1SQPH

Crystal structure analysis of bovine bc1 with myxothiazol
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
67
structure length
67
Chain Sequence
ELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 20
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1sqpH00
3L74H 3H1JH 1SQQH 3L73H 1NTKH 1SQPH 3H1HH 1SQVH 3H1LH 1NTZH 3CX5F 3L70H 1EZVH 1BCCH 3L71H 1NTMH 4D6TH 1BGYH 1KYOF 1KB9F 1PPJH 3CWBH 4PD4F 3H1KH 2A06H 1BE3H 2FYUH 4U3FH 3CXHF 1P84F 2BCCH 3BCCH 5KLVH 1NU1H 3L72H 2IBZH 1SQXH 3TGUH 1L0NH 3H1IH 3L75H 1PP9H 1SQBH 1L0LH
chains in the Genus database with same CATH superfamily
4JTAB 2UXNA 4LCUC 2N74A 2KG7B 1V55B 5EC1C 1O9HA 2QKCA 2XNDG 3M8AA 2F23A 1YVWA 2OCCC 3QO7A 3ZHTA 4LFAO 2ZE7A 3AK2A 1XMOO 1GN4A 2ZR3A 1HNXB 3QG5A 3AK3A 3ZMVA 3GWKC 3H1IH 3ICXA 4PA9A 4JYBA 4B3RO 3CYOA 3K5LA 1N33O 3HKBA 1OCRC 2P22C 4LNUA 1BT8A 2F4VO 4PJ0Z 1N0JA 1YDXA 4KUMA 4C7UA 5IT9N 3AG4B 1MSWD 1GTOA 4NKGB 1I94O 2UXBO 3ZRWB 4EKWA 3U0ZA 4LF5O 3D36C 3CCLV 1SESA 4B3SO 4E2LA 4LF9B 4NYKA 1QQCA 4K8ZA 1MNGA 2LGQA 2YC0A 4D7SA 1K92A 3NXSA 1KP2A 4U3JB 4LF8O 1QR9A 1Z2GA 3Q4HB 3N2KB 4IL6Z 4JZGA 4RQEA 1NJIW 5EZYB 5CMUA 5HFLA 2Q67A 2Y0PA 2UUCO 4B3TB 1S77D 1SF9A 5LMUB 4DR5B 2A7WA 1VQ4V 3ZHUA 1JFFA 3UO2A 3JD3A 5J2TB 3E2EA 2ZDIA 3CCUV 2JEUA 5B1BC 2JGDA 5IYCO 2Y0IA 5KA6A 2YUAA 4O4HA 1DGSA 4OX9B 5L3FA 1BQZA 5IYDO 4NXMB 3MHHC 2ETNA 2R72A 3DXRB 2YEVB 4LC1A 3SPIA 5JJJB 4GKJB 1FFXA 2HJFC 4LWSA 4YJ2B 4J7KA 1ZWIC 5C93A 3LNNA 1R6TA 4IIJA 5EYPA 1XMQO 3RT3C 1GM8A 4DV0B 4I4TA 2HFEC 4W4LA 1VMGA 2CH7A 2UXCO 3ETGA 4DRXB 3E22B 4YIPA 1FXVA 4EFBA 4QNHB 3OGIB 4YIOA 3TCUA 2UXDO 3OTOB 1WP7A 1WA8B 5L3EA 5JQGB 2QTSA 2WLLB 1AI5A 2AHZA 3HKEA 4QPJA 3FB7C 1R1BA 2YS8A 5E79Z 3SYPA 1Q90D 4IYIA 4WBNB 4JYAB 5GONB 1WPBA 1BS3A 2QE7G 3RVZA 4CH3A 1H2GA 3K08A 1WLEA 3N2GA 4O4JA 1SC5B 4PA6A 5LP6B 2F43G 1TVKA 1SKVA 1VQ8V 4MW8A 2QKAA 1SQPH 2H8PC 3K3WA 4DV2B 2YIDA 2UUAO 3RVYA 2QM7A 1B6QA 4JI7O 3W7SA 2DQ3A 2VWJA 2QJ1A 1GMGA 1NZ6A 1OHHG 1L1FA 1U96A 1QLEB 3ZHQA 1B04A 3RBZA 3LDCA 2YI8A 3K59A 5B1AB 4P2ZA 1G8MA 1Q86W 4MVOA 4EB6A 1IBLO 3CCVV 1VF7A 3K57A 2RNBA 1F23A 4TWKA 5HFMA 4DR1B 3AG3B 4H33A 1JPXA 4ZI7A 5JCOA 2XUMA 4AILC 2G38A 3E8BA 4K8XA 3RYFB 3ASOB 1CP9A 1SQGA 3F5WC 5L3DA 1D5AA 2DYSC 3T2MA 4UCRA 2IH3C 2WLNA 3ML0A 1FXHA 4LP8A 1M4UA 1FXKA 2Q8VA 4O2AB 4X1IB 3GVMA 3NR7A 4GX2A 1R6NA 2B5UA 5J2UA 1XQ8A 2HKOA 5CA3A 1YF2A 3DXRA 1MOFA 3CRCA 4LBEC 4GKKB 5IYBO 1H8HG 4L8JA 3RYHA 1XL4A 1KQSU 2ODMA 5F2VO 4YHHO 3KZIZ 5L3GA 3E89A 1V54B 2DMXA 4BIUA 3SYCA 1RM1C 4X20B 2YXHA 3IC9A 1M56C 4JI0B 2ADQB 2XTAA 4J42A 1MG1A 1VQ7V 1NVPB 3CXHF 1K73W 1PV0A 3JD2A 1Q43A 4UB8Z 1EFRG 5LGNA 5BR8B 2ADPA 5KUKA 5LGUA 2P06A 3T1YO 2RJZA 1VF5B 3FB6C 4FFBA 2E76B 2FMLA 3UKMA 1M5IA 1Q3EA 4O2BA 3T4ZA 1N8RW 4ICGA 4DR7B 4PA3A 4RO2A 3FYIB 1XUQA 4JI1O 2CAZC 3OR6C 4NTWA 3APQA 2R9IA 3AK1A 4MVZA 2CGOA 4CS2A 2ZE6A 1QU7A 4NVPA 3CRAA 1YI2V 3UT5A 3THOA 1Y74B 3K5NA 4LH7A 2ZM6O 1PNLA 1AI4A 4YY3O 4JI6O 3JYCA 3ZX6A 4JI8B 3CJHA 1ZTEA 4X1KA 1WB8A 3CSXA 5KX5B 1D5NA 4FM2A 4FVMA 4NB5A 4U3FH 5ITZA 3UQ8A 1N0NA 5IJ0A 2X6BA 3K9AA 3ZHVA 1H2LA 1K7DA 2AXTZ 1S5HC 4AHCA 2AZ0A 2HG5C 3JSLA 5GTHZ 2IM9A 1NS1A 1LNQA 3RFRA 2VWKA 1BCCH 1EN5A 1HR0B 5B3SC 1D2DA 3B4SA 2PUSA 2ITDC 4N21A 3CP1A 4K35A 1XHZA 1CXZB 4JI3O 2EIKB 2F1MA 1Q6UA 3KCXA 4CH4A 2QM4A 4DR4B 3SPGA 5B1OA 1DF4A 1Q6HA 1XILA 4KL1A 3ZMTA 2R9AA 2YIBD 1N34B 5KHGA 3JAKA 2OTJV 1S5LZ 2CTPA 1TA8A 4CH6A 5LYJA 1IBKB 4AI8A 1OCZC 2EIMC 1PL4A 4TT3G 2IH1C 1QR8A 2Y69C 2BOBC 3CRQA 3AG1B 4LF7O 2WLIA 4JYCA 3F7VC 4CS4A 2R70A 4XBFA 3HKBB 1FS0G 2KSDA 4UUJC 3FB8C 1K3EA 5EBLC 4LNUB 5H9CA 1R3LC 3OUFA 4DK0A 1GM9A 1JVMA 1BZKA 3ZCCA 2WLKA 4FK5C 3STLC 4FPPA 2BOCC 1GN2A 4PA7A 2GV9A 2MK3A 1XNQO 4IGGA 1IZ3A 2N04A 4MS2A 4E4EA 3DGEA 5FNVA 3W7XA 3W7TA 2UUBB 1GM7A 5LXTA 2ZD9A 3W7WA 2LO1A 5IWAO 1W0KG 2ZNJA 4I9WA 4JPRA 1AI6A 2FTKA 1VQNV 4PD4F 3STZC 1QLNA 3CMAV 1R3IC 2X0LA 1SZXA 4TQFA 3P3NA 1VQKV 4YXWG 4DR3O 1FJGO 2EBOA 5B66Z 1YHQV 1BHBA 3OTFA 3CCMV 3JASA 4J80A 1E1QG 1PKXA 1JFFB 5H6RA 4J9YB 1TAEA 1BE3H 3KCYA 2HP8A 4XDKA 1JJOA 2JGDB 4RQFA 3QNEA 4F6EA 3QTCA 4O4HB 2B1IA 1HNXO 2PGGA 4PELA 2ZXWC 1IBMB 4WFAV 1BHAA 4X64B 2A0LA 2VQFB 5EC2C 1KP3A 4LR3A 1EN4A 4GX5A 1PPJH 5A2QN 1FFXB 4LWSB 3H1KH 3CCSV 1P7BA 1IXMA 2C2AA 4IIJB 2EIJC 4JI4B 1K9MW 5EYPB 1M57C 3HKCA 4Q6GA 3JAMN 4I4TB 1BL8A 3ZHRA 2CH7B 4JAVA 3FFQA 4LF9O 4HNAA 1QVGU 4KHPB 4CC6A 2WLJA 2B9ZA 1VEWA 1YXBA 1EBOA 2DYRB 1FJGB 1P7GA 3E83A 4LF6B 1R6KA 3B40A 3ETQA 2WLHA 1GRJA 1NH2B 4FZ0A 1V55C 1Q81W 4RWUA 1QBZA 3RW0A 4LFBB 1F4MA 3SJAC 3HKEB 5LOVA 3ABLB 4MSWC 4B3TO 3ZMUA 4B3MB 5LMUO 2XAHA 1BGYH 2KKWA 3UM7A 4DR5O 2E3CA 4FLZA 1FAFA 1NVPD 4N23A 5LBQA 3N2GB 1AROP 4O4JB 4G2KA 3L74H 3RWRD 1TVKB 4PI2A 1OCOC 1YIJV 4OX9O 2Y4UA 1VQ6V 4RUEA 3OW2U 4NXMO 3RN4A 1AJPA 5IJ9A 4JTCB 1KKCA 1PD3A 4AQYB 4GKJO 1HNWB 5LMNB 4H44B 2OIEA 4I50A 3ABUA 4O4LA 4MTGA 4DV0O 4X65B 4EB6B 4RAIA 1OZ0A 1RPOA 1B06A 4OPAA 2BE3A 2YSUB 3S3XA 3SYQA 1ZLZA 1H2SB 2HLDG 1TGOA 2GHYA 3VQVA 2OTLV 4JV5B 3CCQV 3VBBA 2JJ1G 2ARHA 4O4IA 5D5QA 4QE7A 4ZI7B 5TISZ 3WG7B 2CTWA 3BA8A 3T1CA 4QPKA 3OMIB 3RYIA 3OTOO 1K4DC 3H1HH 2Z5UA 1GH6A 5H2FZ 2XAFA 3BA9A 5LA6A 1MMMA 1THZA 2ITCC 4CBCA 2L35A 1OCCC 3JD0A 3OEHG 2HVKC 3K0DA 3JD1A 3CPWU 4JYAO 3CMEV 1XI1A 1Y6XA 3SJCC 4JI5B 3T4DA 1FXKB 1XBLA 4B08A 4WFEA 2PYLA 3C90A 1AR1B 2X6AA 1NTKH 5J2UB 1VF6A 1OJHA 2DN9A 2IJHA 1P49A 3MAQA 2YXLA 4B7EA 5LHGA 4CS3A 5LHIA 4DV2O 4IHJA 3CRMA 4I9QA 3RYHB 3FYEB 3TGUH 3OEEG 5B1BB 2HJDA 1KU9A 4UVCA 3OMNB 1AJQA 5EBWC 1XHXA 2GSMB 4X89A 4B7KA 3ABTA 4DR1O 3E8GA 2EULA 4R7CA 4P9OA 1I5XA 3WB2A 4R6ZA 3F7YC 1HDJA 1JOYA 2DOSA 1O9GA 1JQ0A 3K79A 3ZEDA 4DV5B 3C3TA 1QNMA 4MTXA 4FFBB 3K06A 2ATKC 1KBHA 4O2BB 3G6BA 5LP6C 1EM1A 4QE9A 5DM6V 2X6CA 2UU9B 4UCVA 3ZN1A 1T5EA 1R73A 1Y66A 3AG2B 2WA4A 4X1YA 1M9NA 3BRCA 4J7JA 3ZMZA 3M7MX 4X88A 4JASA 3U10A 1COWG 2IU0A 1XOUA 3UT5B 4ZIBA 2W0FC 2EILB 4MW3A 4ZOLA 4Z2WA 1AB3A 1QLEC 3MD0A 1YTFD 3CJHB 4X1KB 4BW5A 2JS3A 4OGQB 3CC4V 1W2BU 4MVMA 1RSOA 5ITZB 4GKKO 5B1AC 4NXNB 5IJ0B 3H1JH 4TUYA 3AG3C 4DW0A 1G4YB 5L3CA 1V9PA 1JX9A 3DSQA 1NI8A 5GW7A 4DUZB 1VQLV 3CC2V 1US6A 5IE9A 2Q7EA 3O65A 3VOUA 4P9PA 1I7FA 5L3BA 3ASOC 4JI0O 4JAUA 4ZHQA 3BY6A 2JK5C 1K97A 3JSNA 1M93A 5EK0A 1J5EB 3ASNB 3D36A 2VQEB 2EZOA 1QVFU 3RYCA 2UXXA 3CRRA 3CCEV 3E86A 5BR8O 3JAKB 5LYJB 4DV1B 3O9OA 4CZZA 2W6JG 3J80N 1ENVA 2EINC 4K3AA 4H37A 1L0NH 4DR7O 4NTXA 1L0LH 2LP7A 4F6RA 2EJRA 2WLIB 2PY5A 3PJSK 2CDYA 1H2KA 2Z3YA 2M6YA 2AZ2A 1RFYA 3WB0A 2N05A 3D3IA 3SPJA 3CWBH 4FMTA 2Q6AA 2GBOA 4NR1A 1KUQA 1LUWA 4JI8O 3JAWA 1V54C 3TXQA 4DV7B 1I5YA 5E1AC 1DK1A 3OT7A 5KMGA 2RMKB 2NNUA 5FNVB 4ASUG 2PF4E 5LXTB 3T1HB 5EIBD 5B5EZ 1K33A 1HR0O 1AP6A 4GX1A 1Q82W 1E1RG 4H13B 4JAAA 3FAVA 1G6UA 3LSSA 4DR2B 4LF4B 1W0JG 2F66C 2EZPA 4DR4O 1FD9A 2IJKA 5LGTA 1F7YA 2HEPA 2YI9A 2FB5A 4DV3O 2WSSG 1NTMH 1MZEA 1BQ0A 3JALA 2E74B 4D6TH 3JCUZ 1N34O 3JASB 4LH6A 3X2QC 3WFVA 2ZIMA 1IBKO 3M99B 1SS3A 3A0RA 5IYZA 4GZRB 3L70H 3RGBA 5JJEB 3ABMC 3KG2A 1KYOF 2BTQA 3EHBB 2P4VA 4BIOA 2Q7GA 1IXBA 1X4TA 5FL7G 4DUYB 1I08A 1ZX3A 4HBNA 3OM3B 3HKCB 3N27A 1JA8A 3H1LH 3LNMB 5D5PA 2PTMA 3TETA 1JMKC 2P7TC 1K5QA 1Y76A 5IY5B 3A0BZ 1FKAO 4I0XA 2JIZG 2EIKC 2XAQA 3AG7A 1Q6IA 1DTOA 1MA1A 4HNAB 5K1XA 2UUBO 4DR6B 1S5JA 3H01A 4X62B 1ROPA 2DJVA 3HB3B 5K1PA 2Y4TA 3BEHA 1PL0A 4DV3B 1HWYA 5FPOA 3D3QA 5LOVB 4BAYA 4CC5A 3F5TA 4DV4B 3AG1C 4I5SA 2Q69A 4FLTA 2Q9LA 3SYAA 2GTAA 1PNMA 3ZMSA 1NR1A 3OAAG 3ETDA 3SJBC 3ZN0A 1SQQH 2ZE8A 2LQTA 4WFHA 3OMAB 3OR7C 2Q0OC 2XT9A 3LSUA 3HKDA 3EVKA 3OE7G 1IBMO 5CA0A 3IC7A 3G6EV 2DW4A 4X64O 5IJ9B 2VQFO 1XNRB 2ZINA 2JGUA 4JZ2A 2QSAA 1WN7A 3VQXA 1XDCA 1M90W 1QCEA 1N36B 3VQYA 4W4KA 4JI4O 4I50B 2IW5A 3DTUB 1LUVA 2JJ2G 4O4LB 2ZKOA 2QR4A 2LFRA 3IGAC 2V1DA 3A0HZ 1KKDA 4O4IB 1B3QA 4UVAA 4KHPO 4WF9V 3LUTB 1AR5A 4LF6O 2DWEC 4ZBMA 3RYIB 5CB4A 1H8EG 4UXNA 2HHHB 1WJZA 3JCZA 5LA6B 1M1KW 4LFBO 4ABMA 2ZDIC 5JVDA 2CUGA 1SRYA 2MW2B 3PN1A 2Q4PA 3ZS8C 4XDJA 4B3MO 2Z0AA 1IDSA 4MTFA 4PDVA 2ILMA 1VIBA 3B77A 2E5LB 1RPRA 2M7WA 3BVOA 3U11A 4ZKIA 1PM9A 4GYCB 4UCOA 5CBGA 2V7QG 2QM8A 5AG2A 5KLVH 4IHJB 3P3PA 1SERA 5DN6G 4DV6B 2ZNIA 4AQYO 3D8CA 3BHPA 1HNWO 2Q5ZA 5LMNO 2CE4A 3B8NA 1KD1W 2H3OA 3CC7V 4QJFB 2RCVA 4YJ3A 2A79B 4FZ1A 4JTDB 2BSKA 1HW7A 2ZXWB 2XAJA 4FLYA 2LJ2A 2W0XA 2DYRC 4U7NA 2CTQA 2GTSA 4X65O 3K04A 4JV5O 1J95A 3IFXA 2YIAA 3I55V 3EXAA 1H38A 4JF3A 3ABLC 1SZTA 3G4SV 1ZL8A 5CA1A 4JGSA 1HNZB 3VQWA 1N32B 4K0KB 2DWDC 1XREA 1DLBA 1VARA 1MABG 2GUZA 2P6JA 4OPHA 4LFCB 4QIWF 4Q20A 3BPZA 4UCUA 3ABKB 4JI2O 4KP4A 5KHJA 4X66B 3G80A 4JI5O 2F95B 4FM1A 2LW7A 2OIGA 3LDEA 4X1YB 5EIBC 4TSFG 1WNSA 2QWPB 3AG4C 3FX7A 4EEQA 4RUFA 2QWOB 4J10A 2VRZA 1K5SA 5BXZA 4ZOLB 3OFNG 1AJNA 4FM0A 4HAMA 2D3OW 2OCCB 3BABA 5EBMC 2BCCH 4H0LB 3B2EE 2YICA 1GN6A 3FKSG 4DYLA 1RSOB 2NLJC 1BSMA 2P5OA 4EFEA 4TUYB 2RN9A 1KC8W 2O57A 4MVRA 1OCOB 1SA0A 2P90A 5JCOC 1X59A 2HR3A 1WAZA 1YSCA 1OCRB 2QWNB 5KAFZ 3WG7C 5FLXN 2F93B 2Y48A 1NT2B 3CEIA 4L87A 4U7OA 4ZHQB 1YCIA 2JEXA 2VS0A 2QEXV 4FLVA 1URFA 4GCZA 4X9QA 3RYCB 4GLXA 3GB7C 4PV1B 4JI2B 1FXKC 2P4KA 4DV5O 5CBHA 2LW1A 2AGAA 2FYUH 2HVJC 3J81N 1WB7A 3FB5C 1NU1H 4I55A 4UB6Z 3R65A 4FLUA 3P30A 3FD9A 1W59A 3K5MA 2NN4A 2UU9O 4F6RB 4WCEV 4LFAB 1U97A 2JRIA 4UCTA 5GTIZ 4TV9A 1XMOB 2RQ6A 4GX0A 2BTOA 1F4NA 3LDDA 1OCCB 3GWOA 4B3RB 2RDCA 1N33B 2QWRB 1FYJA 3JAWB 5BMVB 5JJNB 4TV8A 1KMIZ 2QGNA 1Q8IA 2F4VB 2OT5A 4NXNO 5C8YA 3JATA 3K9SA 4GUNA 3QVNA 1ORQC 5KMGB 1I94B 2UXBB 3DC5A 4DO2A 4LF5B 4HYOA 3TK1A 4DUZO 4B3SB 1P84F 4TOIA 1TUBA 3S3WA 2B1GA 4J11A 3ZRXA 1R3KC 2IJIA 4DXWA 4FIPC 1H2MA 3FAVB 3MDSA 3JARA 2AW9A 1J5EO 5JH7A 4MVUA 4LF8B 4UV8A 2FL4A 2VQEO 4KXRA 1LR1A 1KB9F 3JALB 3CB2A 1MSDA 2X7RB 2ZE5A 3AG2C 2UUCB 1NQTA 4PDRA 4DV1O 2ZT9B 2KG7A 4IT5A 2XOKG 2EILC 5IYZB 4PI0A 3W7UA 4KFMA 3K5OA 2Q68A 3SJQC 4FJCC 2BTQB 3R66A 4JYYA 4BIZA 1YJNV 1Y67A 3BFRA 2EJ7A 4OXSA 3WU2Z 5BZBA 1WPXA 3BAAA 3WB1A 2PYJA 3E35A 4P30A 2FKXA 1YJWV 3KKYA 2OCHA 4DV7O 1IX9A 1FFTB 1NKDA 3UCSC 2ZQMA 2DQ0A 1VQMV 1Y76B 1UPGA 4I0XB 1XMQB 3B09A 2W6IG 3J7AU 3ZRWA 3OD4A 1XEQA 3ASNC 3IJ4A 4FFKA 4J7ZA 3T1HO 4Z1MG 1DF5A 1CEZA 2UXCB 4BW9A 2PZSA 3OUSA 1P4RA 5KHHA 4FLXA 1AP5A 1F51A 3K0GA 1VQPV 3CHXA 4DR2O 4LF4O 5DECA 2UXDB 1AILA 1I0HA 4I7ZB 1A32A 4U3JA 4UCSA 2A06H 3HR0A 3Q4HA 3N2KA 4HZ3A 1R3JC 5EZYA 3ZHSA 2CK3G 2D2CB 4G28B 2E75B 1VQOV 1NR7A 1NH2D 2YXYA 5A9GA 1NTZH 2PI4A 1FPOA 1EZJA 1MZFA 5CN0A 5J2TA 1VQ5V 3A2FA 1GAXA 2DYSB 1AVMA 1ZAUA 3HKDB 2KB1A 5CA0B 2QKSA 2ZR2A 5BMVA 3L75H 1GN3A 2EINB 1SQFA 2A3QA 4UVBA 2UUAB 4DUYO 4PDLA 4JI7B 3ZIAG 2YEVA 2EX3A 4UFZA 4PHZA 1K4CC 1Z5WA 1JR9A 4MT8A 2QDOA 4YJ2A 5CBFA 1CPYA 2WAMA 1ZUQA 2R9RB 3BCCH 2Q7HA 3CE2A 4DR6O 2XASA 1IBLB 1SQBH 4X62O 4Z1VA 2YIBA 1Q5OA 3LSQA 4DRXA 4UV9A 5CB4B 3E22A 3CD6V 2JS5A 1YZBA 1RM1B 5JVDB 1M56B 2H94A 5KHKA 1HP8A 1JCHA 4NTYA 2OWOA 1WA8A 2GDSA 1S0VA 5JQGA 4BWAA 3L72H 4DV4O 3OGCC 3SR2C 2WLLA 5LL6Y 2ZIOA 4QGPA 4PDMA 2PI5A 4WFFA 3HPLC 4DK1A 3K58A 3ZRVA 3ETEA 4WBNA 1RP3B 5GONA 5BY1A 1GO3F 3G67A 2L6LA 1AI7A 5H6QA 1NBMG 1KECA 2IJJA 1YEWA 1XL6A 5LP6A 1Z5VA 2CGNA 4XDLA 3X2QB 1XNRO 3K03A 1E79G 5IY5C 3SGIA 1L8DA 3JD4A 4WFGA 1N36O 1Q7YW 4YJ3B 2QTOA 3I5DA 2BSKB 1WP8A 4YHHB 2Q0AA 3ABMB 2LFSA 4DW1A 1SQXH 1IVSA 2K1EA 3CCRV 1PNKA 3MHSC 3AEIA 1ZL8B 5CA1B 2XAGA 4GT1A 2LGWA 2HHHO 2GUZB 5KAIZ 5B3SB 3SPHA 2IU3A 5LHHA 2K9PA 3RYFA 1UJWB 3T1YB 3C3SA 4F4LA 4D7TA 4MVSA 3L73H 3TXSA 1IURA 4X8AA 1AR4A 4G27B 2E5LO 1S76D 4PA4A 3L71H 3ZJZA 2QWQB 3E8HA 4JI1B 2DE0X 3P32A 4O2AA 4X1IA 2KQXA 3CCJV 2Q73A 2WA3A 3QF7A 2JVDA 1OCZB 2EIMB 2IBZH 3IAYA 2Y69B 2ZM6B 4DV6O 4JI6B 1SQVH 4YY3B 3CX5F 5DEDA 1VP7A 1K34A 1SA0B 2V4DA 1N4CA 3A8TA 2JDIG 5H5NA 3ZBHA 2XHBA 1JJ2U 2NR5A 1QHTA 4A5UB 1VQ9V 2WPDG 3TJTA 3I56V 4X20A 3SDLA 1Y4MA 4JI3B 5IDJA 1TUEB 3B8MA 3QO8A 4MTOA 3H9VA 1HNZO 1N32O 4K0KO 4LFCO 2WLMA 4MVQA 2AHYA 5J9PC 4I55B 5FPRA 4BR6A 5KA5A 1VF6C 2A9HA 4J9ZB 4X66O 3L9DA 3DC6A 3CXCU 1YTFB 4TV9B 3G71V 3UO3A 4LF7B 2CTRA 2OYQA 1SETA 1OV9A 5JWPA 3QO5A 1EN6A 2WWWA 4R50A 4TQDA 2YDEA 4TV8B 1UFIA 1YJ9V 1S72V 1YITV 1Y74A 1EZVH 5C8YB 3JATB 1GKFA 5KX5A 4FLWA 4CH5A 5B1NA 1XNQB 3SYOA 3SPCA 1BMFG 5KUMA 1H2NA 1TUBB 1PP9H 2ZCEA 4R8CA 3CS5A 2EIJB 5IWAB 1M57B 3JARB 4WFBV 5JH7B 5KHIA 3ABKC 3E8FA 3ZRSA 4IYHA 1G1XB 1ZSPA 4J41A 2QA4V 4DR3B 3APOA 1K8AW 2P67A 3EFFK 1S3JA 1GK9A
chains in the Genus database with same CATH topology
3L74H 3H1JH 1SQQH 3L73H 1NTKH 1SQPH 3H1HH 1SQVH 3H1LH 1NTZH 3CX5F 3L70H 1EZVH 1BCCH 3L71H 1NTMH 4D6TH 1BGYH 1KYOF 1KB9F 1PPJH 3CWBH 4PD4F 3H1KH 2A06H 1BE3H 2FYUH 4U3FH 3CXHF 1P84F 2BCCH 3BCCH 5KLVH 1NU1H 3L72H 2IBZH 1SQXH 3TGUH 1L0NH 3H1IH 3L75H 1PP9H 1SQBH 1L0LH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L74 H;  3H1J H;  1SQQ H;  3L73 H;  1NTK H;  1SQP H;  3H1H H;  1SQV H;  3H1L H;  1NTZ H;  3CX5 F;  3L70 H;  1EZV H;  1BCC H;  3L71 H;  1NTM H;  4D6T H;  1BGY H;  1KYO F;  1KB9 F;  1PPJ H;  3CWB H;  4PD4 F;  3H1K H;  2A06 H;  1BE3 H;  2FYU H;  4U3F H;  3CXH F;  1P84 F;  2BCC H;  3BCC H;  5KLV H;  1NU1 H;  3L72 H;  2IBZ H;  1SQX H;  3TGU H;  1L0N H;  3H1I H;  3L75 H;  1PP9 H;  1SQB H;  1L0L H; 
#chains in the Genus database with same CATH topology
 4JTA B;  2UXN A;  4LCU C;  2N74 A;  2KG7 B;  1V55 B;  5EC1 C;  1O9H A;  2QKC A;  2XND G;  3M8A A;  2F23 A;  1YVW A;  2OCC C;  3QO7 A;  3ZHT A;  4LFA O;  2ZE7 A;  3AK2 A;  1XMO O;  1GN4 A;  2ZR3 A;  1HNX B;  3QG5 A;  3AK3 A;  3ZMV A;  3GWK C;  3H1I H;  3ICX A;  4PA9 A;  4JYB A;  4B3R O;  3CYO A;  3K5L A;  1N33 O;  3HKB A;  1OCR C;  2P22 C;  4LNU A;  1BT8 A;  2F4V O;  4PJ0 Z;  1N0J A;  1YDX A;  4KUM A;  4C7U A;  5IT9 N;  3AG4 B;  1MSW D;  1GTO A;  4NKG B;  1I94 O;  2UXB O;  3ZRW B;  4EKW A;  3U0Z A;  4LF5 O;  3D36 C;  3CCL V;  1SES A;  4B3S O;  4E2L A;  4LF9 B;  4NYK A;  1QQC A;  4K8Z A;  1MNG A;  2LGQ A;  2YC0 A;  4D7S A;  1K92 A;  3NXS A;  1KP2 A;  4U3J B;  4LF8 O;  1QR9 A;  1Z2G A;  3Q4H B;  3N2K B;  4IL6 Z;  4JZG A;  4RQE A;  1NJI W;  5EZY B;  5CMU A;  5HFL A;  2Q67 A;  2Y0P A;  2UUC O;  4B3T B;  1S77 D;  1SF9 A;  5LMU B;  4DR5 B;  2A7W A;  1VQ4 V;  3ZHU A;  1JFF A;  3UO2 A;  3JD3 A;  5J2T B;  3E2E A;  2ZDI A;  3CCU V;  2JEU A;  5B1B C;  2JGD A;  5IYC O;  2Y0I A;  5KA6 A;  2YUA A;  4O4H A;  1DGS A;  4OX9 B;  5L3F A;  1BQZ A;  5IYD O;  4NXM B;  3MHH C;  2ETN A;  2R72 A;  3DXR B;  2YEV B;  4LC1 A;  3SPI A;  5JJJ B;  4GKJ B;  1FFX A;  2HJF C;  4LWS A;  4YJ2 B;  4J7K A;  1ZWI C;  5C93 A;  3LNN A;  1R6T A;  4IIJ A;  5EYP A;  1XMQ O;  3RT3 C;  1GM8 A;  4DV0 B;  4I4T A;  2HFE C;  4W4L A;  1VMG A;  2CH7 A;  2UXC O;  3ETG A;  4DRX B;  3E22 B;  4YIP A;  1FXV A;  4EFB A;  4QNH B;  3OGI B;  4YIO A;  3TCU A;  2UXD O;  3OTO B;  1WP7 A;  1WA8 B;  5L3E A;  5JQG B;  2QTS A;  2WLL B;  1AI5 A;  2AHZ A;  3HKE A;  4QPJ A;  3FB7 C;  1R1B A;  2YS8 A;  5E79 Z;  3SYP A;  1Q90 D;  4IYI A;  4WBN B;  4JYA B;  5GON B;  1WPB A;  1BS3 A;  2QE7 G;  3RVZ A;  4CH3 A;  1H2G A;  3K08 A;  1WLE A;  3N2G A;  4O4J A;  1SC5 B;  4PA6 A;  5LP6 B;  2F43 G;  1TVK A;  1SKV A;  1VQ8 V;  4MW8 A;  2QKA A;  1SQP H;  2H8P C;  3K3W A;  4DV2 B;  2YID A;  2UUA O;  3RVY A;  2QM7 A;  1B6Q A;  4JI7 O;  3W7S A;  2DQ3 A;  2VWJ A;  2QJ1 A;  1GMG A;  1NZ6 A;  1OHH G;  1L1F A;  1U96 A;  1QLE B;  3ZHQ A;  1B04 A;  3RBZ A;  3LDC A;  2YI8 A;  3K59 A;  5B1A B;  4P2Z A;  1G8M A;  1Q86 W;  4MVO A;  4EB6 A;  1IBL O;  3CCV V;  1VF7 A;  3K57 A;  2RNB A;  1F23 A;  4TWK A;  5HFM A;  4DR1 B;  3AG3 B;  4H33 A;  1JPX A;  4ZI7 A;  5JCO A;  2XUM A;  4AIL C;  2G38 A;  3E8B A;  4K8X A;  3RYF B;  3ASO B;  1CP9 A;  1SQG A;  3F5W C;  5L3D A;  1D5A A;  2DYS C;  3T2M A;  4UCR A;  2IH3 C;  2WLN A;  3ML0 A;  1FXH A;  4LP8 A;  1M4U A;  1FXK A;  2Q8V A;  4O2A B;  4X1I B;  3GVM A;  3NR7 A;  4GX2 A;  1R6N A;  2B5U A;  5J2U A;  1XQ8 A;  2HKO A;  5CA3 A;  1YF2 A;  3DXR A;  1MOF A;  3CRC A;  4LBE C;  4GKK B;  5IYB O;  1H8H G;  4L8J A;  3RYH A;  1XL4 A;  1KQS U;  2ODM A;  5F2V O;  4YHH O;  3KZI Z;  5L3G A;  3E89 A;  1V54 B;  2DMX A;  4BIU A;  3SYC A;  1RM1 C;  4X20 B;  2YXH A;  3IC9 A;  1M56 C;  4JI0 B;  2ADQ B;  2XTA A;  4J42 A;  1MG1 A;  1VQ7 V;  1NVP B;  3CXH F;  1K73 W;  1PV0 A;  3JD2 A;  1Q43 A;  4UB8 Z;  1EFR G;  5LGN A;  5BR8 B;  2ADP A;  5KUK A;  5LGU A;  2P06 A;  3T1Y O;  2RJZ A;  1VF5 B;  3FB6 C;  4FFB A;  2E76 B;  2FML A;  3UKM A;  1M5I A;  1Q3E A;  4O2B A;  3T4Z A;  1N8R W;  4ICG A;  4DR7 B;  4PA3 A;  4RO2 A;  3FYI B;  1XUQ A;  4JI1 O;  2CAZ C;  3OR6 C;  4NTW A;  3APQ A;  2R9I A;  3AK1 A;  4MVZ A;  2CGO A;  4CS2 A;  2ZE6 A;  1QU7 A;  4NVP A;  3CRA A;  1YI2 V;  3UT5 A;  3THO A;  1Y74 B;  3K5N A;  4LH7 A;  2ZM6 O;  1PNL A;  1AI4 A;  4YY3 O;  4JI6 O;  3JYC A;  3ZX6 A;  4JI8 B;  3CJH A;  1ZTE A;  4X1K A;  1WB8 A;  3CSX A;  5KX5 B;  1D5N A;  4FM2 A;  4FVM A;  4NB5 A;  4U3F H;  5ITZ A;  3UQ8 A;  1N0N A;  5IJ0 A;  2X6B A;  3K9A A;  3ZHV A;  1H2L A;  1K7D A;  2AXT Z;  1S5H C;  4AHC A;  2AZ0 A;  2HG5 C;  3JSL A;  5GTH Z;  2IM9 A;  1NS1 A;  1LNQ A;  3RFR A;  2VWK A;  1BCC H;  1EN5 A;  1HR0 B;  5B3S C;  1D2D A;  3B4S A;  2PUS A;  2ITD C;  4N21 A;  3CP1 A;  4K35 A;  1XHZ A;  1CXZ B;  4JI3 O;  2EIK B;  2F1M A;  1Q6U A;  3KCX A;  4CH4 A;  2QM4 A;  4DR4 B;  3SPG A;  5B1O A;  1DF4 A;  1Q6H A;  1XIL A;  4KL1 A;  3ZMT A;  2R9A A;  2YIB D;  1N34 B;  5KHG A;  3JAK A;  2OTJ V;  1S5L Z;  2CTP A;  1TA8 A;  4CH6 A;  5LYJ A;  1IBK B;  4AI8 A;  1OCZ C;  2EIM C;  1PL4 A;  4TT3 G;  2IH1 C;  1QR8 A;  2Y69 C;  2BOB C;  3CRQ A;  3AG1 B;  4LF7 O;  2WLI A;  4JYC A;  3F7V C;  4CS4 A;  2R70 A;  4XBF A;  3HKB B;  1FS0 G;  2KSD A;  4UUJ C;  3FB8 C;  1K3E A;  5EBL C;  4LNU B;  5H9C A;  1R3L C;  3OUF A;  4DK0 A;  1GM9 A;  1JVM A;  1BZK A;  3ZCC A;  2WLK A;  4FK5 C;  3STL C;  4FPP A;  2BOC C;  1GN2 A;  4PA7 A;  2GV9 A;  2MK3 A;  1XNQ O;  4IGG A;  1IZ3 A;  2N04 A;  4MS2 A;  4E4E A;  3DGE A;  5FNV A;  3W7X A;  3W7T A;  2UUB B;  1GM7 A;  5LXT A;  2ZD9 A;  3W7W A;  2LO1 A;  5IWA O;  1W0K G;  2ZNJ A;  4I9W A;  4JPR A;  1AI6 A;  2FTK A;  1VQN V;  4PD4 F;  3STZ C;  1QLN A;  3CMA V;  1R3I C;  2X0L A;  1SZX A;  4TQF A;  3P3N A;  1VQK V;  4YXW G;  4DR3 O;  1FJG O;  2EBO A;  5B66 Z;  1YHQ V;  1BHB A;  3OTF A;  3CCM V;  3JAS A;  4J80 A;  1E1Q G;  1PKX A;  1JFF B;  5H6R A;  4J9Y B;  1TAE A;  1BE3 H;  3KCY A;  2HP8 A;  4XDK A;  1JJO A;  2JGD B;  4RQF A;  3QNE A;  4F6E A;  3QTC A;  4O4H B;  2B1I A;  1HNX O;  2PGG A;  4PEL A;  2ZXW C;  1IBM B;  4WFA V;  1BHA A;  4X64 B;  2A0L A;  2VQF B;  5EC2 C;  1KP3 A;  4LR3 A;  1EN4 A;  4GX5 A;  1PPJ H;  5A2Q N;  1FFX B;  4LWS B;  3H1K H;  3CCS V;  1P7B A;  1IXM A;  2C2A A;  4IIJ B;  2EIJ C;  4JI4 B;  1K9M W;  5EYP B;  1M57 C;  3HKC A;  4Q6G A;  3JAM N;  4I4T B;  1BL8 A;  3ZHR A;  2CH7 B;  4JAV A;  3FFQ A;  4LF9 O;  4HNA A;  1QVG U;  4KHP B;  4CC6 A;  2WLJ A;  2B9Z A;  1VEW A;  1YXB A;  1EBO A;  2DYR B;  1FJG B;  1P7G A;  3E83 A;  4LF6 B;  1R6K A;  3B40 A;  3ETQ A;  2WLH A;  1GRJ A;  1NH2 B;  4FZ0 A;  1V55 C;  1Q81 W;  4RWU A;  1QBZ A;  3RW0 A;  4LFB B;  1F4M A;  3SJA C;  3HKE B;  5LOV A;  3ABL B;  4MSW C;  4B3T O;  3ZMU A;  4B3M B;  5LMU O;  2XAH A;  1BGY H;  2KKW A;  3UM7 A;  4DR5 O;  2E3C A;  4FLZ A;  1FAF A;  1NVP D;  4N23 A;  5LBQ A;  3N2G B;  1ARO P;  4O4J B;  4G2K A;  3L74 H;  3RWR D;  1TVK B;  4PI2 A;  1OCO C;  1YIJ V;  4OX9 O;  2Y4U A;  1VQ6 V;  4RUE A;  3OW2 U;  4NXM O;  3RN4 A;  1AJP A;  5IJ9 A;  4JTC B;  1KKC A;  1PD3 A;  4AQY B;  4GKJ O;  1HNW B;  5LMN B;  4H44 B;  2OIE A;  4I50 A;  3ABU A;  4O4L A;  4MTG A;  4DV0 O;  4X65 B;  4EB6 B;  4RAI A;  1OZ0 A;  1RPO A;  1B06 A;  4OPA A;  2BE3 A;  2YSU B;  3S3X A;  3SYQ A;  1ZLZ A;  1H2S B;  2HLD G;  1TGO A;  2GHY A;  3VQV A;  2OTL V;  4JV5 B;  3CCQ V;  3VBB A;  2JJ1 G;  2ARH A;  4O4I A;  5D5Q A;  4QE7 A;  4ZI7 B;  5TIS Z;  3WG7 B;  2CTW A;  3BA8 A;  3T1C A;  4QPK A;  3OMI B;  3RYI A;  3OTO O;  1K4D C;  3H1H H;  2Z5U A;  1GH6 A;  5H2F Z;  2XAF A;  3BA9 A;  5LA6 A;  1MMM A;  1THZ A;  2ITC C;  4CBC A;  2L35 A;  1OCC C;  3JD0 A;  3OEH G;  2HVK C;  3K0D A;  3JD1 A;  3CPW U;  4JYA O;  3CME V;  1XI1 A;  1Y6X A;  3SJC C;  4JI5 B;  3T4D A;  1FXK B;  1XBL A;  4B08 A;  4WFE A;  2PYL A;  3C90 A;  1AR1 B;  2X6A A;  1NTK H;  5J2U B;  1VF6 A;  1OJH A;  2DN9 A;  2IJH A;  1P49 A;  3MAQ A;  2YXL A;  4B7E A;  5LHG A;  4CS3 A;  5LHI A;  4DV2 O;  4IHJ A;  3CRM A;  4I9Q A;  3RYH B;  3FYE B;  3TGU H;  3OEE G;  5B1B B;  2HJD A;  1KU9 A;  4UVC A;  3OMN B;  1AJQ A;  5EBW C;  1XHX A;  2GSM B;  4X89 A;  4B7K A;  3ABT A;  4DR1 O;  3E8G A;  2EUL A;  4R7C A;  4P9O A;  1I5X A;  3WB2 A;  4R6Z A;  3F7Y C;  1HDJ A;  1JOY A;  2DOS A;  1O9G A;  1JQ0 A;  3K79 A;  3ZED A;  4DV5 B;  3C3T A;  1QNM A;  4MTX A;  4FFB B;  3K06 A;  2ATK C;  1KBH A;  4O2B B;  3G6B A;  5LP6 C;  1EM1 A;  4QE9 A;  5DM6 V;  2X6C A;  2UU9 B;  4UCV A;  3ZN1 A;  1T5E A;  1R73 A;  1Y66 A;  3AG2 B;  2WA4 A;  4X1Y A;  1M9N A;  3BRC A;  4J7J A;  3ZMZ A;  3M7M X;  4X88 A;  4JAS A;  3U10 A;  1COW G;  2IU0 A;  1XOU A;  3UT5 B;  4ZIB A;  2W0F C;  2EIL B;  4MW3 A;  4ZOL A;  4Z2W A;  1AB3 A;  1QLE C;  3MD0 A;  1YTF D;  3CJH B;  4X1K B;  4BW5 A;  2JS3 A;  4OGQ B;  3CC4 V;  1W2B U;  4MVM A;  1RSO A;  5ITZ B;  4GKK O;  5B1A C;  4NXN B;  5IJ0 B;  3H1J H;  4TUY A;  3AG3 C;  4DW0 A;  1G4Y B;  5L3C A;  1V9P A;  1JX9 A;  3DSQ A;  1NI8 A;  5GW7 A;  4DUZ B;  1VQL V;  3CC2 V;  1US6 A;  5IE9 A;  2Q7E A;  3O65 A;  3VOU A;  4P9P A;  1I7F A;  5L3B A;  3ASO C;  4JI0 O;  4JAU A;  4ZHQ A;  3BY6 A;  2JK5 C;  1K97 A;  3JSN A;  1M93 A;  5EK0 A;  1J5E B;  3ASN B;  3D36 A;  2VQE B;  2EZO A;  1QVF U;  3RYC A;  2UXX A;  3CRR A;  3CCE V;  3E86 A;  5BR8 O;  3JAK B;  5LYJ B;  4DV1 B;  3O9O A;  4CZZ A;  2W6J G;  3J80 N;  1ENV A;  2EIN C;  4K3A A;  4H37 A;  1L0N H;  4DR7 O;  4NTX A;  1L0L H;  2LP7 A;  4F6R A;  2EJR A;  2WLI B;  2PY5 A;  3PJS K;  2CDY A;  1H2K A;  2Z3Y A;  2M6Y A;  2AZ2 A;  1RFY A;  3WB0 A;  2N05 A;  3D3I A;  3SPJ A;  3CWB H;  4FMT A;  2Q6A A;  2GBO A;  4NR1 A;  1KUQ A;  1LUW A;  4JI8 O;  3JAW A;  1V54 C;  3TXQ A;  4DV7 B;  1I5Y A;  5E1A C;  1DK1 A;  3OT7 A;  5KMG A;  2RMK B;  2NNU A;  5FNV B;  4ASU G;  2PF4 E;  5LXT B;  3T1H B;  5EIB D;  5B5E Z;  1K33 A;  1HR0 O;  1AP6 A;  4GX1 A;  1Q82 W;  1E1R G;  4H13 B;  4JAA A;  3FAV A;  1G6U A;  3LSS A;  4DR2 B;  4LF4 B;  1W0J G;  2F66 C;  2EZP A;  4DR4 O;  1FD9 A;  2IJK A;  5LGT A;  1F7Y A;  2HEP A;  2YI9 A;  2FB5 A;  4DV3 O;  2WSS G;  1NTM H;  1MZE A;  1BQ0 A;  3JAL A;  2E74 B;  4D6T H;  3JCU Z;  1N34 O;  3JAS B;  4LH6 A;  3X2Q C;  3WFV A;  2ZIM A;  1IBK O;  3M99 B;  1SS3 A;  3A0R A;  5IYZ A;  4GZR B;  3L70 H;  3RGB A;  5JJE B;  3ABM C;  3KG2 A;  1KYO F;  2BTQ A;  3EHB B;  2P4V A;  4BIO A;  2Q7G A;  1IXB A;  1X4T A;  5FL7 G;  4DUY B;  1I08 A;  1ZX3 A;  4HBN A;  3OM3 B;  3HKC B;  3N27 A;  1JA8 A;  3H1L H;  3LNM B;  5D5P A;  2PTM A;  3TET A;  1JMK C;  2P7T C;  1K5Q A;  1Y76 A;  5IY5 B;  3A0B Z;  1FKA O;  4I0X A;  2JIZ G;  2EIK C;  2XAQ A;  3AG7 A;  1Q6I A;  1DTO A;  1MA1 A;  4HNA B;  5K1X A;  2UUB O;  4DR6 B;  1S5J A;  3H01 A;  4X62 B;  1ROP A;  2DJV A;  3HB3 B;  5K1P A;  2Y4T A;  3BEH A;  1PL0 A;  4DV3 B;  1HWY A;  5FPO A;  3D3Q A;  5LOV B;  4BAY A;  4CC5 A;  3F5T A;  4DV4 B;  3AG1 C;  4I5S A;  2Q69 A;  4FLT A;  2Q9L A;  3SYA A;  2GTA A;  1PNM A;  3ZMS A;  1NR1 A;  3OAA G;  3ETD A;  3SJB C;  3ZN0 A;  1SQQ H;  2ZE8 A;  2LQT A;  4WFH A;  3OMA B;  3OR7 C;  2Q0O C;  2XT9 A;  3LSU A;  3HKD A;  3EVK A;  3OE7 G;  1IBM O;  5CA0 A;  3IC7 A;  3G6E V;  2DW4 A;  4X64 O;  5IJ9 B;  2VQF O;  1XNR B;  2ZIN A;  2JGU A;  4JZ2 A;  2QSA A;  1WN7 A;  3VQX A;  1XDC A;  1M90 W;  1QCE A;  1N36 B;  3VQY A;  4W4K A;  4JI4 O;  4I50 B;  2IW5 A;  3DTU B;  1LUV A;  2JJ2 G;  4O4L B;  2ZKO A;  2QR4 A;  2LFR A;  3IGA C;  2V1D A;  3A0H Z;  1KKD A;  4O4I B;  1B3Q A;  4UVA A;  4KHP O;  4WF9 V;  3LUT B;  1AR5 A;  4LF6 O;  2DWE C;  4ZBM A;  3RYI B;  5CB4 A;  1H8E G;  4UXN A;  2HHH B;  1WJZ A;  3JCZ A;  5LA6 B;  1M1K W;  4LFB O;  4ABM A;  2ZDI C;  5JVD A;  2CUG A;  1SRY A;  2MW2 B;  3PN1 A;  2Q4P A;  3ZS8 C;  4XDJ A;  4B3M O;  2Z0A A;  1IDS A;  4MTF A;  4PDV A;  2ILM A;  1VIB A;  3B77 A;  2E5L B;  1RPR A;  2M7W A;  3BVO A;  3U11 A;  4ZKI A;  1PM9 A;  4GYC B;  4UCO A;  5CBG A;  2V7Q G;  2QM8 A;  5AG2 A;  5KLV H;  4IHJ B;  3P3P A;  1SER A;  5DN6 G;  4DV6 B;  2ZNI A;  4AQY O;  3D8C A;  3BHP A;  1HNW O;  2Q5Z A;  5LMN O;  2CE4 A;  3B8N A;  1KD1 W;  2H3O A;  3CC7 V;  4QJF B;  2RCV A;  4YJ3 A;  2A79 B;  4FZ1 A;  4JTD B;  2BSK A;  1HW7 A;  2ZXW B;  2XAJ A;  4FLY A;  2LJ2 A;  2W0X A;  2DYR C;  4U7N A;  2CTQ A;  2GTS A;  4X65 O;  3K04 A;  4JV5 O;  1J95 A;  3IFX A;  2YIA A;  3I55 V;  3EXA A;  1H38 A;  4JF3 A;  3ABL C;  1SZT A;  3G4S V;  1ZL8 A;  5CA1 A;  4JGS A;  1HNZ B;  3VQW A;  1N32 B;  4K0K B;  2DWD C;  1XRE A;  1DLB A;  1VAR A;  1MAB G;  2GUZ A;  2P6J A;  4OPH A;  4LFC B;  4QIW F;  4Q20 A;  3BPZ A;  4UCU A;  3ABK B;  4JI2 O;  4KP4 A;  5KHJ A;  4X66 B;  3G80 A;  4JI5 O;  2F95 B;  4FM1 A;  2LW7 A;  2OIG A;  3LDE A;  4X1Y B;  5EIB C;  4TSF G;  1WNS A;  2QWP B;  3AG4 C;  3FX7 A;  4EEQ A;  4RUF A;  2QWO B;  4J10 A;  2VRZ A;  1K5S A;  5BXZ A;  4ZOL B;  3OFN G;  1AJN A;  4FM0 A;  4HAM A;  2D3O W;  2OCC B;  3BAB A;  5EBM C;  2BCC H;  4H0L B;  3B2E E;  2YIC A;  1GN6 A;  3FKS G;  4DYL A;  1RSO B;  2NLJ C;  1BSM A;  2P5O A;  4EFE A;  4TUY B;  2RN9 A;  1KC8 W;  2O57 A;  4MVR A;  1OCO B;  1SA0 A;  2P90 A;  5JCO C;  1X59 A;  2HR3 A;  1WAZ A;  1YSC A;  1OCR B;  2QWN B;  5KAF Z;  3WG7 C;  5FLX N;  2F93 B;  2Y48 A;  1NT2 B;  3CEI A;  4L87 A;  4U7O A;  4ZHQ B;  1YCI A;  2JEX A;  2VS0 A;  2QEX V;  4FLV A;  1URF A;  4GCZ A;  4X9Q A;  3RYC B;  4GLX A;  3GB7 C;  4PV1 B;  4JI2 B;  1FXK C;  2P4K A;  4DV5 O;  5CBH A;  2LW1 A;  2AGA A;  2FYU H;  2HVJ C;  3J81 N;  1WB7 A;  3FB5 C;  1NU1 H;  4I55 A;  4UB6 Z;  3R65 A;  4FLU A;  3P30 A;  3FD9 A;  1W59 A;  3K5M A;  2NN4 A;  2UU9 O;  4F6R B;  4WCE V;  4LFA B;  1U97 A;  2JRI A;  4UCT A;  5GTI Z;  4TV9 A;  1XMO B;  2RQ6 A;  4GX0 A;  2BTO A;  1F4N A;  3LDD A;  1OCC B;  3GWO A;  4B3R B;  2RDC A;  1N33 B;  2QWR B;  1FYJ A;  3JAW B;  5BMV B;  5JJN B;  4TV8 A;  1KMI Z;  2QGN A;  1Q8I A;  2F4V B;  2OT5 A;  4NXN O;  5C8Y A;  3JAT A;  3K9S A;  4GUN A;  3QVN A;  1ORQ C;  5KMG B;  1I94 B;  2UXB B;  3DC5 A;  4DO2 A;  4LF5 B;  4HYO A;  3TK1 A;  4DUZ O;  4B3S B;  1P84 F;  4TOI A;  1TUB A;  3S3W A;  2B1G A;  4J11 A;  3ZRX A;  1R3K C;  2IJI A;  4DXW A;  4FIP C;  1H2M A;  3FAV B;  3MDS A;  3JAR A;  2AW9 A;  1J5E O;  5JH7 A;  4MVU A;  4LF8 B;  4UV8 A;  2FL4 A;  2VQE O;  4KXR A;  1LR1 A;  1KB9 F;  3JAL B;  3CB2 A;  1MSD A;  2X7R B;  2ZE5 A;  3AG2 C;  2UUC B;  1NQT A;  4PDR A;  4DV1 O;  2ZT9 B;  2KG7 A;  4IT5 A;  2XOK G;  2EIL C;  5IYZ B;  4PI0 A;  3W7U A;  4KFM A;  3K5O A;  2Q68 A;  3SJQ C;  4FJC C;  2BTQ B;  3R66 A;  4JYY A;  4BIZ A;  1YJN V;  1Y67 A;  3BFR A;  2EJ7 A;  4OXS A;  3WU2 Z;  5BZB A;  1WPX A;  3BAA A;  3WB1 A;  2PYJ A;  3E35 A;  4P30 A;  2FKX A;  1YJW V;  3KKY A;  2OCH A;  4DV7 O;  1IX9 A;  1FFT B;  1NKD A;  3UCS C;  2ZQM A;  2DQ0 A;  1VQM V;  1Y76 B;  1UPG A;  4I0X B;  1XMQ B;  3B09 A;  2W6I G;  3J7A U;  3ZRW A;  3OD4 A;  1XEQ A;  3ASN C;  3IJ4 A;  4FFK A;  4J7Z A;  3T1H O;  4Z1M G;  1DF5 A;  1CEZ A;  2UXC B;  4BW9 A;  2PZS A;  3OUS A;  1P4R A;  5KHH A;  4FLX A;  1AP5 A;  1F51 A;  3K0G A;  1VQP V;  3CHX A;  4DR2 O;  4LF4 O;  5DEC A;  2UXD B;  1AIL A;  1I0H A;  4I7Z B;  1A32 A;  4U3J A;  4UCS A;  2A06 H;  3HR0 A;  3Q4H A;  3N2K A;  4HZ3 A;  1R3J C;  5EZY A;  3ZHS A;  2CK3 G;  2D2C B;  4G28 B;  2E75 B;  1VQO V;  1NR7 A;  1NH2 D;  2YXY A;  5A9G A;  1NTZ H;  2PI4 A;  1FPO A;  1EZJ A;  1MZF A;  5CN0 A;  5J2T A;  1VQ5 V;  3A2F A;  1GAX A;  2DYS B;  1AVM A;  1ZAU A;  3HKD B;  2KB1 A;  5CA0 B;  2QKS A;  2ZR2 A;  5BMV A;  3L75 H;  1GN3 A;  2EIN B;  1SQF A;  2A3Q A;  4UVB A;  2UUA B;  4DUY O;  4PDL A;  4JI7 B;  3ZIA G;  2YEV A;  2EX3 A;  4UFZ A;  4PHZ A;  1K4C C;  1Z5W A;  1JR9 A;  4MT8 A;  2QDO A;  4YJ2 A;  5CBF A;  1CPY A;  2WAM A;  1ZUQ A;  2R9R B;  3BCC H;  2Q7H A;  3CE2 A;  4DR6 O;  2XAS A;  1IBL B;  1SQB H;  4X62 O;  4Z1V A;  2YIB A;  1Q5O A;  3LSQ A;  4DRX A;  4UV9 A;  5CB4 B;  3E22 A;  3CD6 V;  2JS5 A;  1YZB A;  1RM1 B;  5JVD B;  1M56 B;  2H94 A;  5KHK A;  1HP8 A;  1JCH A;  4NTY A;  2OWO A;  1WA8 A;  2GDS A;  1S0V A;  5JQG A;  4BWA A;  3L72 H;  4DV4 O;  3OGC C;  3SR2 C;  2WLL A;  5LL6 Y;  2ZIO A;  4QGP A;  4PDM A;  2PI5 A;  4WFF A;  3HPL C;  4DK1 A;  3K58 A;  3ZRV A;  3ETE A;  4WBN A;  1RP3 B;  5GON A;  5BY1 A;  1GO3 F;  3G67 A;  2L6L A;  1AI7 A;  5H6Q A;  1NBM G;  1KEC A;  2IJJ A;  1YEW A;  1XL6 A;  5LP6 A;  1Z5V A;  2CGN A;  4XDL A;  3X2Q B;  1XNR O;  3K03 A;  1E79 G;  5IY5 C;  3SGI A;  1L8D A;  3JD4 A;  4WFG A;  1N36 O;  1Q7Y W;  4YJ3 B;  2QTO A;  3I5D A;  2BSK B;  1WP8 A;  4YHH B;  2Q0A A;  3ABM B;  2LFS A;  4DW1 A;  1SQX H;  1IVS A;  2K1E A;  3CCR V;  1PNK A;  3MHS C;  3AEI A;  1ZL8 B;  5CA1 B;  2XAG A;  4GT1 A;  2LGW A;  2HHH O;  2GUZ B;  5KAI Z;  5B3S B;  3SPH A;  2IU3 A;  5LHH A;  2K9P A;  3RYF A;  1UJW B;  3T1Y B;  3C3S A;  4F4L A;  4D7T A;  4MVS A;  3L73 H;  3TXS A;  1IUR A;  4X8A A;  1AR4 A;  4G27 B;  2E5L O;  1S76 D;  4PA4 A;  3L71 H;  3ZJZ A;  2QWQ B;  3E8H A;  4JI1 B;  2DE0 X;  3P32 A;  4O2A A;  4X1I A;  2KQX A;  3CCJ V;  2Q73 A;  2WA3 A;  3QF7 A;  2JVD A;  1OCZ B;  2EIM B;  2IBZ H;  3IAY A;  2Y69 B;  2ZM6 B;  4DV6 O;  4JI6 B;  1SQV H;  4YY3 B;  3CX5 F;  5DED A;  1VP7 A;  1K34 A;  1SA0 B;  2V4D A;  1N4C A;  3A8T A;  2JDI G;  5H5N A;  3ZBH A;  2XHB A;  1JJ2 U;  2NR5 A;  1QHT A;  4A5U B;  1VQ9 V;  2WPD G;  3TJT A;  3I56 V;  4X20 A;  3SDL A;  1Y4M A;  4JI3 B;  5IDJ A;  1TUE B;  3B8M A;  3QO8 A;  4MTO A;  3H9V A;  1HNZ O;  1N32 O;  4K0K O;  4LFC O;  2WLM A;  4MVQ A;  2AHY A;  5J9P C;  4I55 B;  5FPR A;  4BR6 A;  5KA5 A;  1VF6 C;  2A9H A;  4J9Z B;  4X66 O;  3L9D A;  3DC6 A;  3CXC U;  1YTF B;  4TV9 B;  3G71 V;  3UO3 A;  4LF7 B;  2CTR A;  2OYQ A;  1SET A;  1OV9 A;  5JWP A;  3QO5 A;  1EN6 A;  2WWW A;  4R50 A;  4TQD A;  2YDE A;  4TV8 B;  1UFI A;  1YJ9 V;  1S72 V;  1YIT V;  1Y74 A;  1EZV H;  5C8Y B;  3JAT B;  1GKF A;  5KX5 A;  4FLW A;  4CH5 A;  5B1N A;  1XNQ B;  3SYO A;  3SPC A;  1BMF G;  5KUM A;  1H2N A;  1TUB B;  1PP9 H;  2ZCE A;  4R8C A;  3CS5 A;  2EIJ B;  5IWA B;  1M57 B;  3JAR B;  4WFB V;  5JH7 B;  5KHI A;  3ABK C;  3E8F A;  3ZRS A;  4IYH A;  1G1X B;  1ZSP A;  4J41 A;  2QA4 V;  4DR3 B;  3APO A;  1K8A W;  2P67 A;  3EFF K;  1S3J A;  1GK9 A; 
#chains in the Genus database with same CATH homology
 3L74 H;  3H1J H;  1SQQ H;  3L73 H;  1NTK H;  1SQP H;  3H1H H;  1SQV H;  3H1L H;  1NTZ H;  3CX5 F;  3L70 H;  1EZV H;  1BCC H;  3L71 H;  1NTM H;  4D6T H;  1BGY H;  1KYO F;  1KB9 F;  1PPJ H;  3CWB H;  4PD4 F;  3H1K H;  2A06 H;  1BE3 H;  2FYU H;  4U3F H;  3CXH F;  1P84 F;  2BCC H;  3BCC H;  5KLV H;  1NU1 H;  3L72 H;  2IBZ H;  1SQX H;  3TGU H;  1L0N H;  3H1I H;  3L75 H;  1PP9 H;  1SQB H;  1L0L H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...