1GPZA 1K1OA 2FMJA 3QLPH 3QO6A 5A2MH 1HJAB 1ZRKA 1O3PB 1P2NA 4X2XA 1SGFG 2OXSA 3RXMA 9ESTA 3ZZ9A 2FLRH 1WYKA 1Y3WA 4XBDA 4VGCB 1P05A 5I25A 5KGOA 4AC9A 1NRPH 3DUXH 4DURA 3SQEE 1C1VH 2SNWA 1QB9A 1VITH 2CN0H 1GVZA 2F9VA 1O2MA 1FY5A 3F2HA 4AN7A 2G4TA 5H4IB 1GHBF 1W7XH 5T6GA 3RC4A 1UJ1A 2ZP0H 3QGNB 1L2EA 2RA0A 1XUJA 2GT7A 2W3IA 3TJNA 3OAAD 1ZYOA 4FVBA 3FAOA 1ANCA 2XWAA 1RTKA 1OP0A 1B0EA 1FUJA 1ZR0A 4I8LA 3DSGA 2QV1A 1NC6A 1NY22 4KTUA 4Y71A 2A2XH 2K8IA 3PLPA 1NRRH 1V6DA 1DX5M 3UTUH 1OP2A 4OS6A 3RXKA 1AKSB 2O8TA 2ZTYA 2F9UA 1GL0E 3ITIA 1ZSKA 2O8WA 1TX8A 1VITG 2W26A 1SR5C 4X1PU 3RXIA 2AMPA 1AN1E 1IAUA 2KCPA 2ZG0H 2B0FA 4ABBA 4OS1A 3U8TH 3PRBA 2BQ6B 3A8AA 2W6JD 2FS8A 1L4DA 2ZFFH 3LIWA 3A84A 3D65E 4A6LA 2BXTH 4AX9H 5A0AE 1GJ7B 2VIQA 3NXPA 1L0ZA 3LPRA 1N8OC 1IQJA 1TRNA 4K1SA 2EI7A 3SU3A 2HOBA 1BB0B 2DUCA 2Q6FA 3ESTA 1A3EH 4FUHA 2BD9A 4FUCA 2Z6BD 1DUEA 2GDDA 3A8BA 1GJDB 1CT2E 2WV4A 1HB0B 2C8WB 3VXEH 4P02A 3UR6A 3P8FA 1O33A 1CHGA 1YY3A 5HIYA 2RA3A 3A87A 5EOKA 4UFGH 1CVWH 2KAIB 4HFPB 4ZUHA 3WW7A 1N8OB 3LH3A 4MNWA 3TK5A 4IMZA 4X2VA 2VGCC 1KXAA 4RKOB 2TGAA 4WVPE 2OBOA 2IJOB 2HVYB 1NESE 3ZZ5A 1QL7A 1YPJH 1GHAG 3N7DA 1G3CA 5EQRA 2HPQH 2BD3A 5JBTA 3STJA 4BAQB 2JH0D 2XCFA 1OWIA 3CENA 4LXBH 2PKSC 1A0JA 1DS2E 1ZTLA 2FOGA 4BOHA 1FONA 4X6PA 2V35A 1CGHA 2I6QA 3SJOA 1OP8A 2UUKB 3PMJA 3TNTA 3BTKE 1MQ5A 2C90B 1PPHE 3GY6A 4X2WA 1KLIH 2NU2E 3T25A 3MU0A 1ACBE 1AFQB 1LHGH 4TY7A 5EODA 2Z9GA 2G8TA 1SQAA 5SGAE 5LGOA 3M35A 3SV6A 1YPMH 5F6MA 2YMSB 2RG3A 2ZU3A 1WDIA 2SGDE 1O2OA 2XTTB 3KYGA 4Y0YE 1HLTH 2PTNA 5AHGH 2BDGA 1KDQB 1THSH 1TALA 3ZZ3A 4INLA 1IQHA 1JOUB 3LJJA 1P3CA 1EAUA 1O39A 1A5HA 3SNAA 2PGQB 1OWEA 2PTCE 5ABWA 4WXIA 1G2LA 2VGCB 1O36A 3EE0B 1FQ3A 1C1WH 1P57B 1PYTC 1Y59T 4BAHB 1TGTA 2VVUA 3H09A 3SNEA 5EU8A 8KME2 1CA0B 1TE0A 2WPIS 5FPYA 1MKWH 3GY4A 1SVPA 3RXTA 3UQOA 1BIOA 4JZFH 1S6FA 3D23A 3RXBA 1GMCF 5C94A 1ZSJA 1EZQA 3OYPA 4CRCA 2ZHQH 2GDEH 1E0FD 3RXQA 1KXCA 3TLOA 1SGYE 1J16A 1O2LA 1F5LA 3E91A 1PPBH 2GZ7A 1ANBA 1O3OA 2C93B 2VH0A 1SGQE 2ZFQH 2HGTH 1W0JD 2GP9B 4Z6AH 1GWAA 1O3EA 1QNJA 2PV9B 1NU7B 1EFRD 2KX4A 1P2KA 3ATIA 1GI1A 4BANB 4B6EA 1GI5A 2KM0A 4I8GA 3ZVGA 1MQ6A 4H6TA 4NWLA 3SN8A 1C5QA 1UK3A 2JKHA 2V3OH 4FVDA 1TA2A 1S83A 4GHQA 3VXFH 1CU1A 1CGJE 3LC3A 2ZDLA 2UUYA 1J14A 1ETTH 1ZHPA 4A1VA 2P3UB 1EX3A 4Q7XA 2J2UA 4Y8ZA 2A4GA 3GY5A 3LGYA 3E90B 1Y3XA 4ISIH 2HNTC 2W6ID 2Z3DA 3ZZ6A 5CHAB 5LPEA 2XOKD 1NZQH 4AFUA 3LGVA 2HALA 2OBQA 3S0NA 3SUGA 1EJMA 2YOLA 4U32A 4GCHF 4ZKSU 1O2RA 1HGTH 2VWOA 3MI4A 5LH8A 1AZZA 2F4LA 5DP4A 3ZVDA 1FPHH 2BY8X 4LZ4B 2W5EA 1SGRE 1UHBB 1OS8A 4I8KA 1SLXB 1LQDB 3F1SB 1O30A 1HAOH 2GZ9A 4AYVB 1SGNE 4FU8A 2AMDA 1C2EA 4CRGA 3KQDA 1AB9C 1TMTH 5T6DA 5CHBA 2F9PA 4ABEA 5IYTA 4RN6A 1QJ6B 4ZKNU 1GDUA 2FM2A 1SGPE 4F48B 2NU1E 3LDXH 3ATMA 5A8ZA 2WINI 2Y5GA 2A4QA 1E79D 1SLWB 4AOQA 4B75A 3GDSA 1TMBH 3S7HB 3ZZBA 4FXGH 3LGUA 3T27A 2DE9A 1C4V2 4Z0KA 1O3AA 2PP6A 1W12U 1DICA 1JMOH 1O34A 3LU9B 5L30H 1F0SA 4YLUA 1P8VC 1C2JA 2A2QH 1K1LA 3GY2A 3UOUA 1E1RD 2SGPE 4K5ZA 2B5TB 3NZIA 4ABDA 6GCHF 2PKAA 5FPSA 1GGDB 1EJNA 2JETB 1O5EH 4OGYA 4AYYB 1RIWC 1GBKA 1S82A 1CT0E 2B7DH 3MU8A 3Q3YA 3V13A 2Y80A 3DT0H 2UWLA 3VB3A 4XDEA 1KTTB 5DP3A 1WQVH 1P9SA 2F43B 2W3KA 1QJ1B 2F9OA 1FX0B 2GZ8A 5B6OA 2H9HA 3NUMA 2H2ZA 2TBSA 3MH5A 4ZAEA 3RMMH 2VIDA 1MTSA 1MD7A 1K28D 1RS0A 3RXJA 1TIOA 1H4WA 1MH0A 3A83A 4IN2A 4NFFA 1PQAA 2PWXA 3P92A 4UFEH 1ZTJA 1Z8RA 3PTNA 1MZAA 1C5LH 3RXOA 2ILNA 1XX9A 4Q4LA 1ARCA 4JZEH 2FTMA 1D3PB 1KLJH 3T5FH 1GI3A 2OC1A 5JDUB 1VCQA 1CT4E 3MNXA 3URDA 1CA8B 3F9HA 2A5IA 1YYY1 1J9CH 1ELEE 2AIQA 1O2JA 1UK2A 1AE8H 5DP5A 4XD7D 4OM9A 4M7GA 5DG6A 3AAVA 4BNRA 1QFKH 1GI7B 1JRTA 5A09A 1TGCA 1QBVH 3W1EA 9LPRA 1TBZH 1XXFA 2ZFPH 1EAXA 3OY5U 1EATA 1O37A 1GMCG 1RTLA 5GNDA 3BTHE 2Y6TA 1ARBA 1EUFA 1SBWA 1GDNA 1VCWA 2FPZA 4NSYA 1P11E 1ZPCA 3SU6A 1V2PT 1IOEA 1F7ZA 2WYJA 3ELAH 1Y3UA 2KFWA 3NWUA 1SGDE 3SUFA 6GCHG 4WWYA 2GV6A 3RXSA 2ZHFH 3RDZA 1WXRA 5FX5A 4KTSA 4NSVA 1MCVA 2O8MA 4I31A 3MH6A 6CHAB 1HFDA 4O97A 4CBNA 3U8RH 3GY3A 1NTPA 3M7QA 1UCYH 2GTBA 1C9TA 2XNDD 2PSXA 1ELDE 1TQ0B 1V2MT 3RU4T 1TNKA 3QX5H 1D9IA 2RDLA 4YM9A 1ELCA 5E0JA 2XXLA 3A80A 2FDAA 4CBOA 5ESBA 1V2QT 4X1NU 1THRH 4J2YB 3BEIB 4INKA 3PLKA 1D3DB 4CHAB 1AVWA 1PQ7A 1C5TA 2FIRH 2ZZUH 3M3VA 5EXMA 4ESTE 1HJ9A 1BITA 1SL3A 2OTVA 1GBJA 1T8MA 3SI4H 3HK6B 2STBE 4XOJA 4MNXA 3VG8A 4JYTA 1SSXA 3FP6E 1FN6A 2ODPA 3FZZA 1ZMNA 5FCKA 5E8EH 1O2NA 1K2I1 4O3TA 3E16B 3A82A 5A0BA 5IK2D 3TJOA 5EQSA 2FO9A 2F83A 3A8CA 1A5IA 1XVMA 2FOMB 1TGNA 3PO1C 3OEHD 1TPAE 1KXBA 2Z7FE 2FLBH 3FO8D 1WTGH 1GCTB 1YCPK 3QWCH 4NCYA 5C67A 3K6ZA 5DSFA 3M61U 4JCNA 1BJUA 2XCNA 1FNIA 1NROH 1SHYA 2P93A 2Z3EA 1XUGA 3M5LA 2ZDMA 3EA8A 1T4VH 1V2VT 1O3MA 1ZPBA 3M3TA 1FIZA 2QIQA 1WOFA 1OWDA 3AAUA 2ZEBA 2AHME 6LPRA 3LGTA 1WUNH 3HATH 1AU8A 2WSSD 3TH2H 2P94A 1YPLH 4E7NA 1O3GA 1H8IH 2QF3A 3TGIE 1QZ8A 2OCVB 1Y8TA 4INHA 3SI3H 3RXLA 1QIXB 1GBLA 1ZMLA 4K8BA 1YLCA 2VIVA 3ZZ4A 1NFYA 2QXJA 3F3BA 1THPB 3QK1A 1P06A 1WQSA 3U28C 1DITH 1MTVA 2BHGA 4ISNA 2CHAC 1XUIA 1A4WH 3MH7A 1XXDA 2GX4A 3EA7A 3RXCA 4X1QU 5JBCS 2ODQA 1YKTA 1FV9A 3FP8E 3SHAH 1VITF 1LVBA 3RXPA 5AFYH 3DCLA 3SJKA 1AIXH 4DJZB 2ZGBH 2VVCA 3E0PB 3O8BA 3VB7A 4D8NA 1M9UA 4AB8A 2Y7ZA 1D3QB 2G81E 2IN2A 5DKMA 3P17H 4BTIB 4CRDA 1BTZA 2PKAB 5C1YA 1F5RA 1ELGA 2P16A 2EI6A 2VWNA 1G3DA 1ZJKA 1DWDH 4AG1A 2XBXA 2Z3CA 1NU9A 2ANKH 2ZDNA 1O2XA 4PROA 1BTYA 1AUTC 1YCPM 4ABIA 3RLYH 1EPTB 1GJ9B 3AK5A 1LKBA 2EY4C 4BAKB 3DFJA 3NPSA 2VBCA 2AMQA 5E0GA 1FY4A 3DFLA 1HIAA 2VIOA 3B9FH 3MMGA 1RRKA 4D7GA 1O3HA 4Z1MD 4JZ1A 4DW2U 1C5WB 3KGPA 3PRDA 2AS9A 1QRXA 4I32A 4WMFA 2V0BA 4WJG2 2PLXA 1Q3XA 4MTBA 3T2NA 1DPOA 2XC0A 1FAKH 1ELBA 3SBKA 4JZDH 2J94A 3FOAA 1MUEB 4NZLA 1GJCB 4IMQA 4XE4A 1TNIA 1PPGE 1KXFA 3H5CB 3MNCA 4GPGA 1Y5BT 1C1UH 3QTOH 5AFZH 1O3JA 2BDYA 4FUFA 1WU1A 5ESTE 3RXHA 1MAYA 3FN8A 3AW0A 4MVNA 3UAIC 3H7TA 2XWBI 1W0YH 1EZUC 2SGAA 1YPHC 4Y10E 2AGIX 4Q7ZA 3GDUA 3UOPA 5DK1A 1NRNH 4GLYA 1VKYA 1XUHA 3OY6U 3RC6A 2AGEX 2WPMS 2ZU5A 3F0PA 1FMGA 3RM0H 4K69A 4YTAA 1W3CA 2FOCA 4SGAE 4X8VH 2WPKS 1BTWA 1O2HA 3MO6A 3RXAA 4SGBE 1Q2WA 1YLDA 3SNCA 4NIYA 3HPTB 1GG6C 4BAOB 3Q00A 2RDEA 1O3DA 4ABJA 1MTNC 4Y8YA 3GYMA 2QC2A 4YO9A 3FFGA 1QJ7B 4TWYA 1SOTA 1BTHH 2FI4E 1C5RA 2Q1JA 4RI0A 3O8CA 2W7UA 3EE7A 1HAIH 1ZLRA 2CGAA 2Z9LA 4BXWA 4WXVA 1V2UT 3V12A 1TPOA 1O2PA 2FOEA 1GBBA 1E36B 1DLEA 4UFDH 5FCRA 1W2KH 3TGJE 1AWFH 1HUTH 2Z9KA 2ZO3H 3D62A 3O8DA 1ABJH 2BY9X 2PW8H 2P8OC 1HXFH 4H6SB 3ZV8A 3U69H 1HAPH 2KR7A 2ZF0H 1HCGA 2YNBA 1BMAA 3PV2A 4FOUC 2XBVA 4FUBA 5T6FA 3C27B 3PROA 1QHRB 5EW2H 3Q77A 4NG9H 3A81A 3BTWE 4HG6A 2ZQ1A 3KCGH 1GJBB 1LHCH 1K22H 1UTJA 5A8YA 3VPKA 2QY0B 1PPFE 1O3IA 4Y0ZE 4U30A 3ZVEA 1BMMH 3T62A 1O2VA 1O2TA 1TPPA 1JIRA 1LCYA 7LPRA 4GAWA 3SZEA 1BMNH 1AZ8A 1RIWB 1MBMA 1O35A 2JDID 1GGDC 1A46H 2BLWA 3S69A 1UO6A 2UUFB 2BVSH 5EGMA 3EQ0H 2FXRA 1TX7A 1P02A 1ESAA 1XUKA 4TY6A 1PQ8A 3IITA 3QGJA 1UCYK 1V2OT 1HAVA 3PMBB 2HNTE 2BOKA 3W95A 3RU4E 2OK5A 1QB6A 8LPRA 2RFKC 1AMHA 5EJLA 2PGBB 1AWHB 1GI2A 4YLQH 1DOJA 1C2MA 3TJUA 1MKWK 2A4OA 3A88A 1HJAC 1TRYA 2BQWB 3M7TA 2P3FH 2PFEA 1V2LT 4HZHA 4ACAA 5GWZA 1NM6A 1BT7A 1SG8B 1ORFA 5F8ZA 3SNBA 2BLOA 4B73A 2TRMA 1C2FA 2YNAA 3M36A 1C5NH 1BA8B 1TYNA 4I86A 4MPUA 8GCHG 2ZGHA 2A7JA 1FLEE 1JIMA 2XBWA 1EP6A 1CA0C 1D4PB 4Y6DA 3SORA 3P8OA 1KSNA 4B71A 2J92A 2P59A 2JH5D 3BTEE 3K6YA 2GT8A 1C2GA 1C4U2 1GMHF 1O5DH 2H6MA 4K3JA 1C5PA 4E06H 1FPCH 4JYUH 1G2MA 1MBQA 1GBHA 3BV9B 3I77A 5JYIA 5FX6A 1O3FA 1Z1IA 5EG4A 5G4BA 4IC5A 4YZUA 2Z9IA 1GI8B 2VJ1A 3OU0A 2AGGX 2QN5T 3GY8A 1O3NA 5EW1H 2WUCA 1TGSZ 1P01A 2OQ5A 2FYQA 4F49A 1U6QA 4B6FA 4ISLA 1DSUA 1X7AC 1KLTA 1QBOA 4OS4A 2XNIA 2QXGA 4YESB 1MZDA 3P8NA 1LMWB 4E7RG 1O2ZA 1V2WT 3K65B 1P2OA 3RU4D 3ZV9A 4O3UA 3URCA 1C2IA 4DG4A 3VFEA 2ZKSA 2LNCA 3I78A 3IG6B 1TLDA 1XUFA 4I8JA 1HAZB 1S6LA 1FXYA 1W0ZU 1ZPZA 2H5DA 2ULLA 5L2YH 2ZI2H 2SGEE 1EAIA 1SC8U 3BTFE 3KIDU 2BZAA 3TPIZ 4DIIH 1EPTC 3LKWA 2WZQA 3ZZDA 4TPIZ 1UW7A 4ASHA 4YOGA 1XVOA 1T32A 4J1YA 5FHTA 1ZTKA 4X6NA 1RFNA 1QRZA 5EPNA 1DE7H 1UK4A 1ZRBA 3HGPA 1F0RA 1BRCE 3PTBA 4A7IB 1KMHB 1L1NA 5C1UA 4ABFA 4YT6H 2B9LA 1O0DH 1NRSH 3LGWA 4FU7A 3QN7A 4AFZA 1TNHA 1UCYE 1LPZB 1SKYE 3F9FA 3TITA 1KYNA 1S81A 2G5VA 5A8XA 4XBBA 5DP7A 3BTTE 1OKXA 1EJAA 1XM1A 2W7SA 2HRVA 1F5KU 3ZVFA 4NWKA 1K1JA 5DP9A 1S85A 1UTPA 1BUIA 3Q3XA 2BB4A 1H9IE 5HIZA 2ZCLP 3M5OA 1WV7H 5EXNA 1AI8H 2ZC9H 4NA8A 5GCHG 4UDWH 1C2HA 2EC9H 3HKIB 4MLFB 1E34B 1Y3VA 1JRSA 2ZTXA 2K1QA 5GPIB 1ZGIA 1K1MA 1ESBA 1AUJA 2WPHS 1S0RA 3SYJA 1AB9B 2VH6A 1ETSH 1HV7A 2ZECA 2ZPRA 4DOQA 3MOCA 4B2BA 3F0OA 1J15A 4A1XA 2J98A 1EKBB 3Q76A 5FPTA 3MNSA 1TBQH 3MQKC 1L4ZA 5FBEA 3A8DA 1NFWA 5C1XA 2D8WA 1NO9H 1CBWC 3DHKH 3F6UH 4DIHH 1DT2A 2ZTZA 2A32A 2BY6X 1OXGA 2C3SA 4YOJA 1PPCE 4MNVA 5T3HA 2ZHEH 1P04A 3ENSB 3SHCH 3QUMP 3GCOA 1P12E 4IBLH 1UVTH 3A7WA 1T31A 4NIWA 2J34A 2IJD1 3SV7A 3SGQE 4X8SH 3MTYA 1UTNA 3UPEA 2OQUA 3V7TA 1TAWA 2XC5A 2Z94A 1BJVA 1DWBH 4O03A 5IDKA 1BZXE 2L6OA 4BXSA 2AERH 4A1TA 1YWUA 4QT8C 2A0QB 1Z71A 2LELA 1GHYH 4KKDA 1JXPA 4UE7H 1LVMA 1TMUH 2XYAA 1YPEH 1C2LA 3SV2H 6CHAC 1NS3A 2FOAA 4CR9A 2GCHG 4GUXA 3W94A 3UY9A 1AVGH 1GBIA 4ZXXH 5FAHA 2WUBA 1YM0A 1ANEA 1MAXA 5DGJA 1LHEH 2R0LA 1H9LB 1RJXB 1O2SA 3GY7A 2G51A 2TGDA 2V7QD 2ZHDA 2BX4A 4AGKA 2JH6D 1C5XB 3JZ2B 1P3EA 2H5CA 3GCHB 1ZOMA 1GBEA 1AY6H 1TPSA 3UQVA 2M5TA 2CF8H 4AFSA 3QDZB 1JWTA 3BG8A 3SOSA 1OHHD 3OTPA 3U1IB 4XSKU 1TNGA 3WY8A 1QQ4A 1Z8GA 5K7RA 1COWD 3LH1A 4CH8B 1W11U 4HI3A 3VGCB 1DSTA 2OINA 4Q2KA 1GJ6A 3F9EA 2WPJS 1OPHB 4I7YH 1DWCH 4WF8A 5B6LA 2BLQA 3RC5A 2UUJB 2NU3E 4D9RA 1IQKA 1C5SA 1QQUA 2P3TB 2KCYA 3S7KB 2H9EH 4JZIA 1ZSLA 1MU8B 4OS5A 1HJ8A 1H8DH 3M3SA 4JYVH 2BVXH 2THFB 2SGQE 2ZIQH 1ZMJA 1ZJDA 2O8LA 5L2ZH 3KQBA 4GSOA 4OS7A 4X6OA 1SGTA 3MU1A 1LQEA 2CK3D 2Q6DA 3A7VA 1ELVA 3GYLB 3UB0A 2B8OH 1G37A 1D6WA 1K1PA 1O32A 3A86A 2PUQH 5C20A 1HIAB 3TGKE 3UFAA 1OWJA 4RT0A 3M5NA 1V2ST 2XW9A 1CGIE 3VGCC 1A61H 1EPTA 4AGJA 1O2KA 1HAVB 1E1QD 1L1JA 1G3EA 1TOCB 3FVFB 3UREA 3SUDA
chains in the Genus database with same CATH topology
5TCAA 1INCA 1YGCH 3GICB 5F8XA 4NA9H 2G00A 1SI5H 1QR3E 1ZHRA 2VVVA 3OTJE 1PPEE 2VIWA 1C1QA 1EXFA 1T8NA 1O2UA 4UD9H 1EZSC 4Y79A 3OSYA 2FEQH 1O31A 2F3CE 1QL9A 3MNBA 4ISHH 1SMFE 4X1RU 3RMLH 4ZMAH 1P09A 2ASUB 2D2DA 3BTGE 5F8TA 3H7OA 4ZROA 3SU1A 4B76A 3T28A 5HGGA 7GCHG 1DUAA 3L6PA 1AFQC 1SLUB 1P9UA 2NWNA 3A7ZA 1P10A 2A45B 3BIVH 5BPEA 2F9NA 4B1TA 1C2KA 1SGCA 2ZGXH 1UVUH 4MPWA 5E0HA 1ID5H 5HM2A 1ELAA 1IQLA 1HDTH 3MFJA 2F91A 4U01A 1C5YB 2Q6GA 1Z6JH 1LHDH 1TNJA 3SV8A 1NFXA 2ZPQA 2Y5HA 3ODFA 1AHTH 1IQGA 1K9OE 1T8LA 2BLVA 2D26C 2IOTA 3M5MA 2HLCA 2QA9E 1FZZA 2UWPA 1BBRE 4IN1A 3V3MA 2QYIA 1GJAB 4GHTA 3GOVB 1PYTD 2GKVE 3ATLA 1GCTC 1FI8A 1GBFA 2FESH 2ESTE 3SZNA 1RTFB 3MO3A 1QY6A 4AG2A 2BZ6H 3A85A 3KNXA 3E1XB 1DXPA 1WCZA 3TNSA 1DFPA 1Y3YA 1CQQA 3IWMA 4K60A 1GVKB 1H9HE 5PTPA 5C5NA 3BSQA 5BRRE 2CMYA 2GCTC 1PPZA 2SNVA 1XKAC 1GHZA 5CE1A 1TGBA 1B7XB 1C5UA 1FIWA 1S0QA 1O5CB 2ZFSA 2G5NA 4NFEA 1FY3A 1J17T 3CS7A 4UEHH 2OC8A 2DE8A 2NU4E 3E6PH 3JZ1B 1SPJA 2GD4B 2GMTB 2H1UA 1YBWA 3TIUA 5JPMH 1BBRH 4DVAU 4Y7BA 1OYTH 3BN9A 4MDSA 4A92A 1SFQB 3VB6A 1XKBC 1G3BA 1VR1H 2LPRA 3P6ZB 3VB4A 3O8RA 2TIOA 3HGNA 4O9VA 5DJ7A 2C8YB 2JETC 1UMAH 2PUXB 2HVXA 1UHBA 1GJ4H 3GISB 2ALPA 2ZNKH 1EAWA 4MG3A 1VGCB 3AVZA 1PFXC 4IW4E 3RXVA 2A4RA 2BD4A 2FOFA 2BDAA 2J95A 2GVFA 3ZZCA 3RP2A 2FX4A 1LDTT 4R0IA 1HPGA 3RMNH 5HYOA 3SUEA 1P0SH 3LOXA 3ZVCA 2BDBA 1AO5A 4CH2B 3R3GB 4CRBA 2Z9JA 3A7XA 2RCEA 1DLKB 1DM4B 1MTWA 1GBDA 2ZDVH 2ZPSA 3KL6A 1GMDG 3ZZ7A 2QGRA 3LJOA 1IQFA 1MCTA 4HGCA 4IGDA 5F03A 4Y8XA 2FYRA 2ZU2A 2BMGB 1MKXH 4MNYA 3NKKA 4Q7YA 1SGEE 2ZWLH 1VGCC 4LK4A 3KF2A 3PV4A 2VINA 4VGCC 5GJ4B 2C8XB 3PWBA 1QB1A 5FBIA 2ZU4A 3PMAB 2A1DB 4Q80A 1EQ9A 2BVRH 1GMDF 1LKAA 1SGFA 3BEFB 4UFFH 1O3BA 1SFIA 1ZZZA 3P70B 3T26A 3U1JB 1GBCA 1YPGH 4ZHMU 5TCCA 1RD3B 1MMJN 2ZHWH 1QA0A 1BRAA 2ZGJA 5HXFA 3UR9A 4THNH 4WH8A 3P8GA 3CP7A 3SW2B 2EA3A 5JBAS 4ISOA 1LHFH 3D49H 3U98H 4LZ1H 1C5MD 1Q31A 1P2IA 1XMNB 4DY7B 1V2NT 5AVDA 4XBCA 3Q3KA 1GBMA 1O5GH 1CE5A 3RXGA 3SJIA 1T4UH 1IQMA 2XC4A 1QBNA 3PMHB 3MU4A 2FX6A 2SGFE 2C4FH 3MHWU 1KXDA 2V3HH 4RKJB 1KDQA 4I8HA 1ELFA 4RSPA 4KELA 1TONA 1GVLA 1GI4A 2I6SA 3R0FA 5CHAC 1GL1A 1DWEH 2J9NA 4OS2A 3ZZAA 1YF4A 2OD3B 2ZDAH 1G9IE 1RXPA 3BEUA 1IHTH 4AFQA 4X0WU 3PB1E 3QZRA 4D9QA 2ZFRH 2XBYA 3FZDA 1Y5AT 1OWKA 1SLVB 2GGVB 2VNTA 3E3TA 1UTMA 4H42U 3L3TA 3VB5A 1DY8A 1UTOA 3MWIU 4X6MA 1O2WA 1TBRH 3PYHA 2A31A 1WAYB 2PR3A 4MQAA 2WV5A 4Y76A 4XFQA 1FAXA 1GCDA 2ZCKP 1A7SA 4X8TH 1YP9A 4CR5A 1F0TA 2HWLB 4YT7H 2VWMA 2BY7X 1N1LA 1ETRH 3KEEA 1OOKB 5L6NH 4GCHG 2Y82A 1Z8IB 5DP8A 1TX6A 3LGIA 1TB6H 1KTSB 1T7CA 2FS9A 1IHSH 2BTCE 3QZQA 4FUEA 4Y7AA 1LVYA 2KAIA 1BRBE 2BD7A 2R0KA 1DDJA 2ZGCA 2FODA 1MTNB 1QRWA 5GXPA 3VEQB 3ATWA 1PQ5A 1Z7KA 5J4QA 5HM9A 1NN6A 2P8OB 3SNDA 1ESTA 2BDCA 2A7HA 1S84A 3B8JA 3F9GA 3RUOA 3RM2H 1YPHE 2BDIA 2AH4X 4FUJA 3K9XB 4F4OC 1BCUH 1TWXB 2IPHA 2ANYA 1V2TT 2TGTA 3SU2A 7KMEH 2J38A 3SU0A 1F92A 3TH4H 7GCHF 1ELTA 1Z1JA 3LONA 2PSYA 4JK5A 1PJPA 1KY9A 1QGFA 4ABGA 3AASA 4CRAA 3E0NB 4LOYH 2VB0A 1UVPA 3RXUA 1SQOA 2CJIA 5A0CA 4X8UH 2BX3A 2TPIZ 1C1MA 1V2KT 2FTLE 3BIUH 2FOBA 1BQYA 2HNTF 1BTXA 3SJ9A 3UWJH 2FZZA 3P95A 4FUDA 1C5VA 1W14U 1DVAH 2CXVA 1UTKA 1LVOA 1G32B 2AYWA 1FJSA 3BTDE 1YPKH 5JB8S 4JMYA 1GG6B 1MU6B 4KTCA 1V2JT 4U2WA 4D76A 2G55A 3S9CA 3EGKH 2G4UA 2QCYA 4ZHAA 4MPVA 1QCPA 3STIA 1EZXC 2R9PA 4AB9A 2OUAA 3UWIA 1QURH 1HAGE 1C1RA 3PO1B 4NIXA 4CREA 2XRCA 1GHVH 1UTLM 2R3UA 3E8LA 3K2UA 3ZYEA 2AFQB 3SGAE 2BM2A 1BDAA 1N6XA 1IQNA 3SGBE 2A7CA 3ZYDA 1A3BH 1GHBG 4WMDA 4X1SU 2R2MB 3BG4B 6ESTA 1T8OA 3EYDA 1C2DA 4OGXA 1QL8A 3GDVA 3RXRA 1E38B 1AFEH 3TVJB 2QXHA 2BY5X 1FY1A 5DO4H 2H9TH 5LPRA 1YCPH 1O5FH 1A0LA 3OX7U 1GHXH 2V6NA 4AZ2B 1P2MA 2O9QA 2J4IA 1TA6A 1NFUA 3KN2A 1Z6EA 2OC0A 1D3TB 5FXLA 2A5AA 3RXEA 2SFAA 1C1OA 1NT1A 3GCTG 5LPFA 3UNRA 1CHOG 1P2JA 3DD2H 2HPPH 3NCLA 1IQIA 1GHAF 3GCNA 1W8BH 2Y81A 1SGIB 4ZXYH 4FUIA 2VIPA 1GBAA 2ZU1A 1F2SE 1S5SA 2TGPZ 1A2CH 1Y5UT 3RXDA 2WYGA 1D6RA 5C2ZA 2F9BH 2ZQ2A 1KXEA 2CV3A 1O38A 1EB1H 1L1GA 3LT3A 3HK3B 3FANA 1BBRK 1HRTH 5K0HA 1ANDA 3MH4A 3A89A 1A1RA 1GI9B 3V0XA 4IC6A 3S9AA 3B23B 4TYDA 4ZKRU 2A5KA 5C3NA 4BTUB 2BD2A 4B2CA 3ZZ8A 5E2PA 1SQTA 2Y5FA 1LTOA 1E37B 1WBGB 1TABE 1DANH 3A7YA 3HKJB 2GCHF 4K1TA 4A5TS 1GDQA 5JB9S 1DY9A 1GJ5H 3A7TA 1AD8H 1NRQH 1QA7A 1P2QA 1UVSH 2ZA5A 3MYWA 1V3XA 4AORA 2NU0E 1DXWA 1VJAU 1GI0A 2G52A 3SQHE 1TQ7B 4WH6A 2BD5A 1O5BB 1AKSA 4FU9A 1UTQA 1V2RT 1VCPA 4CHAC 5CMXH 5GIBA 4GVUA 4K8YA 3UIRA 1CBWB 4B2AA 1WTHD 5EPYA 3ZVBA 4D7FA 1O2GH 1TRMA 1HXEH 3G01A 3RXFA 4DT7B 3SJ8A 3KHVA 3BG4C 2OLGA 1VJ9U 2O8UA 3ATKA 2BYAX 3MO9A 2FP7B 1BTPA 1QTFA 1MKXK 1HAYB 3TK9A 1B5GH 1FN8A 1H1BA 3BTME 3RLWH 5AF9H 3SU4A 2ANMH 2PHBA 1BMLA 2ZCHP 5JBBS 3GCHC 3PLBA 1HAXB 1K1IA 3SU5A 4BAMB 3CS0A 5EQQA 1LPGB 3PM3A 1SOZA 1O2YA 3PWCA 4CRFA 4FUGA 1JBUH 4ZKOU 1HBTH 1OWHA 2BD8A 4YOIA 1EP5A 2GMTC 1NPMA 1G30B 5GCHF 2BOHB 3NK8A 1TFXA 1BTUA 2D1JA 4NZQA 5ETXA 3U8OH 5J4SA 3EA9A 4IS5A 4DGJA 2Y7XA 1AGJA 5C5OA 3KQEA 1GHWH 4H4FA 3C1KA 1FDPA 1IQEA 4JK6A 3UUZA 1E35B 5E2OA 4WY3A 4R8TB 2WPLS 1GJ8B 2UWOA 3SV9A 2AIPA 4ZHLU 1EOJA 3ODDA 3SO3A 3TK6A 1AE5A 3M7UA 1UVOA 1C9PA 1SHHB 1KIGH 2ANWA 3RMOH 1HYLA 2QXIA 4ABAA 3I29A 2OP9A 1A0HB 2BXUH 1C1NA 1SB1H 2ZFTA 1MD8A 1C5ZB 1B0FA 1FY8E 5HMAA 2BDHA 4NA7A 1HNEE 1O3CA 4HTCH 3F68H 3BF6H 1ZGVA 1HAHH 2OC7A 4X2YA 1K1NA 2QAAA 3L33A 4K1EA 3EAJA 3UNQA 3FP7E 1ZHMA 1BHXF 3BTQE 5GDSH 1AQ7A 2EI8A 3TH3H 1OX1A 2R3YA 3KQCA 1Z8JB 1EASA 5DP6A 3ZVAA 2FI5E 4DCDA 2FOHA 1C1PA 3N7OA 2EEKA 1W10U 1S6HA 1WSSH 1CO7E 1C1TA 2PKSB 1RGQA 4TPYA 2ODYB 3QTVH 3U9AH 1O5AB 5TJXA 4B74A 7ESTE 3S9BA 1EOLA 8ESTE 1GI6A 2QF0A 1BOQA 2VWLA 3DA9B 4BTTB 1W13U 3AW1A 2AEIH 4I33A 1AVXA 1LPKB 2C8ZB 1ABIH 1G36A 4KGAA 1A5GH 4K2YA 1C1SA 2FWWA 1BRUP 1CSOE 1BHXB 4ABHA 4KP0A 5I46H 4TWWA 2P95A 1O3KA 1N6YA 1C5OH 3TU7H 1K21H 2GCTB 3T29A 4NGAH 3TJVA 1O2IA 1J8AA 2ALVA 3M37A 2CF9H 2GV7A 1LO6A 5DPAA 1GMHG 4Y11E 1YC0A 1O3LA 2ZDKA 1P03A 1OYQA 2FI3E 5EXLA 3LC5A 1EB2A 2BQ7B 2R2WU 1MTUA 2CHAB 8GCHF 1OSSA 1W7GH 4WMEA 1F0UA 1C4Y2 4UONA 4E05H 1GBTA 3UNSA 3MU5A 2VU8E 1CHOF 1VZQH 3EDXB 2STAE 3GCTF 1TOMH 4MPXA 1TNLA 1O2QA 4NIVA 4ZH8A 1GPZA 1K1OA 2FMJA 3QLPH 3QO6A 5A2MH 1HJAB 1ZRKA 1O3PB 1P2NA 4X2XA 1SGFG 2OXSA 3RXMA 9ESTA 3ZZ9A 2FLRH 1WYKA 1Y3WA 4XBDA 4VGCB 1P05A 5I25A 1NRPH 3DUXH 4DURA 3SQEE 1C1VH 2SNWA 1QB9A 1VITH 2CN0H 1GVZA 2F9VA 1O2MA 1FY5A 4AN7A 2G4TA 5H4IB 1GHBF 1W7XH 5T6GA 3RC4A 1UJ1A 2ZP0H 3QGNB 1L2EA 2RA0A 1XUJA 2GT7A 2W3IA 3TJNA 1ZYOA 4FVBA 3FAOA 1ANCA 2XWAA 1RTKA 1OP0A 1B0EA 1FUJA 1ZR0A 4I8LA 2QV1A 1NC6A 1NY22 4KTUA 4Y71A 2A2XH 3PLPA 1NRRH 1V6DA 1DX5M 3UTUH 1OP2A 4OS6A 3RXKA 1AKSB 2O8TA 2ZTYA 2F9UA 1GL0E 3ITIA 1ZSKA 2O8WA 1TX8A 1VITG 2W26A 1SR5C 4X1PU 3RXIA 2AMPA 1AN1E 1IAUA 2ZG0H 2B0FA 4ABBA 4OS1A 3U8TH 2BQ6B 3A8AA 3LIWA 2FS8A 1L4DA 2ZFFH 3A84A 3D65E 4A6LA 2BXTH 4AX9H 5A0AE 1GJ7B 2VIQA 3NXPA 1L0ZA 3LPRA 1N8OC 1IQJA 1TRNA 4K1SA 2EI7A 3SU3A 2HOBA 1BB0B 2DUCA 2Q6FA 3ESTA 1A3EH 4FUHA 2BD9A 4FUCA 2Z6BD 1DUEA 2GDDA 3A8BA 1GJDB 1CT2E 2WV4A 1HB0B 2C8WB 3VXEH 3UR6A 3P8FA 1O33A 1CHGA 2RA3A 3A87A 5EOKA 4UFGH 1CVWH 2KAIB 4HFPB 4ZUHA 1N8OB 3LH3A 4MNWA 3TK5A 4IMZA 4X2VA 2VGCC 1KXAA 4RKOB 2TGAA 4WVPE 2OBOA 2IJOB 1NESE 3ZZ5A 1QL7A 1YPJH 1GHAG 1G3CA 5EQRA 2HPQH 2BD3A 5JBTA 3STJA 4BAQB 2XCFA 2JH0D 1OWIA 3CENA 4LXBH 2PKSC 1A0JA 1DS2E 1ZTLA 2FOGA 4BOHA 1FONA 4X6PA 2V35A 1CGHA 2I6QA 3SJOA 1OP8A 2UUKB 3PMJA 3TNTA 3BTKE 1MQ5A 2C90B 1PPHE 3GY6A 4X2WA 1KLIH 2NU2E 3T25A 3MU0A 1ACBE 1AFQB 1LHGH 4TY7A 5EODA 2Z9GA 2G8TA 1SQAA 5SGAE 5LGOA 3M35A 3SV6A 1YPMH 5F6MA 2RG3A 2ZU3A 2SGDE 2XTTB 1O2OA 4Y0YE 1HLTH 2PTNA 5AHGH 2BDGA 1KDQB 1THSH 1TALA 3ZZ3A 4INLA 1IQHA 1JOUB 3LJJA 1P3CA 1EAUA 1O39A 1A5HA 3SNAA 2PGQB 1OWEA 2PTCE 5ABWA 4WXIA 1G2LA 2VGCB 1O36A 3EE0B 1FQ3A 1C1WH 1P57B 1PYTC 1Y59T 4BAHB 1TGTA 2VVUA 3SNEA 5EU8A 8KME2 1CA0B 1TE0A 2WPIS 5FPYA 1MKWH 3GY4A 1SVPA 3RXTA 3UQOA 1BIOA 4JZFH 1S6FA 3D23A 3RXBA