1SQPK

Crystal structure analysis of bovine bc1 with myxothiazol
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
53
structure length
53
Chain Sequence
b'MLTRFLGPRYRQLARNWVPTAGLWGAVGAVGLVWATDWRLILDWVPYINGKFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 14
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF08997 UCR_6-4kD Ubiquinol-cytochrome C reductase complex, 6.4kD protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1sqpK00
2WSEH 2WSFH 1NTZK 3CLQA 1SQBK 3LW5H 1SQQK 2WSCH 2OARA 1NTKK 2FYUK 2LKMA 1SQPK 3G3ZA 1L0NK 3M9QA 1SQXK 1L0LK 1NTMK 1NU1K 4IFDK 2J59M 1SQVK 5KLVK 2O01H
chains in the Genus database with same CATH superfamily
3TGUG 1N7SC 1Q2NA 1LT1A 1EZVI 2KSEA 3H32A 1OVUA 3D6YA 2FYUJ 3L75G 3PJSK 2KB7P 1FAVA 1A02F 1GTWA 5KAIE 1SQXG 2Y9ZA 3BRVB 4GDOA 4WWIA 2ZYAA 2P7JA 4N78E 5AW5B 4OH8B 2KOGA 1Q82Q 2KSJA 1J1EC 1LTBC 2YMYA 2E5TA 1NTMG 3AE6C 3VMZA 1BCCJ 2POHA 4R4MA 1SQQJ 1YHQP 2R5DA 2B87A 1GK4A 4WY4D 1RH5B 3L75E 1FZCB 2KLUA 3O6QB 1SQXK 1KFNA 3CC4P 1DIPA 2WVRA 2WSFH 1AA0A 2PGDA 1FZCC 3CMEP 4RJTA 1PV3A 3R4YA 4PJ0E 2AEMA 4KHXA 3BCCD 3USSA 2HODA 1L0NJ 1NU1J 3NFQA 3H1JJ 1NTME 1D7MA 3FWLA 1K04A 1N73C 2QJPC 1SFCA 2ZT9C 4PD4I 4HH2A 4D6TJ 3A7OA 1X79B 1EXIA 1X8YA 1AQTA 2YXQB 5KLIB 1L0LJ 2A06D 1SQVJ 2CPBA 4WY4B 5APWA 1T3UA 3CLQA 3AE5C 3L72E 1PP9J 1MFTA 1HWTC 1MKMA 1NTZE 2ZAEB 3GG2A 3NMDA 1N86A 1S9KD 1L4AC 2Z4EA 2MJZA 1KTMA 4BRYA 1ZV8A 1H0TA 2YNYA 3V2PA 2ZVOB 2WPQA 4NPEA 1PIXA 1SQPD 4BXLA 2HYNA 3CXHD 1BGYE 1A02J 3OAKA 1KC8Q 3BRTB 2K37A 2XKMA 1VQNP 1N7SA 5AW3B 3KPEA 4Y99C 2FY8A 3PH0A 3CCMP 2M5AB 1W2BO 1Y8AA 1BDDA 3T97B 2LXCB 3CX5E 1KQLA 4DCKA 1FZAA 3CC7P 1S1CX 4I2LC 1YQ3C 1M8OB 3F89A 1YJ9P 1ZOYC 2N1TD 3MHVA 1RF1B 4N78D 2NPSA 1VQOP 2Z5HA 3BCCJ 3RK3C 2J5UA 4W7ZA 3CWBE 3TGUD 4L74A 2C9NY 1H89A 4OGQC 2OYIB 3L75D 5KJ7C 5EFWB 1JY3O 1PGPA 3TNUB 1HGVA 2QJKC 1S5LH 2IZ1A 2K1AA 5E79H 1VPCA 1RF0C 2FXMA 1BDCA 2A45H 5B5EE 2N1TB 1MZ9A 2E74D 1NTMD 1SQQG 1PFIA 2W6AA 1N73A 3H1LJ 2FYUE 1IK9A 2CPSA 1URQD 3HE5B 2RN0A 5GTIE 1CI6A 5AVQB 3S1KA 3CCRP 1T3JA 4W7YA 1PGQA 1JY2N 1GU4A 3CXHH 3CMAP 2JR8A 1NTKK 1PGOA 1NTZD 4PD4E 4Z1MH 1NU1G 3NXSA 3GMAA 1L4AA 3VMAA 4I6MC 1BCCE 4JYBA 3CD6P 1R8EA 5KAIH 3UIAA 1KQSO 2Q6QA 3JSVC 4D6TG 4YXWH 2PAJA 2QRXA 2E74B 1BGYD 3RL0g 2IFMA 5AVUB 1LP1B 1RHZB 3HD7D 2XU6A 3I56P 3PLNA 1M90Q 1UIXA 1WRGA 5CJ0A 1DH3A 3V2NA 1URQB 1HVVA 1JCCA 2V4HA 2BEZF 3CX5D 5AW2B 3TSIA 2W27A 3AE3C 3G3ZA 1L0NE 2O3JA 1K9MQ 1LT9B 1HJ0A 1NU1E 1YTZI 5KLVE 3H1JE 3MUDC 2WPRA 3AE9C 4EOTA 1GU5A 2KYVA 2NZ2A 1GL2D 2H89C 3L74J 4JBZA 2KZIA 4YTPC 1PGJA 1PPJG 4OWFA 2FFDB 2Q1KA 4PJ0H 3CWBD 4H44D 1L0LE 1GK6A 1SQVE 5DJTB 1SQBJ 3RL0C 3HD7B 2Y0CA 3AE2C 1LWUB 1PP9E 2ZXEB 2M3EA 5KJ7A 1AQ5A 5GTHE 3HTKA 1CSBA 1MV8A 1IJDB 3E1IA 3G9RA 1KZUB 3D71A 2WSEH 2KNCA 3L72J 4K3AA 2KS1A 2QJYB 1KYOI 1RF0A 3BCCG 1EQ7A 5CHXA 3M06A 2QJYC 3QWOC 1GL2B 3MTUE 3V4QA 1PPJE 3L73E 3AEDC 3L36A 2HPCB 2FYUD 4H44B 4R4LA 1GZLA 2A06G 3GLMA 2A45G 5CCHC 1OW7A 2KLVA 5B66E 1USDA 4CPGA 4GODA 5AW1B 2E75D 1ZW0A 2XNXA 4L75A 5H2FE 4LLHA 1OVRA 1JMMA 1BCCD 2AXTE 5CBNA 1NAYA 3MIWA 3RBXA 1KILC 3CI9A 1K73Q 1SQPG 3CX5H 3C9IA 1EDLA 1SQQD 3EWKA 3SWYA 2IBZG 4K35A 1VQ9P 1Y47A 4JQ0D 3CWBJ 3VMXA 1KB9I 3MGNA 4U3FJ 1DX7A 4HKZH 5KAFE 1M1JA 3E1RA 1U57A 1AV1A 3NTNA 2KK7A 3A2AA 1OWAA 1L0ND 1FU1A 1CW5A 1NU1D 2K9JB 2WT7B 1JTHB 5KLVD 3A5TA 3H1JD 3EQ2A 2YKOA 3MUDA 1SQPK 3PP5A 3AEBC 2V7QJ 3LW5J 1G2CB 3H1LE 3V6IA 2SPZA 3B71A 2KUBA 2HG5D 4I7ZC 2C0WA 2E76C 1NKNA 1AVOA 2IBZE 2QM8A 1FE6A 2RKLA 3H1KJ 3K5BA 1L0LD 3ABVC 1SQVD 2WSCH 4ASWA 5B5EH 1QGKB 1RE3C 1M57D 1PP9D 2IPPA 2FBWC 3L71J 1OVVA 3B5NB 3A0BE 1AFOA 2YMKA 2YKPA 2K9YA 3FWNA 1J1DB 3I5CA 1N2DC 4WBAA 1FDMA 3B5NC 1QVFO 1T2KD 2KI7B 3WUUA 4AYCA 4GOEA 2KXPB 4U7JA 1SQBG 1PPJD 5CCGC 4OVNF 4GIFA 3MZWB 3SSUA 2CK3H 3A0HH 5CCHA 3A3YB 3L72G 1RE4C 1NTZG 5AW6B 2WWWA 3BVHA 1NYHA 1EXJA 1KD1Q 3L74E 2E5YA 5K5GB 2PP6A 2QVAA 1NTMK 2OTLP 1AVYA 1HUCA 5KLVJ 3IFMA 1KILA 5AVXB 3P32A 1SQBE 2OYHB 1BGYG 1JEKA 1Y9BA 1R5LA 4UB6E 4C7NB 3H1IJ 4N6JA 3U1CA 3BATA 5TISE 3GHGB 1IFIA 2R44A 1NTZK 5AW0B 5KLIC 2FYNB 1BE3E 1BSNA 4WY4C 3PTZA 4MN4C 2XNDH 4L73A 4ZNCA 1HH0A 1QL2A 1DD3A 1LTJB 3B4SA 1YI2P 4ZKPA 5L8RJ 3H1LD 1J2JB 3KHUA 1HTLC 1EDJA 3CWBG 2QIWA 1OZHA 2IBZD 1S4XA 1QEXA 1KORA 1FBMA 3OJAB 4DOJA 3L73J 3HE4A 1JY3N 1IFPA 1RE3A 1LJ2A 2H7HA 1P84E 2WITA 1EDKA 4RESB 4JPZB 1YJNP 1EZVE 3HUSB 1NAFA 3L70J 5AVTB 1IFMA 2OQQA 1YBKA 2P10A 2QM7A 5APXA 2JP3A 2ZYGA 4C7RA 2D2CD 1IFNA 5B66H 4EI2A 3HUSC 2YIUB 3FX0A 3W67A 1KFMA 1RF1C 4B86A 4WB4A 1R5SA 2YXRB 1DD4A 1PL5A 2FYUG 4U3FE 2Q3IA 2YIUC 2AEFA 1OW8A 3KZIE 1YJWP 2AXCA 2M0BA 4HYTB 1VQMP 4ZMDA 3AEGC 3TK1A 1WMKA 2OYIC 1JM0A 1RE4A 2ZJSE 1FZCA 5AW7B 3O6QA 3L74D 4QMAA 1NVOA 5KAFH 1BCCG 1JY2P 2W6BA 1N8RQ 2JWAA 2OYOA 4ZKUA 3H1KE 2D2CB 2OARA 2FYUK 1SQBD 4IOIH 2N1TC 1KQFB 2O1JA 2J59M 1XTCC 2LXBA 2D2CC 3L71E 1M56D 2G8YA 3VTPC 1K05A 2I1JA 2WPVB 1NWQA 5CBOA 3L72D 1LTIC 1L0NG 1BE3D 1YQ4C 1LTAC 4WY4A 3JCUE 5KLVG 3AE4C 1FJKA 2BCCE 3H1JG 5BU8B 5CMZA 1HBWA 4YXDC 1SQQK 2HLOA 3A0BH 5AVZB 1NKZB 1JB0J 4NPDA 3Q5PA 3LIDA 2IYPA 2R32A 2JDIH 1L0LG 1VQ7P 1SQVG 2Y9YA 1KQGB 1KV4A 1NH4A 2A45I 2W6JH 2LR2A 1PP9G 2E74C 4M3LA 3M0DC 2FYZA 3S9OA 5AVWB 1VQPP 1P84D 2ITAA 1L0NK 3WUTA 1URQC 5APVA 5AW4B 2IDBA 2WMMA 1NU1K 3IR9A 1EZVD 1IZNB 5KLVK 2M5AA 1U7JA 4XFJA 4N3YB 1S72P 3O8ZA 3CCVP 3T97A 3TYYA 3C1LA 1UIIA 3CXHI 3P8MC 1LT9C 5AVYB 1YYCA 3H1IE 1CZQA 3OW2O 2VRSA 3Q5SA 1L0LK 1RF1A 3L73G 1SQVK 4EDFA 4U3FD 4UB8E 1RQVA 2QSIA 3IN6A 3H32B 1FJPA 2WTYA 2FFDC 2XDJA 1JUNA 2C9LY 2UWJE 3SFDC 2R3CA 1YIJP 3L70G 3HD7C 1LWUC 4UB6H 4JF7A 2OYIA 2JWDA 1NGMB 1VQLP 1G1IA 5DJUB 1BE3J 2O01J 1T8ZA 1Q7YQ 5M1BA 3TNUA 2YKQA 3M91A 5APTA 2P1JA 2B88A 3M9QA 4IL6X 1X9VA 3GF3A 3H6PA 3H1KD 1SFCD 2O01H 3WU2E 2I1KA 1MUUA 2N1TA 4IFMA 1GL2C 3L71D 2B87B 5TJHA 3LIEA 2Q5UA 3WUVA 3G71P 1ZR4A 2E42A 1SLQA 2ZXXA 3SWKA 4C46A 3L70E 4H44C 3HE5A 3H25A 1SP4A 4RKUJ 3AEAC 4IL6E 4PD4D 3FXEA 1JOCA 1VF5D 2BASA 3VP9A 2OGUA 4BWNA 2BCCD 2QEXP 3CPWO 1PZQA 1S5LX 2HODB 3RK2D 3H1LG 1NHLA 1P84H 1HF9A 4XA4A 2O01N 1N7SD 1SFCB 4H0LD 3AECC 1KN7A 3U1AA 1JMBA 4I1LA 1LP1A 1X22A 3M0DA 3H1HJ 4WVZA 4EYYQ 5BU5A 3GF7A 1LTTC 1URQA 1X0TA 2E75B 1DEEG 3D70A 1OXZA 2NPSD 1VF5B 3KZIH 1ZRTE 1E79H 4BRYB 1H0TB 2E75C 3RK3E 3H1ID 1LT9A 2JO1A 2Q3EA 3RGUA 2IYOA 3RK2B 5APSA 2GUSA 2N9BA 2V7QH 3LW5H 3Q1MA 2P2UA 1GMJA 3KXDA 1N7SB 4H0LB 2R3SA 2R5BA 2FFDA 3CXHE 5AVVB 3CX5I 4IFDK 3RBZA 2YO3A 3AEFC 3MP7B 4H0LC 3HD7A 3GW6A 5KKZB 1LWUA 1QLED 3L74G 4A7PA 4AUWA 2LKMA 5GTIH 2ZYDA 5KKZC 2K88A 1J1DC 2NPSB 2H8PD 1IFDA 2BCCJ 1M1KQ 1J1EB 1LTGC 4PD4H 2Q7CA 3L73D 1VQ8P 2W8ZA 2ZT9D 2NPSC 1NTKJ 1KYOE 3JCUH 3V5BA 1GL2A 1ZN5A 4RO0A 3PRJA 3AE1C 1FZGA 4DT0A 2HPCA 3TGUE 2W90A 3L70D 2IX7C 1L2PA 1JNMA 2WSFJ 1BE3G 1L4AD 4H13D 1SQXE 1E5WA 1SQBK 1Z56A 1OFCX 5AW9B 4L76A 2N9YB 3M9HA 1N73B 2QJPB 1T2KC 3CCUP 1NJIQ 2ZT9B 2J58A 2OYHC 1VL2A 3Q3DA 2C0XA 1CI6B 3KQGA 1RY3A 1HJBA 3L4FA 1ZLLA 3VYIA 3B8EB 3GHGC 1N7LA 1EZVG 2PFXA 3V2QA 4PV1D 4UB8H 1KB9E 1JY3P 1K8AQ 2FYNC 1L4AB 4H13B 1ZRTD 4GT1A 3SFEC 5GTHH 1EC5A 2NRGA 3RK3D 1H8AA 4AQRD 2FXOA 2K9JA 1LTJC 2WT7A 1IO4A 1JTHA 4H13C 1Q86Q 2Y0EA 1QX8A 4U3FG 4DZOA 3P8CE 2Q9IA 1G2CA 4OGQD 3H1HG 4Y28J 1MFZA 3E7KA 5KJ7D 4Y99B 1GW3A 2M8RA 3WMM0 3U59A 2G3AA 3AEEC 3WU2H 3CCLP 3KDPB 4PV1B 3B5NA 3EFGA 4LC1A 3H1KG 4HJGH 4PV1C 2QG4A 1NO4A 3CCSP 4IL6H 4IFFA 3RK3B 2E43A 5H2FH 1TU3F 4NPFX 1KYOD 3L71G 2W83C 5CCGA 2Z5IA 3H1HE 2AXTH 1FZEA 1YITP 4OGQB 2MKVA 1ZMEC 1DEBA 1LNQA 2Y0DA 1W5CE 1SS1A 1FDOA 5KTBA 3HTKB 1Q81Q 1FDIA 4JYCA 2QJKB 5AW8B 3V4WA 2BCCG 2KNCB 1VDFA 2ZFCA 2KS1B 2OTKE 1FOSE 2B89A 1T6AA 2L5GB 1W2EA 4ASVA 1SQXD 3PHLA 3G4SP 1KILE 1GD2E 1NTKG 1FZFA 2XZRA 1FC2C 1S3JA 5AVSB 1LTSC 4GOFA 2DW3A 1BSHA 2GA1A 2OYHA 4KJMA 5AVRB 4C7NA 4W80A 3AE8C 2XV5A 4YPCA 1SQPJ 3FXDA 3GHGA 3P7KA 1RQUA 3R2PA 1S2EA 1KB9D 2WZ7A 3VP8A 1GDTA 1ZR2A 2IZ0A 3H1IG 1NTKE 2IFNA 3FGAD 3VN0A 1LTJA 4TT3H 3P8CD 3JC22 5APQA 3D6ZA 3RL0D 3A0HE 4LGDE 1AJYA 2JEEA 3IF4A 1SQQE 3IAOA 1M1JB 3ZDMA 1SVFA 1NOHA 2JKVA 3TF5A 1ZP0C 1FS0E 1KYOH 3TGUJ 3KYQA 2YO2A 1M1JC 5C39A 1JO5A 1OX3A 5CJ4A 2M3BA 1QL1A 3QH9A 2HR3A 3S4RA 3L75J 1VQ5P 3CC2P 3BASA 3F5HA 3HUSA 1JY2O 1SQXJ 3CCJP 2IBZI 2RMZA 1OMIA 1VQ6P 3EFFK 3ITKA 3N7NA 1FOSF 1WT6A 2HFED 3TDKA 2QA4P 3H1HD 5CCHD 1EDIA 3W68A 4D6TE 3RL0B 2H88C 1JCDA 1NTMJ 3MD0A 2RH0A 3V2RA 1GW4A 2P67A 5TISH 2FXPA 3VOPA 3AE7C 2KIKA 2WSEJ 3C8VA 3VMYA 2ZVNB 2GM4A 1KILD 3L35A 2GUVA 5APYA 4EIJA 1NTZJ 3II6A 2B9BA 4HB1A 4XE5B 4DJGA 1KB9H 2JJLA 5APUA 1OIPA 3CCQP 2QE7H 3OA7A 1FZBA 3Q5RA 2KP8A 2OTJP 2L91A 3M0AA 1XTGB 1BGYJ 3M9BA 1VQ4P 1IFJA 1QVGO 2K3RA 1HGZA 2KZJA 3G6EP 1NTKD 2E76D 1KILB 2O1KA 1ZXGA 3BCCE 2H43A 1IK7A 2FKWB 3N4XA 2PRRA 3Q2YA 1YTZT 1SFCC 3SWFA 2WPSA 1S5LE 1G1JA 2AEJA 5E79E 2WSSH 2BEQD 2WQYC 3HRNA 1IC2A 2A06E 4GKGA 2I8DA 2P58A 3B5ND 1M7LA 1U7MA 3CCEP 4O9BA 1KMIZ 1OW6A 5BVZA 3L37A 1USEA 1S9KE 1VF5C 1Q90D 1H88A 4I7ZB 2E76B 5CCGD 4KT0J 3I55P 3RK2C 1VQKP 3CL3D 1LGHB 2WSCJ 1SQPE 3HE4B 4TLFA 4D6TD 1P84I
chains in the Genus database with same CATH topology
2WSEH 4GT1A 1N7SC 1RF0A 3H32A 3VTPC 3RK3D 1H8AA 4AQRD 1EQ7A 5CHXA 3M06A 2I1JA 1LTJC 2WT7A 1NWQA 1IO4A 1JTHA 4DZOA 3P8CE 2KB7P 2Q9IA 1FAVA 1A02F 1GL2B 3MTUE 1LTIC 1GTWA 1G2CA 3V4QA 3BRVB 1LTAC 3L36A 4WY4A 1MFZA 2HPCB 1FJKA 5KJ7D 4Y99B 1GW3A 5BU8B 5CMZA 1HBWA 2M8RA 1GZLA 3WMM0 2P7JA 3U59A 2A45G 4N78E 1SQQK 4OH8B 2KOGA 5AW5B 5CCHC 2HLOA 2KLVA 5AVZB 1NKZB 2KSJA 1J1EC 1LTBC 5AW1B 3LIDA 2YMYA 2R32A 3KDPB 3VMZA 3B5NA 2XNXA 2POHA 1NH4A 2A45I 3EFGA 4LLHA 4LC1A 4M3LA 3M0DC 1JMMA 2R5DA 1GK4A 2FYZA 5AVWB 4WY4D 1NO4A 3MIWA 1FZCB 4IFFA 1KILC 3RK3B 2E43A 1L0NK 3CI9A 1SQXK 1KFNA 1URQC 3C9IA 5APVA 5AW4B 1NU1K 3IR9A 5CCGA 5KLVK 2Z5IA 2WSFH 3SWYA 4N3YB 1FZEA 3O8ZA 1FZCC 3T97A 3TYYA 1DEBA 3VMXA 3MGNA 1DX7A 3P8MC 1LT9C 5AVYB 1YYCA 5KTBA 1CZQA 3HTKB 4KHXA 2HODA 1M1JA 2VRSA 4JYCA 1L0LK 1RF1A 3NTNA 1SQVK 5AW8B 3V4WA 3NFQA 3A2AA 1FOSE 2ZFCA 1VDFA 2L5GB 1N73C 1W2EA 1OWAA 3H32B 1FJPA 1SFCA 1FU1A 2WTYA 1CW5A 2FFDC 1GD2E 2XDJA 2WT7B 4HH2A 1JUNA 1JTHB 3A7OA 1X79B 2C9LY 3A5TA 1X8YA 3EQ2A 2YKOA 2R3CA 3MUDA 1SQPK 3PP5A 1G2CB 3HD7C 1FZFA 2XZRA 1LWUC 2HG5D 2CPBA 4WY4B 4JF7A 5APWA 2OYIA 5AVSB 1T3UA 2C0WA 3CLQA 1LTSC 1NKNA 1HWTC 3NMDA 2QM8A 1G1IA 2OYHA 1N86A 1T8ZA 3TNUA 5AVRB 2WSCH 4C7NA 2YKQA 4W80A 3M91A 1S9KD 1L4AC 5APTA 2Z4EA 2XV5A 1RE3C 2P1JA 2MJZA 2IPPA 3M9QA 3GHGA 1X9VA 3H6PA 1ZV8A 3P7KA 2YNYA 1SFCD 3V2PA 2O01H 2WPQA 3B5NB 3R2PA 1AFOA 2I1KA 1MUUA 2WZ7A 2N1TA 2HYNA 2YKPA 3VP8A 4IFMA 1GDTA 1GL2C 1J1DB 3I5CA 1ZR2A 1N2DC 1A02J 3OAKA 4WBAA 3BRTB 1FDMA 3LIEA 2Q5UA 2XKMA 3B5NC 1N7SA 5AW3B 1T2KD 1ZR4A 2IFNA 2E42A 1SLQA 3KPEA 4Y99C 3VN0A 4C46A 4AYCA 1LTJA 3HE5A 3P8CD 1SP4A 5APQA 1JOCA 3RL0D 2BASA 1KQLA 1FZAA 4LGDE 3VP9A 5CCGC 2JEEA 4I2LC 4GIFA 2HODB 1M1JB 3RK2D 1SVFA 2N1TD 1NOHA 4N78D 1RF1B 1NHLA 5CCHA 4XA4A 2NPSA 3KYQA 2YO2A 2Z5HA 3A3YB 1N7SD 1RE4C 5AW6B 1M1JC 2WWWA 1JO5A 1SFCB 3RK3C 3BVHA 5CJ4A 2M3BA 1QL1A 4W7ZA 3U1AA 3BASA 2C9NY 2PP6A 3HUSA 4I1LA 1H89A 1JY2O 1NTMK 3M0DA 2OYIB 1HUCA 3IFMA 5BU5A 5KJ7C 1KILA 1LTTC 5AVXB 3N7NA 1FOSF 1WT6A 3P32A 1URQA 2OYHB 2HFED 1JY3O 3TNUB 4C7NB 1HGVA 1OXZA 4N6JA 5CCHD 3BATA 3U1CA 2NPSD 3RL0B 1JCDA 1VPCA 1RF0C 3GHGB 1IFIA 3MD0A 2FXMA 1LT9A 2A45H 3V2RA 1GW4A 3RK2B 1NTZK 5APSA 2N1TB 2P67A 1MZ9A 2GUSA 3VOPA 5AW0B 2N9BA 3LW5H 1PFIA 3VMYA 2P2UA 2W6AA 2GM4A 4WY4C 1N7SB 1N73A 1KILD 3L35A 2R5BA 1IK9A 1HH0A 2FFDA 2GUVA 2CPSA 1QL2A 1URQD 5AVVB 1LTJB 4IFDK 3HE5B 4ZKPA 1CI6A 5APYA 5AVQB 2YO3A 4EIJA 3II6A 1T3JA 4W7YA 4XE5B 1J2JB 2JJLA 3HD7A 5APUA 1JY2N 1HTLC 1GU4A 1LWUA 3OA7A 1NTKK 1FZBA 4AUWA 2LKMA 2KP8A 1FBMA 3OJAB 4DOJA 3M0AA 1XTGB 3HE4A 1JY3N 1J1DC 3NXSA 2NPSB 2H8PD 1IFDA 1L4AA 4I6MC 1RE3A 1J1EB 4JYBA 1LTGC 2H7HA 2Q7CA 2WITA 3UIAA 3M9BA 4RESB 2NPSC 3V5BA 2PAJA 1IFJA 3HUSB 1NAFA 1HGZA 1IFMA 5AVTB 1GL2A 2IFMA 5AVUB 2QM7A 5APXA 3HD7D 2XU6A 1ZN5A 1FZGA 4C7RA 1WRGA 1IFNA 2HPCA 1KILB 5CJ0A 1DH3A 3HUSC 2O1KA 3V2NA 2IX7C 1URQB 2H43A 1HVVA 1KFMA 1RF1C 1JCCA 1JNMA 4B86A 4WB4A 2FKWB 3N4XA 1L4AD 5AW2B 2Q3IA 2W27A 3TSIA 3G3ZA 1YTZT 1SFCC 3SWFA 1LT9B 2WPSA 1YTZI 1G1JA 1E5WA 1SQBK 2WPRA 1Z56A 4EOTA 1GU5A 2KYVA 3HRNA 1GL2D 4HYTB 5AW9B 3TK1A 1IC2A 4GKGA 2OYIC 3M9HA 1N73B 3B5ND 1T2KC 1RE4A 1M7LA 1FZCA 5AW7B 2FFDB 2J58A 4O9BA 2OYHC 2C0XA 5BVZA 1GK6A 1CI6B 3L37A 3KQGA 1RY3A 1HJBA 1S9KE 3L4FA 3RL0C 1JY2P 1ZLLA 3HD7B 2W6BA 3VYIA 3B8EB 1LWUB 3GHGC 4ZKUA 2ZXEB 1N7LA 1H88A 2OARA 5CCGD 3V2QA 5KJ7A 2FYUK 1AQ5A 3HTKA 3RK2C 1CSBA 2N1TC 3CL3D 1MV8A 1LGHB 1IJDB 1JY3P 3HE4B 1KZUB 2O1JA 3E1IA 2J59M 1XTCC 1L4AB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WSE H;  2WSF H;  1NTZ K;  3CLQ A;  1SQB K;  3LW5 H;  1SQQ K;  2WSC H;  2OAR A;  1NTK K;  2FYU K;  2LKM A;  1SQP K;  3G3Z A;  1L0N K;  3M9Q A;  1SQX K;  1L0L K;  1NTM K;  1NU1 K;  4IFD K;  2J59 M;  1SQV K;  5KLV K;  2O01 H; 
#chains in the Genus database with same CATH topology
 3TGU G;  1N7S C;  1Q2N A;  1LT1 A;  1EZV I;  2KSE A;  3H32 A;  1OVU A;  3D6Y A;  2FYU J;  3L75 G;  3PJS K;  2KB7 P;  1FAV A;  1A02 F;  1GTW A;  5KAI E;  1SQX G;  2Y9Z A;  3BRV B;  4GDO A;  4WWI A;  2ZYA A;  2P7J A;  4N78 E;  5AW5 B;  4OH8 B;  2KOG A;  1Q82 Q;  2KSJ A;  1J1E C;  1LTB C;  2YMY A;  2E5T A;  1NTM G;  3AE6 C;  3VMZ A;  1BCC J;  2POH A;  4R4M A;  1SQQ J;  1YHQ P;  2R5D A;  2B87 A;  1GK4 A;  4WY4 D;  1RH5 B;  3L75 E;  1FZC B;  2KLU A;  3O6Q B;  1SQX K;  1KFN A;  3CC4 P;  1DIP A;  2WVR A;  2WSF H;  1AA0 A;  2PGD A;  1FZC C;  3CME P;  4RJT A;  1PV3 A;  3R4Y A;  4PJ0 E;  2AEM A;  4KHX A;  3BCC D;  3USS A;  2HOD A;  1L0N J;  1NU1 J;  3NFQ A;  3H1J J;  1NTM E;  1D7M A;  3FWL A;  1K04 A;  1N73 C;  2QJP C;  1SFC A;  2ZT9 C;  4PD4 I;  4HH2 A;  4D6T J;  3A7O A;  1X79 B;  1EXI A;  1X8Y A;  1AQT A;  2YXQ B;  5KLI B;  1L0L J;  2A06 D;  1SQV J;  2CPB A;  4WY4 B;  5APW A;  1T3U A;  3CLQ A;  3AE5 C;  3L72 E;  1PP9 J;  1MFT A;  1HWT C;  1MKM A;  1NTZ E;  2ZAE B;  3GG2 A;  3NMD A;  1N86 A;  1S9K D;  1L4A C;  2Z4E A;  2MJZ A;  1KTM A;  4BRY A;  1ZV8 A;  1H0T A;  2YNY A;  3V2P A;  2ZVO B;  2WPQ A;  4NPE A;  1PIX A;  1SQP D;  4BXL A;  2HYN A;  3CXH D;  1BGY E;  1A02 J;  3OAK A;  1KC8 Q;  3BRT B;  2K37 A;  2XKM A;  1VQN P;  1N7S A;  5AW3 B;  3KPE A;  4Y99 C;  2FY8 A;  3PH0 A;  3CCM P;  2M5A B;  1W2B O;  1Y8A A;  1BDD A;  3T97 B;  2LXC B;  3CX5 E;  1KQL A;  4DCK A;  1FZA A;  3CC7 P;  1S1C X;  4I2L C;  1YQ3 C;  1M8O B;  3F89 A;  1YJ9 P;  1ZOY C;  2N1T D;  3MHV A;  1RF1 B;  4N78 D;  2NPS A;  1VQO P;  2Z5H A;  3BCC J;  3RK3 C;  2J5U A;  4W7Z A;  3CWB E;  3TGU D;  4L74 A;  2C9N Y;  1H89 A;  4OGQ C;  2OYI B;  3L75 D;  5KJ7 C;  5EFW B;  1JY3 O;  1PGP A;  3TNU B;  1HGV A;  2QJK C;  1S5L H;  2IZ1 A;  2K1A A;  5E79 H;  1VPC A;  1RF0 C;  2FXM A;  1BDC A;  2A45 H;  5B5E E;  2N1T B;  1MZ9 A;  2E74 D;  1NTM D;  1SQQ G;  1PFI A;  2W6A A;  1N73 A;  3H1L J;  2FYU E;  1IK9 A;  2CPS A;  1URQ D;  3HE5 B;  2RN0 A;  5GTI E;  1CI6 A;  5AVQ B;  3S1K A;  3CCR P;  1T3J A;  4W7Y A;  1PGQ A;  1JY2 N;  1GU4 A;  3CXH H;  3CMA P;  2JR8 A;  1NTK K;  1PGO A;  1NTZ D;  4PD4 E;  4Z1M H;  1NU1 G;  3NXS A;  3GMA A;  1L4A A;  3VMA A;  4I6M C;  1BCC E;  4JYB A;  3CD6 P;  1R8E A;  5KAI H;  3UIA A;  1KQS O;  2Q6Q A;  3JSV C;  4D6T G;  4YXW H;  2PAJ A;  2QRX A;  2E74 B;  1BGY D;  3RL0 g;  2IFM A;  5AVU B;  1LP1 B;  1RHZ B;  3HD7 D;  2XU6 A;  3I56 P;  3PLN A;  1M90 Q;  1UIX A;  1WRG A;  5CJ0 A;  1DH3 A;  3V2N A;  1URQ B;  1HVV A;  1JCC A;  2V4H A;  2BEZ F;  3CX5 D;  5AW2 B;  3TSI A;  2W27 A;  3AE3 C;  3G3Z A;  1L0N E;  2O3J A;  1K9M Q;  1LT9 B;  1HJ0 A;  1NU1 E;  1YTZ I;  5KLV E;  3H1J E;  3MUD C;  2WPR A;  3AE9 C;  4EOT A;  1GU5 A;  2KYV A;  2NZ2 A;  1GL2 D;  2H89 C;  3L74 J;  4JBZ A;  2KZI A;  4YTP C;  1PGJ A;  1PPJ G;  4OWF A;  2FFD B;  2Q1K A;  4PJ0 H;  3CWB D;  4H44 D;  1L0L E;  1GK6 A;  1SQV E;  5DJT B;  1SQB J;  3RL0 C;  3HD7 B;  2Y0C A;  3AE2 C;  1LWU B;  1PP9 E;  2ZXE B;  2M3E A;  5KJ7 A;  1AQ5 A;  5GTH E;  3HTK A;  1CSB A;  1MV8 A;  1IJD B;  3E1I A;  3G9R A;  1KZU B;  3D71 A;  2WSE H;  2KNC A;  3L72 J;  4K3A A;  2KS1 A;  2QJY B;  1KYO I;  1RF0 A;  3BCC G;  1EQ7 A;  5CHX A;  3M06 A;  2QJY C;  3QWO C;  1GL2 B;  3MTU E;  3V4Q A;  1PPJ E;  3L73 E;  3AED C;  3L36 A;  2HPC B;  2FYU D;  4H44 B;  4R4L A;  1GZL A;  2A06 G;  3GLM A;  2A45 G;  5CCH C;  1OW7 A;  2KLV A;  5B66 E;  1USD A;  4CPG A;  4GOD A;  5AW1 B;  2E75 D;  1ZW0 A;  2XNX A;  4L75 A;  5H2F E;  4LLH A;  1OVR A;  1JMM A;  1BCC D;  2AXT E;  5CBN A;  1NAY A;  3MIW A;  3RBX A;  1KIL C;  3CI9 A;  1K73 Q;  1SQP G;  3CX5 H;  3C9I A;  1EDL A;  1SQQ D;  3EWK A;  3SWY A;  2IBZ G;  4K35 A;  1VQ9 P;  1Y47 A;  4JQ0 D;  3CWB J;  3VMX A;  1KB9 I;  3MGN A;  4U3F J;  1DX7 A;  4HKZ H;  5KAF E;  1M1J A;  3E1R A;  1U57 A;  1AV1 A;  3NTN A;  2KK7 A;  3A2A A;  1OWA A;  1L0N D;  1FU1 A;  1CW5 A;  1NU1 D;  2K9J B;  2WT7 B;  1JTH B;  5KLV D;  3A5T A;  3H1J D;  3EQ2 A;  2YKO A;  3MUD A;  1SQP K;  3PP5 A;  3AEB C;  2V7Q J;  3LW5 J;  1G2C B;  3H1L E;  3V6I A;  2SPZ A;  3B71 A;  2KUB A;  2HG5 D;  4I7Z C;  2C0W A;  2E76 C;  1NKN A;  1AVO A;  2IBZ E;  2QM8 A;  1FE6 A;  2RKL A;  3H1K J;  3K5B A;  1L0L D;  3ABV C;  1SQV D;  2WSC H;  4ASW A;  5B5E H;  1QGK B;  1RE3 C;  1M57 D;  1PP9 D;  2IPP A;  2FBW C;  3L71 J;  1OVV A;  3B5N B;  3A0B E;  1AFO A;  2YMK A;  2YKP A;  2K9Y A;  3FWN A;  1J1D B;  3I5C A;  1N2D C;  4WBA A;  1FDM A;  3B5N C;  1QVF O;  1T2K D;  2KI7 B;  3WUU A;  4AYC A;  4GOE A;  2KXP B;  4U7J A;  1SQB G;  1PPJ D;  5CCG C;  4OVN F;  4GIF A;  3MZW B;  3SSU A;  2CK3 H;  3A0H H;  5CCH A;  3A3Y B;  3L72 G;  1RE4 C;  1NTZ G;  5AW6 B;  2WWW A;  3BVH A;  1NYH A;  1EXJ A;  1KD1 Q;  3L74 E;  2E5Y A;  5K5G B;  2PP6 A;  2QVA A;  1NTM K;  2OTL P;  1AVY A;  1HUC A;  5KLV J;  3IFM A;  1KIL A;  5AVX B;  3P32 A;  1SQB E;  2OYH B;  1BGY G;  1JEK A;  1Y9B A;  1R5L A;  4UB6 E;  4C7N B;  3H1I J;  4N6J A;  3U1C A;  3BAT A;  5TIS E;  3GHG B;  1IFI A;  2R44 A;  1NTZ K;  5AW0 B;  5KLI C;  2FYN B;  1BE3 E;  1BSN A;  4WY4 C;  3PTZ A;  4MN4 C;  2XND H;  4L73 A;  4ZNC A;  1HH0 A;  1QL2 A;  1DD3 A;  1LTJ B;  3B4S A;  1YI2 P;  4ZKP A;  5L8R J;  3H1L D;  1J2J B;  3KHU A;  1HTL C;  1EDJ A;  3CWB G;  2QIW A;  1OZH A;  2IBZ D;  1S4X A;  1QEX A;  1KOR A;  1FBM A;  3OJA B;  4DOJ A;  3L73 J;  3HE4 A;  1JY3 N;  1IFP A;  1RE3 A;  1LJ2 A;  2H7H A;  1P84 E;  2WIT A;  1EDK A;  4RES B;  4JPZ B;  1YJN P;  1EZV E;  3HUS B;  1NAF A;  3L70 J;  5AVT B;  1IFM A;  2OQQ A;  1YBK A;  2P10 A;  2QM7 A;  5APX A;  2JP3 A;  2ZYG A;  4C7R A;  2D2C D;  1IFN A;  5B66 H;  4EI2 A;  3HUS C;  2YIU B;  3FX0 A;  3W67 A;  1KFM A;  1RF1 C;  4B86 A;  4WB4 A;  1R5S A;  2YXR B;  1DD4 A;  1PL5 A;  2FYU G;  4U3F E;  2Q3I A;  2YIU C;  2AEF A;  1OW8 A;  3KZI E;  1YJW P;  2AXC A;  2M0B A;  4HYT B;  1VQM P;  4ZMD A;  3AEG C;  3TK1 A;  1WMK A;  2OYI C;  1JM0 A;  1RE4 A;  2ZJS E;  1FZC A;  5AW7 B;  3O6Q A;  3L74 D;  4QMA A;  1NVO A;  5KAF H;  1BCC G;  1JY2 P;  2W6B A;  1N8R Q;  2JWA A;  2OYO A;  4ZKU A;  3H1K E;  2D2C B;  2OAR A;  2FYU K;  1SQB D;  4IOI H;  2N1T C;  1KQF B;  2O1J A;  2J59 M;  1XTC C;  2LXB A;  2D2C C;  3L71 E;  1M56 D;  2G8Y A;  3VTP C;  1K05 A;  2I1J A;  2WPV B;  1NWQ A;  5CBO A;  3L72 D;  1LTI C;  1L0N G;  1BE3 D;  1YQ4 C;  1LTA C;  4WY4 A;  3JCU E;  5KLV G;  3AE4 C;  1FJK A;  2BCC E;  3H1J G;  5BU8 B;  5CMZ A;  1HBW A;  4YXD C;  1SQQ K;  2HLO A;  3A0B H;  5AVZ B;  1NKZ B;  1JB0 J;  4NPD A;  3Q5P A;  3LID A;  2IYP A;  2R32 A;  2JDI H;  1L0L G;  1VQ7 P;  1SQV G;  2Y9Y A;  1KQG B;  1KV4 A;  1NH4 A;  2A45 I;  2W6J H;  2LR2 A;  1PP9 G;  2E74 C;  4M3L A;  3M0D C;  2FYZ A;  3S9O A;  5AVW B;  1VQP P;  1P84 D;  2ITA A;  1L0N K;  3WUT A;  1URQ C;  5APV A;  5AW4 B;  2IDB A;  2WMM A;  1NU1 K;  3IR9 A;  1EZV D;  1IZN B;  5KLV K;  2M5A A;  1U7J A;  4XFJ A;  4N3Y B;  1S72 P;  3O8Z A;  3CCV P;  3T97 A;  3TYY A;  3C1L A;  1UII A;  3CXH I;  3P8M C;  1LT9 C;  5AVY B;  1YYC A;  3H1I E;  1CZQ A;  3OW2 O;  2VRS A;  3Q5S A;  1L0L K;  1RF1 A;  3L73 G;  1SQV K;  4EDF A;  4U3F D;  4UB8 E;  1RQV A;  2QSI A;  3IN6 A;  3H32 B;  1FJP A;  2WTY A;  2FFD C;  2XDJ A;  1JUN A;  2C9L Y;  2UWJ E;  3SFD C;  2R3C A;  1YIJ P;  3L70 G;  3HD7 C;  1LWU C;  4UB6 H;  4JF7 A;  2OYI A;  2JWD A;  1NGM B;  1VQL P;  1G1I A;  5DJU B;  1BE3 J;  2O01 J;  1T8Z A;  1Q7Y Q;  5M1B A;  3TNU A;  2YKQ A;  3M91 A;  5APT A;  2P1J A;  2B88 A;  3M9Q A;  4IL6 X;  1X9V A;  3GF3 A;  3H6P A;  3H1K D;  1SFC D;  2O01 H;  3WU2 E;  2I1K A;  1MUU A;  2N1T A;  4IFM A;  1GL2 C;  3L71 D;  2B87 B;  5TJH A;  3LIE A;  2Q5U A;  3WUV A;  3G71 P;  1ZR4 A;  2E42 A;  1SLQ A;  2ZXX A;  3SWK A;  4C46 A;  3L70 E;  4H44 C;  3HE5 A;  3H25 A;  1SP4 A;  4RKU J;  3AEA C;  4IL6 E;  4PD4 D;  3FXE A;  1JOC A;  1VF5 D;  2BAS A;  3VP9 A;  2OGU A;  4BWN A;  2BCC D;  2QEX P;  3CPW O;  1PZQ A;  1S5L X;  2HOD B;  3RK2 D;  3H1L G;  1NHL A;  1P84 H;  1HF9 A;  4XA4 A;  2O01 N;  1N7S D;  1SFC B;  4H0L D;  3AEC C;  1KN7 A;  3U1A A;  1JMB A;  4I1L A;  1LP1 A;  1X22 A;  3M0D A;  3H1H J;  4WVZ A;  4EYY Q;  5BU5 A;  3GF7 A;  1LTT C;  1URQ A;  1X0T A;  2E75 B;  1DEE G;  3D70 A;  1OXZ A;  2NPS D;  1VF5 B;  3KZI H;  1ZRT E;  1E79 H;  4BRY B;  1H0T B;  2E75 C;  3RK3 E;  3H1I D;  1LT9 A;  2JO1 A;  2Q3E A;  3RGU A;  2IYO A;  3RK2 B;  5APS A;  2GUS A;  2N9B A;  2V7Q H;  3LW5 H;  3Q1M A;  2P2U A;  1GMJ A;  3KXD A;  1N7S B;  4H0L B;  2R3S A;  2R5B A;  2FFD A;  3CXH E;  5AVV B;  3CX5 I;  4IFD K;  3RBZ A;  2YO3 A;  3AEF C;  3MP7 B;  4H0L C;  3HD7 A;  3GW6 A;  5KKZ B;  1LWU A;  1QLE D;  3L74 G;  4A7P A;  4AUW A;  2LKM A;  5GTI H;  2ZYD A;  5KKZ C;  2K88 A;  1J1D C;  2NPS B;  2H8P D;  1IFD A;  2BCC J;  1M1K Q;  1J1E B;  1LTG C;  4PD4 H;  2Q7C A;  3L73 D;  1VQ8 P;  2W8Z A;  2ZT9 D;  2NPS C;  1NTK J;  1KYO E;  3JCU H;  3V5B A;  1GL2 A;  1ZN5 A;  4RO0 A;  3PRJ A;  3AE1 C;  1FZG A;  4DT0 A;  2HPC A;  3TGU E;  2W90 A;  3L70 D;  2IX7 C;  1L2P A;  1JNM A;  2WSF J;  1BE3 G;  1L4A D;  4H13 D;  1SQX E;  1E5W A;  1SQB K;  1Z56 A;  1OFC X;  5AW9 B;  4L76 A;  2N9Y B;  3M9H A;  1N73 B;  2QJP B;  1T2K C;  3CCU P;  1NJI Q;  2ZT9 B;  2J58 A;  2OYH C;  1VL2 A;  3Q3D A;  2C0X A;  1CI6 B;  3KQG A;  1RY3 A;  1HJB A;  3L4F A;  1ZLL A;  3VYI A;  3B8E B;  3GHG C;  1N7L A;  1EZV G;  2PFX A;  3V2Q A;  4PV1 D;  4UB8 H;  1KB9 E;  1JY3 P;  1K8A Q;  2FYN C;  1L4A B;  4H13 B;  1ZRT D;  4GT1 A;  3SFE C;  5GTH H;  1EC5 A;  2NRG A;  3RK3 D;  1H8A A;  4AQR D;  2FXO A;  2K9J A;  1LTJ C;  2WT7 A;  1IO4 A;  1JTH A;  4H13 C;  1Q86 Q;  2Y0E A;  1QX8 A;  4U3F G;  4DZO A;  3P8C E;  2Q9I A;  1G2C A;  4OGQ D;  3H1H G;  4Y28 J;  1MFZ A;  3E7K A;  5KJ7 D;  4Y99 B;  1GW3 A;  2M8R A;  3WMM 0;  3U59 A;  2G3A A;  3AEE C;  3WU2 H;  3CCL P;  3KDP B;  4PV1 B;  3B5N A;  3EFG A;  4LC1 A;  3H1K G;  4HJG H;  4PV1 C;  2QG4 A;  1NO4 A;  3CCS P;  4IL6 H;  4IFF A;  3RK3 B;  2E43 A;  5H2F H;  1TU3 F;  4NPF X;  1KYO D;  3L71 G;  2W83 C;  5CCG A;  2Z5I A;  3H1H E;  2AXT H;  1FZE A;  1YIT P;  4OGQ B;  2MKV A;  1ZME C;  1DEB A;  1LNQ A;  2Y0D A;  1W5C E;  1SS1 A;  1FDO A;  5KTB A;  3HTK B;  1Q81 Q;  1FDI A;  4JYC A;  2QJK B;  5AW8 B;  3V4W A;  2BCC G;  2KNC B;  1VDF A;  2ZFC A;  2KS1 B;  2OTK E;  1FOS E;  2B89 A;  1T6A A;  2L5G B;  1W2E A;  4ASV A;  1SQX D;  3PHL A;  3G4S P;  1KIL E;  1GD2 E;  1NTK G;  1FZF A;  2XZR A;  1FC2 C;  1S3J A;  5AVS B;  1LTS C;  4GOF A;  2DW3 A;  1BSH A;  2GA1 A;  2OYH A;  4KJM A;  5AVR B;  4C7N A;  4W80 A;  3AE8 C;  2XV5 A;  4YPC A;  1SQP J;  3FXD A;  3GHG A;  3P7K A;  1RQU A;  3R2P A;  1S2E A;  1KB9 D;  2WZ7 A;  3VP8 A;  1GDT A;  1ZR2 A;  2IZ0 A;  3H1I G;  1NTK E;  2IFN A;  3FGA D;  3VN0 A;  1LTJ A;  4TT3 H;  3P8C D;  3JC2 2;  5APQ A;  3D6Z A;  3RL0 D;  3A0H E;  4LGD E;  1AJY A;  2JEE A;  3IF4 A;  1SQQ E;  3IAO A;  1M1J B;  3ZDM A;  1SVF A;  1NOH A;  2JKV A;  3TF5 A;  1ZP0 C;  1FS0 E;  1KYO H;  3TGU J;  3KYQ A;  2YO2 A;  1M1J C;  5C39 A;  1JO5 A;  1OX3 A;  5CJ4 A;  2M3B A;  1QL1 A;  3QH9 A;  2HR3 A;  3S4R A;  3L75 J;  1VQ5 P;  3CC2 P;  3BAS A;  3F5H A;  3HUS A;  1JY2 O;  1SQX J;  3CCJ P;  2IBZ I;  2RMZ A;  1OMI A;  1VQ6 P;  3EFF K;  3ITK A;  3N7N A;  1FOS F;  1WT6 A;  2HFE D;  3TDK A;  2QA4 P;  3H1H D;  5CCH D;  1EDI A;  3W68 A;  4D6T E;  3RL0 B;  2H88 C;  1JCD A;  1NTM J;  3MD0 A;  2RH0 A;  3V2R A;  1GW4 A;  2P67 A;  5TIS H;  2FXP A;  3VOP A;  3AE7 C;  2KIK A;  2WSE J;  3C8V A;  3VMY A;  2ZVN B;  2GM4 A;  1KIL D;  3L35 A;  2GUV A;  5APY A;  4EIJ A;  1NTZ J;  3II6 A;  2B9B A;  4HB1 A;  4XE5 B;  4DJG A;  1KB9 H;  2JJL A;  5APU A;  1OIP A;  3CCQ P;  2QE7 H;  3OA7 A;  1FZB A;  3Q5R A;  2KP8 A;  2OTJ P;  2L91 A;  3M0A A;  1XTG B;  1BGY J;  3M9B A;  1VQ4 P;  1IFJ A;  1QVG O;  2K3R A;  1HGZ A;  2KZJ A;  3G6E P;  1NTK D;  2E76 D;  1KIL B;  2O1K A;  1ZXG A;  3BCC E;  2H43 A;  1IK7 A;  2FKW B;  3N4X A;  2PRR A;  3Q2Y A;  1YTZ T;  1SFC C;  3SWF A;  2WPS A;  1S5L E;  1G1J A;  2AEJ A;  5E79 E;  2WSS H;  2BEQ D;  2WQY C;  3HRN A;  1IC2 A;  2A06 E;  4GKG A;  2I8D A;  2P58 A;  3B5N D;  1M7L A;  1U7M A;  3CCE P;  4O9B A;  1KMI Z;  1OW6 A;  5BVZ A;  3L37 A;  1USE A;  1S9K E;  1VF5 C;  1Q90 D;  1H88 A;  4I7Z B;  2E76 B;  5CCG D;  4KT0 J;  3I55 P;  3RK2 C;  1VQK P;  3CL3 D;  1LGH B;  2WSC J;  1SQP E;  3HE4 B;  4TLF A;  4D6T D;  1P84 I; 
#chains in the Genus database with same CATH homology
 2WSE H;  4GT1 A;  1N7S C;  1RF0 A;  3H32 A;  3VTP C;  3RK3 D;  1H8A A;  4AQR D;  1EQ7 A;  5CHX A;  3M06 A;  2I1J A;  1LTJ C;  2WT7 A;  1NWQ A;  1IO4 A;  1JTH A;  4DZO A;  3P8C E;  2KB7 P;  2Q9I A;  1FAV A;  1A02 F;  1GL2 B;  3MTU E;  1LTI C;  1GTW A;  1G2C A;  3V4Q A;  3BRV B;  1LTA C;  3L36 A;  4WY4 A;  1MFZ A;  2HPC B;  1FJK A;  5KJ7 D;  4Y99 B;  1GW3 A;  5BU8 B;  5CMZ A;  1HBW A;  2M8R A;  1GZL A;  3WMM 0;  2P7J A;  3U59 A;  2A45 G;  4N78 E;  1SQQ K;  4OH8 B;  2KOG A;  5AW5 B;  5CCH C;  2HLO A;  2KLV A;  5AVZ B;  1NKZ B;  2KSJ A;  1J1E C;  1LTB C;  5AW1 B;  3LID A;  2YMY A;  2R32 A;  3KDP B;  3VMZ A;  3B5N A;  2XNX A;  2POH A;  1NH4 A;  2A45 I;  3EFG A;  4LLH A;  4LC1 A;  4M3L A;  3M0D C;  1JMM A;  2R5D A;  1GK4 A;  2FYZ A;  5AVW B;  4WY4 D;  1NO4 A;  3MIW A;  1FZC B;  4IFF A;  1KIL C;  3RK3 B;  2E43 A;  1L0N K;  3CI9 A;  1SQX K;  1KFN A;  1URQ C;  3C9I A;  5APV A;  5AW4 B;  1NU1 K;  3IR9 A;  5CCG A;  5KLV K;  2Z5I A;  2WSF H;  3SWY A;  4N3Y B;  1FZE A;  3O8Z A;  1FZC C;  3T97 A;  3TYY A;  1DEB A;  3VMX A;  3MGN A;  1DX7 A;  3P8M C;  1LT9 C;  5AVY B;  1YYC A;  5KTB A;  1CZQ A;  3HTK B;  4KHX A;  2HOD A;  1M1J A;  2VRS A;  4JYC A;  1L0L K;  1RF1 A;  3NTN A;  1SQV K;  5AW8 B;  3V4W A;  3NFQ A;  3A2A A;  1FOS E;  2ZFC A;  1VDF A;  2L5G B;  1N73 C;  1W2E A;  1OWA A;  3H32 B;  1FJP A;  1SFC A;  1FU1 A;  2WTY A;  1CW5 A;  2FFD C;  1GD2 E;  2XDJ A;  2WT7 B;  4HH2 A;  1JUN A;  1JTH B;  3A7O A;  1X79 B;  2C9L Y;  3A5T A;  1X8Y A;  3EQ2 A;  2YKO A;  2R3C A;  3MUD A;  1SQP K;  3PP5 A;  1G2C B;  3HD7 C;  1FZF A;  2XZR A;  1LWU C;  2HG5 D;  2CPB A;  4WY4 B;  4JF7 A;  5APW A;  2OYI A;  5AVS B;  1T3U A;  2C0W A;  3CLQ A;  1LTS C;  1NKN A;  1HWT C;  3NMD A;  2QM8 A;  1G1I A;  2OYH A;  1N86 A;  1T8Z A;  3TNU A;  5AVR B;  2WSC H;  4C7N A;  2YKQ A;  4W80 A;  3M91 A;  1S9K D;  1L4A C;  5APT A;  2Z4E A;  2XV5 A;  1RE3 C;  2P1J A;  2MJZ A;  2IPP A;  3M9Q A;  3GHG A;  1X9V A;  3H6P A;  1ZV8 A;  3P7K A;  2YNY A;  1SFC D;  3V2P A;  2O01 H;  2WPQ A;  3B5N B;  3R2P A;  1AFO A;  2I1K A;  1MUU A;  2WZ7 A;  2N1T A;  2HYN A;  2YKP A;  3VP8 A;  4IFM A;  1GDT A;  1GL2 C;  1J1D B;  3I5C A;  1ZR2 A;  1N2D C;  1A02 J;  3OAK A;  4WBA A;  3BRT B;  1FDM A;  3LIE A;  2Q5U A;  2XKM A;  3B5N C;  1N7S A;  5AW3 B;  1T2K D;  1ZR4 A;  2IFN A;  2E42 A;  1SLQ A;  3KPE A;  4Y99 C;  3VN0 A;  4C46 A;  4AYC A;  1LTJ A;  3HE5 A;  3P8C D;  1SP4 A;  5APQ A;  1JOC A;  3RL0 D;  2BAS A;  1KQL A;  1FZA A;  4LGD E;  3VP9 A;  5CCG C;  2JEE A;  4I2L C;  4GIF A;  2HOD B;  1M1J B;  3RK2 D;  1SVF A;  2N1T D;  1NOH A;  4N78 D;  1RF1 B;  1NHL A;  5CCH A;  4XA4 A;  2NPS A;  3KYQ A;  2YO2 A;  2Z5H A;  3A3Y B;  1N7S D;  1RE4 C;  5AW6 B;  1M1J C;  2WWW A;  1JO5 A;  1SFC B;  3RK3 C;  3BVH A;  5CJ4 A;  2M3B A;  1QL1 A;  4W7Z A;  3U1A A;  3BAS A;  2C9N Y;  2PP6 A;  3HUS A;  4I1L A;  1H89 A;  1JY2 O;  1NTM K;  3M0D A;  2OYI B;  1HUC A;  3IFM A;  5BU5 A;  5KJ7 C;  1KIL A;  1LTT C;  5AVX B;  3N7N A;  1FOS F;  1WT6 A;  3P32 A;  1URQ A;  2OYH B;  2HFE D;  1JY3 O;  3TNU B;  4C7N B;  1HGV A;  1OXZ A;  4N6J A;  5CCH D;  3BAT A;  3U1C A;  2NPS D;  3RL0 B;  1JCD A;  1VPC A;  1RF0 C;  3GHG B;  1IFI A;  3MD0 A;  2FXM A;  1LT9 A;  2A45 H;  3V2R A;  1GW4 A;  3RK2 B;  1NTZ K;  5APS A;  2N1T B;  2P67 A;  1MZ9 A;  2GUS A;  3VOP A;  5AW0 B;  2N9B A;  3LW5 H;  1PFI A;  3VMY A;  2P2U A;  2W6A A;  2GM4 A;  4WY4 C;  1N7S B;  1N73 A;  1KIL D;  3L35 A;  2R5B A;  1IK9 A;  1HH0 A;  2FFD A;  2GUV A;  2CPS A;  1QL2 A;  1URQ D;  5AVV B;  1LTJ B;  4IFD K;  3HE5 B;  4ZKP A;  1CI6 A;  5APY A;  5AVQ B;  2YO3 A;  4EIJ A;  3II6 A;  1T3J A;  4W7Y A;  4XE5 B;  1J2J B;  2JJL A;  3HD7 A;  5APU A;  1JY2 N;  1HTL C;  1GU4 A;  1LWU A;  3OA7 A;  1NTK K;  1FZB A;  4AUW A;  2LKM A;  2KP8 A;  1FBM A;  3OJA B;  4DOJ A;  3M0A A;  1XTG B;  3HE4 A;  1JY3 N;  1J1D C;  3NXS A;  2NPS B;  2H8P D;  1IFD A;  1L4A A;  4I6M C;  1RE3 A;  1J1E B;  4JYB A;  1LTG C;  2H7H A;  2Q7C A;  2WIT A;  3UIA A;  3M9B A;  4RES B;  2NPS C;  3V5B A;  2PAJ A;  1IFJ A;  3HUS B;  1NAF A;  1HGZ A;  1IFM A;  5AVT B;  1GL2 A;  2IFM A;  5AVU B;  2QM7 A;  5APX A;  3HD7 D;  2XU6 A;  1ZN5 A;  1FZG A;  4C7R A;  1WRG A;  1IFN A;  2HPC A;  1KIL B;  5CJ0 A;  1DH3 A;  3HUS C;  2O1K A;  3V2N A;  2IX7 C;  1URQ B;  2H43 A;  1HVV A;  1KFM A;  1RF1 C;  1JCC A;  1JNM A;  4B86 A;  4WB4 A;  2FKW B;  3N4X A;  1L4A D;  5AW2 B;  2Q3I A;  2W27 A;  3TSI A;  3G3Z A;  1YTZ T;  1SFC C;  3SWF A;  1LT9 B;  2WPS A;  1YTZ I;  1G1J A;  1E5W A;  1SQB K;  2WPR A;  1Z56 A;  4EOT A;  1GU5 A;  2KYV A;  3HRN A;  1GL2 D;  4HYT B;  5AW9 B;  3TK1 A;  1IC2 A;  4GKG A;  2OYI C;  3M9H A;  1N73 B;  3B5N D;  1T2K C;  1RE4 A;  1M7L A;  1FZC A;  5AW7 B;  2FFD B;  2J58 A;  4O9B A;  2OYH C;  2C0X A;  5BVZ A;  1GK6 A;  1CI6 B;  3L37 A;  3KQG A;  1RY3 A;  1HJB A;  1S9K E;  3L4F A;  3RL0 C;  1JY2 P;  1ZLL A;  3HD7 B;  2W6B A;  3VYI A;  3B8E B;  1LWU B;  3GHG C;  4ZKU A;  2ZXE B;  1N7L A;  1H88 A;  2OAR A;  5CCG D;  3V2Q A;  5KJ7 A;  2FYU K;  1AQ5 A;  3HTK A;  3RK2 C;  1CSB A;  2N1T C;  3CL3 D;  1MV8 A;  1LGH B;  1IJD B;  1JY3 P;  3HE4 B;  1KZU B;  2O1J A;  3E1I A;  2J59 M;  1XTC C;  1L4A B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...