1SQPK

Crystal structure analysis of bovine bc1 with myxothiazol
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
53
structure length
53
Chain Sequence
MLTRFLGPRYRQLARNWVPTAGLWGAVGAVGLVWATDWRLILDWVPYINGKFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 14
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF08997 UCR_6-4kD Ubiquinol-cytochrome C reductase complex, 6.4kD protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1sqpK00
1NTMK 2O01H 1SQBK 2WSFH 3M9QA 3CLQA 1L0NK 2WSCH 1SQPK 2WSEH 1L0LK 1SQVK 3G3ZA 4IFDK 2LKMA 1SQXK 2J59M 2OARA 1NTZK 3LW5H 5KLVK 1NTKK 2FYUK 1NU1K 1SQQK
chains in the Genus database with same CATH superfamily
1SQVG 3BVHA 2Y9ZA 4I7ZC 2QJYB 2FXOA 2WZ7A 4A7PA 4GKGA 1L0LJ 4IFMA 3RK3E 4U3FG 5GTIE 4NPDA 4N78D 1FJPA 2QJKB 3VMYA 1S9KD 1YJNP 2WQYC 4WB4A 2B87B 1K73Q 1KFNA 1SFCD 4JPZB 4DJGA 2WSEJ 2P67A 1JB0J 3SWKA 1BCCE 1VF5D 1D7MA 3HD7A 1Q86Q 1LTJC 1BE3D 1GU4A 3AE8C 1SFCC 2QM7A 1FZCC 1PGJA 1KFMA 3L72J 1SQQJ 2JJLA 1VF5C 4R4MA 2FFDC 5KAFE 1BE3G 3KPEA 1NO4A 3CX5D 5E79H 2OYIA 3M9HA 5APSA 3CMEP 2D2CD 1P84D 1NTMD 1JM0A 2N1TB 3C9IA 3BCCE 3TYYA 5AW8B 3E7KA 2RN0A 5TJHA 4D6TJ 3FGAD 1NTZG 1FAVA 1SQXD 4UB8H 2L91A 2N9BA 1NTMG 5AVZB 2D2CC 2JO1A 5APQA 1FE6A 1FS0E 1AA0A 3H1KJ 2MJZA 1L0NJ 5AVSB 2ZXEB 1L0LD 1NKNA 2E76D 3GG2A 1SQXG 2IBZD 5GTIH 3HUSC 1FOSF 1NTKE 1KYOI 1Q7YQ 1MFZA 2ZT9B 4H13C 1KMIZ 2N9YB 2YIUB 4K3AA 1A02J 1L0LG 2E76C 1KORA 4O9BA 1PGOA 2XZRA 1JY2P 2W27A 1WMKA 1KB9I 1Y47A 4IL6X 3JCUE 1XTGB 2ZVOB 1EZVG 1KTMA 3SWYA 1S72P 3C1LA 3BASA 1NKZB 1S2EA 4L74A 1J2JB 5B66E 1EDKA 4C7NB 4NPEA 5CBNA 1T2KD 1ZV8A 1ZP0C 2KNCB 1G1JA 3GHGC 1QX8A 3P8CE 3B5NA 4OVNF 2XU6A 2RKLA 1JTHA 1SVFA 2OQQA 2IX7C 2Q1KA 2C9LY 4GOEA 3A7OA 3M0AA 5KAIH 3M0DA 3RK2B 1IFMA 3L72G 1SQQG 1IFDA 2VRSA 1T2KC 1K9MQ 3A3YB 3CCEP 2Z5HA 3MIWA 1NWQA 1S5LE 2Q6QA 1H89A 4AUWA 2E74B 2J58A 1VQ7P 3CX5I 1M1JC 1HWTC 1G2CA 5KTBA 1IFNA 4XE5B 3CXHD 3A0BH 2K37A 1E79H 3HD7D 2FXMA 1P84I 3V2PA 4W80A 1CI6A 4D6TG 2IFMA 3ABVC 1PFIA 2WSFH 1IC2A 1T3UA 1M56D 1KQSO 3M91A 2KP8A 4H0LB 4PD4H 5AW2B 3H1KG 3HD7C 2KB7P 3P7KA 2FYUJ 4C46A 1OW7A 2CPBA 1ZW0A 2IBZI 2YKPA 3V2QA 2E75D 1JMBA 1KILE 2FBWC 2ZYDA 1LT1A 1N73C 2OYIC 3RBXA 1ZOYC 1FZGA 3Q3DA 3L73J 3H1HJ 4NPFX 3AE5C 2E75C 4JF7A 3L75J 2R3CA 5B5EH 4Y28J 2E5TA 5KJ7A 2WTYA 5AW1B 4HKZH 4OGQB 5L8RJ 3KXDA 1BSNA 1FZFA 2WMMA 1AFOA 1T8ZA 1H8AA 1E5WA 1EXJA 2JWAA 3H1IE 2H7HA 2FYNB 1YBKA 3C8VA 3PHLA 1GD2E 3KZIH 5AVYB 2E43A 2HG5D 4ZMDA 1PGQA 3AEBC 2WPQA 2PP6A 2ZYAA 2WPRA 2IYOA 1CW5A 3H1LD 2R3SA 2N1TA 1S1CX 1BCCJ 2C0WA 5AVQB 1ZR2A 2YXRB 1EXIA 1VQ8P 2O01J 4UB6E 1J1EB 1AVYA 1IZNB 2OGUA 2AXTE 2WT7B 3CXHI 3H32B 5AVVB 3B5ND 3CMAP 2FYUD 3GW6A 3B71A 3H1LG 3LIDA 3ZDMA 5KKZB 5DJTB 1HH0A 3BRVB 2IZ1A 1JUNA 2G3AA 1HVVA 2ZVNB 4EDFA 5KLVE 2FYUG 4WY4B 5AW7B 3B5NC 3AE9C 2OYHC 3AEDC 4GT1A 1PIXA 1SQBD 3Q5PA 1ZR4A 2K9JA 1AJYA 2PGDA 3M0DC 1OZHA 1HJBA 3Q1MA 4AQRD 3BCCJ 1G1IA 3TK1A 1KD1Q 5CCGA 1HGZA 3SFDC 5AW5B 4H44D 3U1CA 3RGUA 1QGKB 1SQBG 1GW4A 5CBOA 3L73G 3H1HG 1TU3F 1NAFA 2QRXA 5AVUB 3L75G 3RK3D 4C7NA 4H44C 1NTKJ 1Y8AA 1PP9D 3OA7A 1EDLA 1QEXA 2KNCA 2W6BA 1GTWA 4W7YA 3HE5B 2W90A 3PJSK 3QWOC 3HRNA 3RK3C 1M7LA 1HUCA 3HE4A 1BCCD 1DEEG 3GF7A 3I56P 4UB6H 1SQVD 2QJPB 1VQOP 2AXTH 1AV1A 1LTIC 5KJ7D 3OW2O 4HH2A 4U3FD 3V2RA 2WWWA 3RL0g 3PRJA 1USDA 2CPSA 2L5GB 1BCCG 5KLIB 2A45G 2KSJA 1BDCA 2OTKE 2Y0EA 3SWFA 2G8YA 2XKMA 2HYNA 1Q81Q 5KJ7C 4KT0J 3LW5H 3W67A 1X79B 2BCCE 1QLED 3E1IA 1K05A 3V5BA 1MUUA 3BCCD 1SQPK 1N7SB 1R8EA 5APVA 1JCDA 1WRGA 4BXLA 5TISH 3L36A 1JY3P 3L37A 1FDMA 3SSUA 3L71E 1ZRTD 3AE4C 3FWNA 1HF9A 2N1TD 3CCJP 3VMAA 2W8ZA 3BCCG 1OIPA 2Q5UA 2FKWB 4I7ZB 1NYHA 5APWA 1OFCX 3V2NA 3TGUE 3R4YA 4PJ0E 3H1JE 2ZYGA 3NXSA 1NTKD 1NU1E 2K9YA 2N1TC 4PD4D 4DCKA 1M57D 3L74E 3NTNA 4HJGH 1KYOE 1OVUA 5APYA 1NTKG 2QVAA 2ZT9D 4RESB 1NTZD 4N6JA 2I8DA 1RE4A 5APXA 4TLFA 1W2BO 5CCGD 5AVRB 2KZIA 1AQ5A 1LTJB 3VN0A 3N7NA 2QEXP 1KB9E 2KS1B 2ZT9C 2WPSA 1YTZI 2YIUC 2A06E 4H13D 4QMAA 1SP4A 1H0TB 1L4AB 2WPVB 5CCGC 1BGYE 1VF5B 1KQFB 3TNUA 1MV8A 4DT0A 5AVWB 3H32A 2WITA 3GLMA 1EZVD 3AE7C 2QE7H 4RO0A 5BVZA 3KDPB 3H1IJ 3RK2D 1FZBA 1U7MA 1VQ5P 1RY3A 2WSCJ 1RF0C 4M3LA 1BDDA 2JDIH 1NU1K 3L4FA 4WY4A 2D2CB 2W83C 1GL2A 2E74D 2O01H 2A45H 5AW6B 5BU8B 3CX5E 1JEKA 4KJMA 1VL2A 1N86A 1EDJA 4PJ0H 1LT9B 1SQVK 3RK2C 4LLHA 2UWJE 3VOPA 3S9OA 1KN7A 1GZLA 1P84E 3L72D 1SQQD 3M06A 4DZOA 5KAFH 4DOJA 2E74C 2V7QH 1YHQP 2K88A 1SQXE 2E76B 4ASVA 2GUVA 4H0LD 2KYVA 4CPGA 2AEJA 3LIEA 3A0HE 3JSVC 2KOGA 2R32A 4HYTB 5KLVJ 4PD4I 4U7JA 1VQNP 1NAYA 1L0LE 3LW5J 3KQGA 4D6TD 3CCQP 3T97B 1X8YA 3H6PA 2IBZE 1KB9H 3HE5A 4H0LC 1JY2N 3K5BA 3AEEC 4EI2A 3V4WA 3P32A 2WVRA 1N7LA 3H1KD 3WUUA 2CK3H 1L0ND 1IFPA 2NRGA 2Q9IA 4ASWA 4WVZA 4BWNA 1BSHA 2XV5A 3MD0A 2HLOA 3FX0A 2IDBA 3AE3C 1VQ4P 1RF1B 1MFTA 4EYYQ 1Q90D 1L0NG 1FBMA 2NPSA 3MUDA 1KILB 1XTCC 2QG4A 3EFFK 1M1JB 1VQ6P 2ZXXA 3N4XA 1KQLA 3JCUH 3BATA 1YYCA 4XA4A 3H1IG 1NTMK 3CX5H 1EZVI 2PAJA 2YO3A 2R5BA 3VMXA 5B66H 1Q82Q 4PV1B 1RE4C 1PV3A 1N7SA 3CWBE 3Q2YA 1LWUB 1SQXK 2OARA 3AE6C 3A5TA 2B87A 1ZLLA 1Y9BA 2YMKA 3U1AA 2FYNC 1IJDB 2IFNA 1L0LK 1RQVA 2RMZA 2JEEA 3CXHE 1ZN5A 1IFJA 2IYPA 1YTZT 1N73B 1IO4A 2XNXA 2E5YA 1S5LH 3MGNA 2HPCB 2BCCJ 3P8MC 4R4LA 2W6JH 4WY4D 2PFXA 5KLVG 1YJ9P 1GL2D 2GM4A 4Y99B 3V6IA 4YPCA 2P1JA 1X22A 1FC2C 3E1RA 4WY4C 2NZ2A 1LTJA 1GL2C 3TGUJ 3H1JJ 1GW3A 2KK7A 2R5DA 1VDFA 1HJ0A 1S3JA 2AXCA 1H0TA 1L4AA 5APTA 3B4SA 4ZKUA 5CMZA 2Q3EA 1ZXGA 3L74J 2V7QJ 1J1DB 1PPJE 1JY2O 2P2UA 3L70E 5M1BA 2XDJA 3IFMA 5GTHE 1R5LA 2O1JA 3S1KA 3L73D 3H1HD 2P58A 2Y0CA 3CC4P 2O3JA 1R5SA 3L75D 3IF4A 3A2AA 2YKQA 3W68A 2OYOA 1FOSE 1SQPE 1RE3A 1OVRA 1DEBA 2Y9YA 2ZJSE 3AE1C 4L75A 1Q2NA 2K1AA 4ZKPA 3F5HA 1BGYJ 3CI9A 1IK9A 1YI2P 1LT9A 2FY8A 2NPSD 1AVOA 2OTJP 3VYIA 1GMJA 2OYHB 3RBZA 3H1LE 5H2FE 3IAOA 2WSCH 3F89A 2QJPC 3I55P 2M5AB 1N8RQ 2NPSC 1LP1B 4EOTA 2M3BA 2XNDH 2Y0DA 2BCCG 2Z4EA 1N7SD 3M9BA 2QJYC 1KV4A 5E79E 1FU1A 4OWFA 3T97A 3TSIA 1LTSC 3AEAC 1T3JA 5CCHA 4H44B 2V4HA 3RL0B 1EDIA 2QJKC 1SQBE 3AEGC 4KHXA 1N7SC 3CPWO 2JWDA 1OW6A 2B89A 3TGUG 3H1JG 2FYZA 2PRRA 1URQB 1KZUB 3QH9A 3USSA 4LC1A 1AQTA 3D71A 1MKMA 4WWIA 4MN4C 2HODB 2Q7CA 5EFWB 5K5GB 1RF1A 4WBAA 2YKOA 3L74G 1LGHB 1KILA 2JP3A 2IZ0A 1U57A 1W5CE 2M8RA 2DW3A 2J59M 1KQGB 1KB9D 1M1JA 1PP9E 1NGMB 2A06D 2JR8A 1M8OB 1YQ3C 2E42A 2I1JA 1OMIA 2BEQD 2B9BA 1BGYD 3PLNA 3O8ZA 3CC2P 5DJUB 1A02F 1GDTA 3VMZA 1LTAC 4OH8B 2A06G 1LWUA 2FYUK 1JO5A 3EWKA 5H2FH 1L4AD 1YJWP 3UIAA 1KC8Q 1OWAA 2R44A 3D6YA 1BGYG 1SQVE 1S5LX 2ITAA 5CJ0A 5AVXB 4U3FE 2J5UA 4I2LC 2KIKA 1FJKA 5CHXA 1GK4A 1UIIA 1L4AC 1JOCA 1VQKP 1SQBK 1FZEA 1N73A 1JCCA 3MP7B 1K8AQ 2M0BA 4XFJA 2QM8A 2HPCA 1JY3N 5KAIE 1SFCB 4N78E 3CWBJ 3AECC 1L2PA 2H89C 1DX7A 1LTGC 4I6MC 1S9KE 2ZAEB 1FZCB 2Z5IA 4GIFA 1JNMA 3IN6A 3P8CD 1YQ4C 2FFDB 3GF3A 3B8EB 2A45I 1FZAA 4W7ZA 1OW8A 2QSIA 1IK7A 1ZRTE 1FDOA 5CJ4A 1RE3C 4JYCA 3A0BE 3EQ2A 4K35A 2SPZA 3HTKB 1EQ7A 2WT7A 3CCSP 1K04A 3M9QA 1LT9C 1BE3E 1M1KQ 1GK6A 3D6ZA 3CCVP 3II6A 4IFDK 1JMMA 2K3RA 2K9JB 4PD4E 2QIWA 1N2DC 2C9NY 1OX3A 3R2PA 4N3YB 2MKVA 2IBZG 1SS1A 5BU5A 5CCHD 1U7JA 3VP9A 1NTZE 4C7RA 4TT3H 1NH4A 1UIXA 3HUSB 1X0TA 1NTME 4BRYB 4H13B 3I5CA 1DH3A 3CL3D 2BEZF 4IFFA 1KYOH 3G3ZA 5CCHC 1CZQA 3WUVA 1YITP 3SFEC 3BRTB 2LKMA 1W2EA 2H43A 1LNQA 1KILD 3PP5A 3OJAB 5B5EE 4I1LA 1GU5A 5C39A 3L70J 1IFIA 2OYHA 3G6EP 2KXPB 2LXCB 4Z1MH 3CWBD 1VPCA 2KLVA 2M5AA 2GA1A 3HE4B 1RF1C 1DD3A 3IR9A 1KILC 2LXBA 1LP1A 3ITKA 3Q5SA 1H88A 3U59A 4YTPC 1EZVE 1OXZA 3O6QB 3GHGB 2HFED 2AEFA 4PV1D 1SQPJ 3CCMP 3TDKA 3CWBG 3G9RA 3G4SP 3KZIE 3Q5RA 3CC7P 1NTKK 3PH0A 2B88A 2O1KA 4OGQD 2KZJA 1EC5A 3H1ID 4PV1C 3H1LJ 1RHZB 1LWUC 4EIJA 2YO2A 2LR2A 2Q3IA 1NTZK 3L72E 1SQQE 1URQA 4JBZA 1JY3O 1HBWA 3V4QA 2C0XA 2HODA 4OGQC 2KSEA 3MTUE 2I1KA 1WT6A 3WMM0 1P84H 4LGDE 3MHVA 4GODA 1MZ9A 3VP8A 3HD7B 3PTZA 1ZMEC 2IPPA 4D6TE 1USEA 4L73A 1SQBJ 2JKVA 1RQUA 4RJTA 1QVFO 2P7JA 4HB1A 3A0HH 1RH5B 4YXWH 4Y99C 1PPJD 5KLVD 3FXEA 4IL6E 3H1KE 3L70D 1L0NE 2H88C 2OYIB 1Z56A 3JC22 2W6AA 5AW0B 1J1EC 1PZQA 2OTLP 1NHLA 1PPJG 3AE2C 3L70G 2FXPA 2E75B 2KI7B 1LTTC 1YIJP 3L71J 1PP9J 5KKZC 2M3EA 1SQPD 3CLQA 2QA4P 2WSEH 1T6AA 2RH0A 4IOIH 1J1DC 2GUSA 2KS1A 1SQQK 1SQPG 4GOFA 1SFCA 5AW9B 1NU1J 3TNUB 3WU2E 1FZCA 3FXDA 1SQVJ 3TF5A 2FFDA 2H8PD 1QL2A 2POHA 2ZFCA 1VQLP 4U3FJ 2HR3A 3WUTA 1VQPP 3OAKA 1OVVA 4JQ0D 2BASA 1PL5A 3HTKA 2O01N 3L35A 3NFQA 2KLUA 3NMDA 1S4XA 4JYBA 1DIPA 3EFGA 1GL2B 1X9VA 1PGPA 1NJIQ 1VQMP 4RKUJ 4B86A 1QVGO 1L0NK 3CD6P 3GMAA 2P10A 3S4RA 4YXDC 4AYCA 1NOHA 2WSSH 3CXHH 3CCRP 5TISE 1HTLC 3RL0D 4IL6H 2KUBA 3B5NB 3HUSA 5AW3B 1JTHB 3CCLP 1LJ2A 4BRYA 2BCCD 1CSBA 3CCUP 1URQD 3VTPC 2YNYA 2WSFJ 1BE3J 1FDIA 3H25A 3MUDC 3RL0C 2FYUE 3L71D 1HGVA 2YXQB 1RF0A 4GDOA 5KLIC 4L76A 5APUA 2YMYA 1G2CB 4ZNCA 3D70A 1DD4A 1URQC 2AEMA 3G71P 1SLQA 3KYQA 3TGUD 3H1JD 3L71G 1PP9G 3FWLA 1CI6B 1NTZJ 1NU1D 3WU2H 3L73E 3H1HE 5AVTB 1NTMJ 1QL1A 1NVOA 3O6QA 3GHGA 3L74D 3L75E 1VQ9P 1KYOD 1LTBC 4UB8E 1NU1G 1SQXJ 3AEFC 2NPSB 5AW4B 5KLVK 3RK3B 5GTHH 1M90Q 3KHUA 3MZWB
chains in the Genus database with same CATH topology
1FBMA 3LIDA 2NPSA 3MUDA 1KILB 1XTCC 3M9QA 3BVHA 1LT9C 1HH0A 2WZ7A 3BRVB 4GKGA 1JUNA 1M1JB 1GK6A 1HVVA 4IFMA 3II6A 4IFDK 1JMMA 3N4XA 4WY4B 5AW7B 1KQLA 3B5NC 3BATA 2OYHC 1YYCA 4N78D 1FJPA 1N2DC 4XA4A 4GT1A 3VMYA 1NTMK 1ZR4A 2C9NY 1S9KD 2PAJA 2YO3A 3M0DC 3R2PA 2R5BA 4N3YB 3VMXA 1HJBA 4AQRD 5BU5A 5CCHD 1G1IA 1RE4C 4WB4A 3TK1A 3VP9A 1N7SA 1KFNA 1LWUB 1SFCD 1SQXK 2OARA 4C7RA 5CCGA 1NH4A 1HGZA 3A5TA 3HUSB 2P67A 5AW5B 3U1CA 1ZLLA 1GW4A 3U1AA 3I5CA 1IJDB 1DH3A 3CL3D 1NAFA 3HD7A 2IFNA 1LTJC 4IFFA 1L0LK 3G3ZA 5CCHC 5AVUB 1GU4A 1CZQA 2JEEA 3BRTB 2LKMA 1SFCC 1W2EA 2H43A 3RK3D 2QM7A 1ZN5A 1IFJA 4C7NA 1FZCC 1KILD 1YTZT 3OJAB 3PP5A 1N73B 1IO4A 3OA7A 1KFMA 2XNXA 2W6BA 4I1LA 1GTWA 1GU5A 3MGNA 1IFIA 2JJLA 2FFDC 2OYHA 4W7YA 3KPEA 1NO4A 3HE5B 2HPCB 2OYIA 3P8MC 4WY4D 3M9HA 5APSA 1VPCA 2KLVA 3HRNA 3RK3C 1M7LA 1GL2D 1RF1C 3HE4B 2GM4A 4Y99B 3IR9A 1KILC 1H88A 1HUCA 3HE4A 3U59A 2N1TB 1OXZA 3C9IA 3TYYA 3GHGB 2HFED 5AW8B 2P1JA 1FAVA 4WY4C 1LTIC 5KJ7D 1LTJA 1GL2C 4HH2A 2N9BA 3V2RA 1NTKK 2WWWA 5AVZB 1GW3A 2O1KA 5APQA 2CPSA 2R5DA 2L5GB 1VDFA 2A45G 2MJZA 5AVSB 2ZXEB 1NKNA 2KSJA 1L4AA 3SWFA 1LWUC 5APTA 4ZKUA 2XKMA 5CMZA 4EIJA 2HYNA 3HUSC 1FOSF 2YO2A 1J1DB 2Q3IA 5KJ7C 1MFZA 1NTZK 3LW5H 1URQA 1JY2O 2P2UA 1JY3O 2XDJA 3IFMA 1HBWA 2O1JA 1X79B 1A02J 3E1IA 3V4QA 2C0XA 3V5BA 2HODA 1MUUA 1SQPK 1N7SB 3MTUE 2I1KA 5APVA 1JCDA 1WRGA 1WT6A 4O9BA 2XZRA 3L36A 1JY2P 3WMM0 2W27A 1JY3P 3L37A 1FDMA 4LGDE 3A2AA 1MZ9A 2N1TD 2YKQA 1XTGB 1FOSE 3VP8A 3SWYA 3HD7B 2IPPA 1RE3A 1DEBA 3BASA 2Q5UA 1NKZB 2FKWB 1J2JB 5APWA 3V2NA 4ZKPA 4C7NB 2P7JA 3CI9A 1IK9A 1LT9A 2NPSD 3NXSA 4Y99C 3VYIA 1T2KD 1ZV8A 2N1TC 2OYHB 1G1JA 3GHGC 3P8CE 2OYIB 1Z56A 3B5NA 2WSCH 2XU6A 1JTHA 2W6AA 5AW0B 1SVFA 3NTNA 2IX7C 2C9LY 3A7OA 1J1EC 3M0AA 1NHLA 5APYA 3M0DA 3RK2B 4RESB 2NPSC 1IFMA 4EOTA 1IFDA 2VRSA 1T2KC 2M3BA 4N6JA 1RE4A 5APXA 3A3YB 1LTTC 2Z5HA 2Z4EA 3MIWA 1N7SD 1NWQA 3M9BA 3CLQA 5CCGD 5AVRB 1H89A 4AUWA 1AQ5A 2J58A 2WSEH 1M1JC 1HWTC 1LTJB 3VN0A 3N7NA 1G2CA 5KTBA 1J1DC 1FU1A 3T97A 1IFNA 2GUSA 4XE5B 3TSIA 1LTSC 2WPSA 1T3JA 5CCHA 1YTZI 3HD7D 3RL0B 2FXMA 1SQQK 1SP4A 5AW9B 1SFCA 3V2PA 4W80A 1CI6A 2IFMA 3TNUB 4KHXA 1N7SC 1PFIA 1L4AB 2WSFH 5CCGC 1FZCA 1IC2A 3TNUA 1MV8A 2FYZA 1T3UA 2FFDA 1URQB 1KZUB 2H8PD 3M91A 2KP8A 1QL2A 4LC1A 5AW2B 2POHA 2ZFCA 3HD7C 2KB7P 2HODB 2Q7CA 5AVWB 3P7KA 3H32A 2WITA 3OAKA 1RF1A 2BASA 3HTKA 4WBAA 2YKOA 4C46A 1LGHB 3L35A 1KILA 3NFQA 2CPBA 5BVZA 3KDPB 3RK2D 1FZBA 2YKPA 1RY3A 2M8RA 3NMDA 1RF0C 2J59M 4JYBA 3V2QA 4M3LA 1M1JA 3EFGA 1GL2B 1X9VA 1N73C 1NU1K 3L4FA 4WY4A 2OYIC 4B86A 1GL2A 5AW6B 2O01H 2A45H 2E42A 5BU8B 1L0NK 2I1JA 1FZGA 1N86A 3O8ZA 1LT9B 4AYCA 1NOHA 1SQVK 3RK2C 4LLHA 1A02F 3VOPA 1GDTA 3VMZA 1LTAC 1HTLC 4OH8B 3RL0D 1GZLA 4JF7A 2R3CA 1LWUA 2FYUK 3B5NB 1JO5A 3M06A 1L4AD 3HUSA 5AW3B 1JTHB 3UIAA 4DZOA 5KJ7A 2WTYA 4DOJA 1OWAA 5AW1B 1CSBA 1URQD 2GUVA 5CJ0A 3VTPC 2YNYA 1FZFA 5AVXB 1AFOA 2KYVA 1T8ZA 3LIEA 1H8AA 4I2LC 1FJKA 3RL0C 1E5WA 5CHXA 1HGVA 2KOGA 2R32A 4HYTB 1GK4A 1RF0A 1L4AC 1JOCA 2H7HA 1SQBK 5APUA 2YMYA 3KQGA 1FZEA 1G2CB 1N73A 1JCCA 1X8YA 3H6PA 1URQC 1SLQA 1GD2E 3HE5A 3KYQA 2QM8A 1JY2N 5AVYB 2HPCA 1JY3N 2HG5D 2E43A 3V4WA 1SFCB 2WPQA 4N78E 1CI6B 2PP6A 3P32A 1DX7A 1N7LA 1LTGC 4I6MC 1S9KE 2WPRA 1FZCB 1CW5A 2Z5IA 4GIFA 1JNMA 5AVTB 3P8CD 1QL1A 2Q9IA 2FFDB 3B8EB 2N1TA 2A45I 2C0WA 1FZAA 4W7ZA 3GHGA 5AVQB 1ZR2A 1J1EB 2XV5A 3MD0A 1LTBC 5CJ4A 2WT7B 2HLOA 1RE3C 3H32B 5AVVB 2NPSB 3B5ND 5AW4B 5KLVK 3RK3B 4JYCA 3EQ2A 1RF1B 3HTKB 1EQ7A 2WT7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTM K;  2O01 H;  1SQB K;  2WSF H;  3M9Q A;  3CLQ A;  1L0N K;  2WSC H;  1SQP K;  2WSE H;  1L0L K;  1SQV K;  3G3Z A;  4IFD K;  2LKM A;  1SQX K;  2J59 M;  2OAR A;  1NTZ K;  3LW5 H;  5KLV K;  1NTK K;  2FYU K;  1NU1 K;  1SQQ K; 
#chains in the Genus database with same CATH topology
 1SQV G;  3BVH A;  2Y9Z A;  4I7Z C;  2QJY B;  2FXO A;  2WZ7 A;  4A7P A;  4GKG A;  1L0L J;  4IFM A;  3RK3 E;  4U3F G;  5GTI E;  4NPD A;  4N78 D;  1FJP A;  2QJK B;  3VMY A;  1S9K D;  1YJN P;  2WQY C;  4WB4 A;  2B87 B;  1K73 Q;  1KFN A;  1SFC D;  4JPZ B;  4DJG A;  2WSE J;  2P67 A;  1JB0 J;  3SWK A;  1BCC E;  1VF5 D;  1D7M A;  3HD7 A;  1Q86 Q;  1LTJ C;  1BE3 D;  1GU4 A;  3AE8 C;  1SFC C;  2QM7 A;  1FZC C;  1PGJ A;  1KFM A;  3L72 J;  1SQQ J;  2JJL A;  1VF5 C;  4R4M A;  2FFD C;  5KAF E;  1BE3 G;  3KPE A;  1NO4 A;  3CX5 D;  5E79 H;  2OYI A;  3M9H A;  5APS A;  3CME P;  2D2C D;  1P84 D;  1NTM D;  1JM0 A;  2N1T B;  3C9I A;  3BCC E;  3TYY A;  5AW8 B;  3E7K A;  2RN0 A;  5TJH A;  4D6T J;  3FGA D;  1NTZ G;  1FAV A;  1SQX D;  4UB8 H;  2L91 A;  2N9B A;  1NTM G;  5AVZ B;  2D2C C;  2JO1 A;  5APQ A;  1FE6 A;  1FS0 E;  1AA0 A;  3H1K J;  2MJZ A;  1L0N J;  5AVS B;  2ZXE B;  1L0L D;  1NKN A;  2E76 D;  3GG2 A;  1SQX G;  2IBZ D;  5GTI H;  3HUS C;  1FOS F;  1NTK E;  1KYO I;  1Q7Y Q;  1MFZ A;  2ZT9 B;  4H13 C;  1KMI Z;  2N9Y B;  2YIU B;  4K3A A;  1A02 J;  1L0L G;  2E76 C;  1KOR A;  4O9B A;  1PGO A;  2XZR A;  1JY2 P;  2W27 A;  1WMK A;  1KB9 I;  1Y47 A;  4IL6 X;  3JCU E;  1XTG B;  2ZVO B;  1EZV G;  1KTM A;  3SWY A;  1S72 P;  3C1L A;  3BAS A;  1NKZ B;  1S2E A;  4L74 A;  1J2J B;  5B66 E;  1EDK A;  4C7N B;  4NPE A;  5CBN A;  1T2K D;  1ZV8 A;  1ZP0 C;  2KNC B;  1G1J A;  3GHG C;  1QX8 A;  3P8C E;  3B5N A;  4OVN F;  2XU6 A;  2RKL A;  1JTH A;  1SVF A;  2OQQ A;  2IX7 C;  2Q1K A;  2C9L Y;  4GOE A;  3A7O A;  3M0A A;  5KAI H;  3M0D A;  3RK2 B;  1IFM A;  3L72 G;  1SQQ G;  1IFD A;  2VRS A;  1T2K C;  1K9M Q;  3A3Y B;  3CCE P;  2Z5H A;  3MIW A;  1NWQ A;  1S5L E;  2Q6Q A;  1H89 A;  4AUW A;  2E74 B;  2J58 A;  1VQ7 P;  3CX5 I;  1M1J C;  1HWT C;  1G2C A;  5KTB A;  1IFN A;  4XE5 B;  3CXH D;  3A0B H;  2K37 A;  1E79 H;  3HD7 D;  2FXM A;  1P84 I;  3V2P A;  4W80 A;  1CI6 A;  4D6T G;  2IFM A;  3ABV C;  1PFI A;  2WSF H;  1IC2 A;  1T3U A;  1M56 D;  1KQS O;  3M91 A;  2KP8 A;  4H0L B;  4PD4 H;  5AW2 B;  3H1K G;  3HD7 C;  2KB7 P;  3P7K A;  2FYU J;  4C46 A;  1OW7 A;  2CPB A;  1ZW0 A;  2IBZ I;  2YKP A;  3V2Q A;  2E75 D;  1JMB A;  1KIL E;  2FBW C;  2ZYD A;  1LT1 A;  1N73 C;  2OYI C;  3RBX A;  1ZOY C;  1FZG A;  3Q3D A;  3L73 J;  3H1H J;  4NPF X;  3AE5 C;  2E75 C;  4JF7 A;  3L75 J;  2R3C A;  5B5E H;  4Y28 J;  2E5T A;  5KJ7 A;  2WTY A;  5AW1 B;  4HKZ H;  4OGQ B;  5L8R J;  3KXD A;  1BSN A;  1FZF A;  2WMM A;  1AFO A;  1T8Z A;  1H8A A;  1E5W A;  1EXJ A;  2JWA A;  3H1I E;  2H7H A;  2FYN B;  1YBK A;  3C8V A;  3PHL A;  1GD2 E;  3KZI H;  5AVY B;  2E43 A;  2HG5 D;  4ZMD A;  1PGQ A;  3AEB C;  2WPQ A;  2PP6 A;  2ZYA A;  2WPR A;  2IYO A;  1CW5 A;  3H1L D;  2R3S A;  2N1T A;  1S1C X;  1BCC J;  2C0W A;  5AVQ B;  1ZR2 A;  2YXR B;  1EXI A;  1VQ8 P;  2O01 J;  4UB6 E;  1J1E B;  1AVY A;  1IZN B;  2OGU A;  2AXT E;  2WT7 B;  3CXH I;  3H32 B;  5AVV B;  3B5N D;  3CMA P;  2FYU D;  3GW6 A;  3B71 A;  3H1L G;  3LID A;  3ZDM A;  5KKZ B;  5DJT B;  1HH0 A;  3BRV B;  2IZ1 A;  1JUN A;  2G3A A;  1HVV A;  2ZVN B;  4EDF A;  5KLV E;  2FYU G;  4WY4 B;  5AW7 B;  3B5N C;  3AE9 C;  2OYH C;  3AED C;  4GT1 A;  1PIX A;  1SQB D;  3Q5P A;  1ZR4 A;  2K9J A;  1AJY A;  2PGD A;  3M0D C;  1OZH A;  1HJB A;  3Q1M A;  4AQR D;  3BCC J;  1G1I A;  3TK1 A;  1KD1 Q;  5CCG A;  1HGZ A;  3SFD C;  5AW5 B;  4H44 D;  3U1C A;  3RGU A;  1QGK B;  1SQB G;  1GW4 A;  5CBO A;  3L73 G;  3H1H G;  1TU3 F;  1NAF A;  2QRX A;  5AVU B;  3L75 G;  3RK3 D;  4C7N A;  4H44 C;  1NTK J;  1Y8A A;  1PP9 D;  3OA7 A;  1EDL A;  1QEX A;  2KNC A;  2W6B A;  1GTW A;  4W7Y A;  3HE5 B;  2W90 A;  3PJS K;  3QWO C;  3HRN A;  3RK3 C;  1M7L A;  1HUC A;  3HE4 A;  1BCC D;  1DEE G;  3GF7 A;  3I56 P;  4UB6 H;  1SQV D;  2QJP B;  1VQO P;  2AXT H;  1AV1 A;  1LTI C;  5KJ7 D;  3OW2 O;  4HH2 A;  4U3F D;  3V2R A;  2WWW A;  3RL0 g;  3PRJ A;  1USD A;  2CPS A;  2L5G B;  1BCC G;  5KLI B;  2A45 G;  2KSJ A;  1BDC A;  2OTK E;  2Y0E A;  3SWF A;  2G8Y A;  2XKM A;  2HYN A;  1Q81 Q;  5KJ7 C;  4KT0 J;  3LW5 H;  3W67 A;  1X79 B;  2BCC E;  1QLE D;  3E1I A;  1K05 A;  3V5B A;  1MUU A;  3BCC D;  1SQP K;  1N7S B;  1R8E A;  5APV A;  1JCD A;  1WRG A;  4BXL A;  5TIS H;  3L36 A;  1JY3 P;  3L37 A;  1FDM A;  3SSU A;  3L71 E;  1ZRT D;  3AE4 C;  3FWN A;  1HF9 A;  2N1T D;  3CCJ P;  3VMA A;  2W8Z A;  3BCC G;  1OIP A;  2Q5U A;  2FKW B;  4I7Z B;  1NYH A;  5APW A;  1OFC X;  3V2N A;  3TGU E;  3R4Y A;  4PJ0 E;  3H1J E;  2ZYG A;  3NXS A;  1NTK D;  1NU1 E;  2K9Y A;  2N1T C;  4PD4 D;  4DCK A;  1M57 D;  3L74 E;  3NTN A;  4HJG H;  1KYO E;  1OVU A;  5APY A;  1NTK G;  2QVA A;  2ZT9 D;  4RES B;  1NTZ D;  4N6J A;  2I8D A;  1RE4 A;  5APX A;  4TLF A;  1W2B O;  5CCG D;  5AVR B;  2KZI A;  1AQ5 A;  1LTJ B;  3VN0 A;  3N7N A;  2QEX P;  1KB9 E;  2KS1 B;  2ZT9 C;  2WPS A;  1YTZ I;  2YIU C;  2A06 E;  4H13 D;  4QMA A;  1SP4 A;  1H0T B;  1L4A B;  2WPV B;  5CCG C;  1BGY E;  1VF5 B;  1KQF B;  3TNU A;  1MV8 A;  4DT0 A;  5AVW B;  3H32 A;  2WIT A;  3GLM A;  1EZV D;  3AE7 C;  2QE7 H;  4RO0 A;  5BVZ A;  3KDP B;  3H1I J;  3RK2 D;  1FZB A;  1U7M A;  1VQ5 P;  1RY3 A;  2WSC J;  1RF0 C;  4M3L A;  1BDD A;  2JDI H;  1NU1 K;  3L4F A;  4WY4 A;  2D2C B;  2W83 C;  1GL2 A;  2E74 D;  2O01 H;  2A45 H;  5AW6 B;  5BU8 B;  3CX5 E;  1JEK A;  4KJM A;  1VL2 A;  1N86 A;  1EDJ A;  4PJ0 H;  1LT9 B;  1SQV K;  3RK2 C;  4LLH A;  2UWJ E;  3VOP A;  3S9O A;  1KN7 A;  1GZL A;  1P84 E;  3L72 D;  1SQQ D;  3M06 A;  4DZO A;  5KAF H;  4DOJ A;  2E74 C;  2V7Q H;  1YHQ P;  2K88 A;  1SQX E;  2E76 B;  4ASV A;  2GUV A;  4H0L D;  2KYV A;  4CPG A;  2AEJ A;  3LIE A;  3A0H E;  3JSV C;  2KOG A;  2R32 A;  4HYT B;  5KLV J;  4PD4 I;  4U7J A;  1VQN P;  1NAY A;  1L0L E;  3LW5 J;  3KQG A;  4D6T D;  3CCQ P;  3T97 B;  1X8Y A;  3H6P A;  2IBZ E;  1KB9 H;  3HE5 A;  4H0L C;  1JY2 N;  3K5B A;  3AEE C;  4EI2 A;  3V4W A;  3P32 A;  2WVR A;  1N7L A;  3H1K D;  3WUU A;  2CK3 H;  1L0N D;  1IFP A;  2NRG A;  2Q9I A;  4ASW A;  4WVZ A;  4BWN A;  1BSH A;  2XV5 A;  3MD0 A;  2HLO A;  3FX0 A;  2IDB A;  3AE3 C;  1VQ4 P;  1RF1 B;  1MFT A;  4EYY Q;  1Q90 D;  1L0N G;  1FBM A;  2NPS A;  3MUD A;  1KIL B;  1XTC C;  2QG4 A;  3EFF K;  1M1J B;  1VQ6 P;  2ZXX A;  3N4X A;  1KQL A;  3JCU H;  3BAT A;  1YYC A;  4XA4 A;  3H1I G;  1NTM K;  3CX5 H;  1EZV I;  2PAJ A;  2YO3 A;  2R5B A;  3VMX A;  5B66 H;  1Q82 Q;  4PV1 B;  1RE4 C;  1PV3 A;  1N7S A;  3CWB E;  3Q2Y A;  1LWU B;  1SQX K;  2OAR A;  3AE6 C;  3A5T A;  2B87 A;  1ZLL A;  1Y9B A;  2YMK A;  3U1A A;  2FYN C;  1IJD B;  2IFN A;  1L0L K;  1RQV A;  2RMZ A;  2JEE A;  3CXH E;  1ZN5 A;  1IFJ A;  2IYP A;  1YTZ T;  1N73 B;  1IO4 A;  2XNX A;  2E5Y A;  1S5L H;  3MGN A;  2HPC B;  2BCC J;  3P8M C;  4R4L A;  2W6J H;  4WY4 D;  2PFX A;  5KLV G;  1YJ9 P;  1GL2 D;  2GM4 A;  4Y99 B;  3V6I A;  4YPC A;  2P1J A;  1X22 A;  1FC2 C;  3E1R A;  4WY4 C;  2NZ2 A;  1LTJ A;  1GL2 C;  3TGU J;  3H1J J;  1GW3 A;  2KK7 A;  2R5D A;  1VDF A;  1HJ0 A;  1S3J A;  2AXC A;  1H0T A;  1L4A A;  5APT A;  3B4S A;  4ZKU A;  5CMZ A;  2Q3E A;  1ZXG A;  3L74 J;  2V7Q J;  1J1D B;  1PPJ E;  1JY2 O;  2P2U A;  3L70 E;  5M1B A;  2XDJ A;  3IFM A;  5GTH E;  1R5L A;  2O1J A;  3S1K A;  3L73 D;  3H1H D;  2P58 A;  2Y0C A;  3CC4 P;  2O3J A;  1R5S A;  3L75 D;  3IF4 A;  3A2A A;  2YKQ A;  3W68 A;  2OYO A;  1FOS E;  1SQP E;  1RE3 A;  1OVR A;  1DEB A;  2Y9Y A;  2ZJS E;  3AE1 C;  4L75 A;  1Q2N A;  2K1A A;  4ZKP A;  3F5H A;  1BGY J;  3CI9 A;  1IK9 A;  1YI2 P;  1LT9 A;  2FY8 A;  2NPS D;  1AVO A;  2OTJ P;  3VYI A;  1GMJ A;  2OYH B;  3RBZ A;  3H1L E;  5H2F E;  3IAO A;  2WSC H;  3F89 A;  2QJP C;  3I55 P;  2M5A B;  1N8R Q;  2NPS C;  1LP1 B;  4EOT A;  2M3B A;  2XND H;  2Y0D A;  2BCC G;  2Z4E A;  1N7S D;  3M9B A;  2QJY C;  1KV4 A;  5E79 E;  1FU1 A;  4OWF A;  3T97 A;  3TSI A;  1LTS C;  3AEA C;  1T3J A;  5CCH A;  4H44 B;  2V4H A;  3RL0 B;  1EDI A;  2QJK C;  1SQB E;  3AEG C;  4KHX A;  1N7S C;  3CPW O;  2JWD A;  1OW6 A;  2B89 A;  3TGU G;  3H1J G;  2FYZ A;  2PRR A;  1URQ B;  1KZU B;  3QH9 A;  3USS A;  4LC1 A;  1AQT A;  3D71 A;  1MKM A;  4WWI A;  4MN4 C;  2HOD B;  2Q7C A;  5EFW B;  5K5G B;  1RF1 A;  4WBA A;  2YKO A;  3L74 G;  1LGH B;  1KIL A;  2JP3 A;  2IZ0 A;  1U57 A;  1W5C E;  2M8R A;  2DW3 A;  2J59 M;  1KQG B;  1KB9 D;  1M1J A;  1PP9 E;  1NGM B;  2A06 D;  2JR8 A;  1M8O B;  1YQ3 C;  2E42 A;  2I1J A;  1OMI A;  2BEQ D;  2B9B A;  1BGY D;  3PLN A;  3O8Z A;  3CC2 P;  5DJU B;  1A02 F;  1GDT A;  3VMZ A;  1LTA C;  4OH8 B;  2A06 G;  1LWU A;  2FYU K;  1JO5 A;  3EWK A;  5H2F H;  1L4A D;  1YJW P;  3UIA A;  1KC8 Q;  1OWA A;  2R44 A;  3D6Y A;  1BGY G;  1SQV E;  1S5L X;  2ITA A;  5CJ0 A;  5AVX B;  4U3F E;  2J5U A;  4I2L C;  2KIK A;  1FJK A;  5CHX A;  1GK4 A;  1UII A;  1L4A C;  1JOC A;  1VQK P;  1SQB K;  1FZE A;  1N73 A;  1JCC A;  3MP7 B;  1K8A Q;  2M0B A;  4XFJ A;  2QM8 A;  2HPC A;  1JY3 N;  5KAI E;  1SFC B;  4N78 E;  3CWB J;  3AEC C;  1L2P A;  2H89 C;  1DX7 A;  1LTG C;  4I6M C;  1S9K E;  2ZAE B;  1FZC B;  2Z5I A;  4GIF A;  1JNM A;  3IN6 A;  3P8C D;  1YQ4 C;  2FFD B;  3GF3 A;  3B8E B;  2A45 I;  1FZA A;  4W7Z A;  1OW8 A;  2QSI A;  1IK7 A;  1ZRT E;  1FDO A;  5CJ4 A;  1RE3 C;  4JYC A;  3A0B E;  3EQ2 A;  4K35 A;  2SPZ A;  3HTK B;  1EQ7 A;  2WT7 A;  3CCS P;  1K04 A;  3M9Q A;  1LT9 C;  1BE3 E;  1M1K Q;  1GK6 A;  3D6Z A;  3CCV P;  3II6 A;  4IFD K;  1JMM A;  2K3R A;  2K9J B;  4PD4 E;  2QIW A;  1N2D C;  2C9N Y;  1OX3 A;  3R2P A;  4N3Y B;  2MKV A;  2IBZ G;  1SS1 A;  5BU5 A;  5CCH D;  1U7J A;  3VP9 A;  1NTZ E;  4C7R A;  4TT3 H;  1NH4 A;  1UIX A;  3HUS B;  1X0T A;  1NTM E;  4BRY B;  4H13 B;  3I5C A;  1DH3 A;  3CL3 D;  2BEZ F;  4IFF A;  1KYO H;  3G3Z A;  5CCH C;  1CZQ A;  3WUV A;  1YIT P;  3SFE C;  3BRT B;  2LKM A;  1W2E A;  2H43 A;  1LNQ A;  1KIL D;  3PP5 A;  3OJA B;  5B5E E;  4I1L A;  1GU5 A;  5C39 A;  3L70 J;  1IFI A;  2OYH A;  3G6E P;  2KXP B;  2LXC B;  4Z1M H;  3CWB D;  1VPC A;  2KLV A;  2M5A A;  2GA1 A;  3HE4 B;  1RF1 C;  1DD3 A;  3IR9 A;  1KIL C;  2LXB A;  1LP1 A;  3ITK A;  3Q5S A;  1H88 A;  3U59 A;  4YTP C;  1EZV E;  1OXZ A;  3O6Q B;  3GHG B;  2HFE D;  2AEF A;  4PV1 D;  1SQP J;  3CCM P;  3TDK A;  3CWB G;  3G9R A;  3G4S P;  3KZI E;  3Q5R A;  3CC7 P;  1NTK K;  3PH0 A;  2B88 A;  2O1K A;  4OGQ D;  2KZJ A;  1EC5 A;  3H1I D;  4PV1 C;  3H1L J;  1RHZ B;  1LWU C;  4EIJ A;  2YO2 A;  2LR2 A;  2Q3I A;  1NTZ K;  3L72 E;  1SQQ E;  1URQ A;  4JBZ A;  1JY3 O;  1HBW A;  3V4Q A;  2C0X A;  2HOD A;  4OGQ C;  2KSE A;  3MTU E;  2I1K A;  1WT6 A;  3WMM 0;  1P84 H;  4LGD E;  3MHV A;  4GOD A;  1MZ9 A;  3VP8 A;  3HD7 B;  3PTZ A;  1ZME C;  2IPP A;  4D6T E;  1USE A;  4L73 A;  1SQB J;  2JKV A;  1RQU A;  4RJT A;  1QVF O;  2P7J A;  4HB1 A;  3A0H H;  1RH5 B;  4YXW H;  4Y99 C;  1PPJ D;  5KLV D;  3FXE A;  4IL6 E;  3H1K E;  3L70 D;  1L0N E;  2H88 C;  2OYI B;  1Z56 A;  3JC2 2;  2W6A A;  5AW0 B;  1J1E C;  1PZQ A;  2OTL P;  1NHL A;  1PPJ G;  3AE2 C;  3L70 G;  2FXP A;  2E75 B;  2KI7 B;  1LTT C;  1YIJ P;  3L71 J;  1PP9 J;  5KKZ C;  2M3E A;  1SQP D;  3CLQ A;  2QA4 P;  2WSE H;  1T6A A;  2RH0 A;  4IOI H;  1J1D C;  2GUS A;  2KS1 A;  1SQQ K;  1SQP G;  4GOF A;  1SFC A;  5AW9 B;  1NU1 J;  3TNU B;  3WU2 E;  1FZC A;  3FXD A;  1SQV J;  3TF5 A;  2FFD A;  2H8P D;  1QL2 A;  2POH A;  2ZFC A;  1VQL P;  4U3F J;  2HR3 A;  3WUT A;  1VQP P;  3OAK A;  1OVV A;  4JQ0 D;  2BAS A;  1PL5 A;  3HTK A;  2O01 N;  3L35 A;  3NFQ A;  2KLU A;  3NMD A;  1S4X A;  4JYB A;  1DIP A;  3EFG A;  1GL2 B;  1X9V A;  1PGP A;  1NJI Q;  1VQM P;  4RKU J;  4B86 A;  1QVG O;  1L0N K;  3CD6 P;  3GMA A;  2P10 A;  3S4R A;  4YXD C;  4AYC A;  1NOH A;  2WSS H;  3CXH H;  3CCR P;  5TIS E;  1HTL C;  3RL0 D;  4IL6 H;  2KUB A;  3B5N B;  3HUS A;  5AW3 B;  1JTH B;  3CCL P;  1LJ2 A;  4BRY A;  2BCC D;  1CSB A;  3CCU P;  1URQ D;  3VTP C;  2YNY A;  2WSF J;  1BE3 J;  1FDI A;  3H25 A;  3MUD C;  3RL0 C;  2FYU E;  3L71 D;  1HGV A;  2YXQ B;  1RF0 A;  4GDO A;  5KLI C;  4L76 A;  5APU A;  2YMY A;  1G2C B;  4ZNC A;  3D70 A;  1DD4 A;  1URQ C;  2AEM A;  3G71 P;  1SLQ A;  3KYQ A;  3TGU D;  3H1J D;  3L71 G;  1PP9 G;  3FWL A;  1CI6 B;  1NTZ J;  1NU1 D;  3WU2 H;  3L73 E;  3H1H E;  5AVT B;  1NTM J;  1QL1 A;  1NVO A;  3O6Q A;  3GHG A;  3L74 D;  3L75 E;  1VQ9 P;  1KYO D;  1LTB C;  4UB8 E;  1NU1 G;  1SQX J;  3AEF C;  2NPS B;  5AW4 B;  5KLV K;  3RK3 B;  5GTH H;  1M90 Q;  3KHU A;  3MZW B; 
#chains in the Genus database with same CATH homology
 1FBM A;  3LID A;  2NPS A;  3MUD A;  1KIL B;  1XTC C;  3M9Q A;  3BVH A;  1LT9 C;  1HH0 A;  2WZ7 A;  3BRV B;  4GKG A;  1JUN A;  1M1J B;  1GK6 A;  1HVV A;  4IFM A;  3II6 A;  4IFD K;  1JMM A;  3N4X A;  4WY4 B;  5AW7 B;  1KQL A;  3B5N C;  3BAT A;  2OYH C;  1YYC A;  4N78 D;  1FJP A;  1N2D C;  4XA4 A;  4GT1 A;  3VMY A;  1NTM K;  1ZR4 A;  2C9N Y;  1S9K D;  2PAJ A;  2YO3 A;  3M0D C;  3R2P A;  2R5B A;  4N3Y B;  3VMX A;  1HJB A;  4AQR D;  5BU5 A;  5CCH D;  1G1I A;  1RE4 C;  4WB4 A;  3TK1 A;  3VP9 A;  1N7S A;  1KFN A;  1LWU B;  1SFC D;  1SQX K;  2OAR A;  4C7R A;  5CCG A;  1NH4 A;  1HGZ A;  3A5T A;  3HUS B;  2P67 A;  5AW5 B;  3U1C A;  1ZLL A;  1GW4 A;  3U1A A;  3I5C A;  1IJD B;  1DH3 A;  3CL3 D;  1NAF A;  3HD7 A;  2IFN A;  1LTJ C;  4IFF A;  1L0L K;  3G3Z A;  5CCH C;  5AVU B;  1GU4 A;  1CZQ A;  2JEE A;  3BRT B;  2LKM A;  1SFC C;  1W2E A;  2H43 A;  3RK3 D;  2QM7 A;  1ZN5 A;  1IFJ A;  4C7N A;  1FZC C;  1KIL D;  1YTZ T;  3OJA B;  3PP5 A;  1N73 B;  1IO4 A;  3OA7 A;  1KFM A;  2XNX A;  2W6B A;  4I1L A;  1GTW A;  1GU5 A;  3MGN A;  1IFI A;  2JJL A;  2FFD C;  2OYH A;  4W7Y A;  3KPE A;  1NO4 A;  3HE5 B;  2HPC B;  2OYI A;  3P8M C;  4WY4 D;  3M9H A;  5APS A;  1VPC A;  2KLV A;  3HRN A;  3RK3 C;  1M7L A;  1GL2 D;  1RF1 C;  3HE4 B;  2GM4 A;  4Y99 B;  3IR9 A;  1KIL C;  1H88 A;  1HUC A;  3HE4 A;  3U59 A;  2N1T B;  1OXZ A;  3C9I A;  3TYY A;  3GHG B;  2HFE D;  5AW8 B;  2P1J A;  1FAV A;  4WY4 C;  1LTI C;  5KJ7 D;  1LTJ A;  1GL2 C;  4HH2 A;  2N9B A;  3V2R A;  1NTK K;  2WWW A;  5AVZ B;  1GW3 A;  2O1K A;  5APQ A;  2CPS A;  2R5D A;  2L5G B;  1VDF A;  2A45 G;  2MJZ A;  5AVS B;  2ZXE B;  1NKN A;  2KSJ A;  1L4A A;  3SWF A;  1LWU C;  5APT A;  4ZKU A;  2XKM A;  5CMZ A;  4EIJ A;  2HYN A;  3HUS C;  1FOS F;  2YO2 A;  1J1D B;  2Q3I A;  5KJ7 C;  1MFZ A;  1NTZ K;  3LW5 H;  1URQ A;  1JY2 O;  2P2U A;  1JY3 O;  2XDJ A;  3IFM A;  1HBW A;  2O1J A;  1X79 B;  1A02 J;  3E1I A;  3V4Q A;  2C0X A;  3V5B A;  2HOD A;  1MUU A;  1SQP K;  1N7S B;  3MTU E;  2I1K A;  5APV A;  1JCD A;  1WRG A;  1WT6 A;  4O9B A;  2XZR A;  3L36 A;  1JY2 P;  3WMM 0;  2W27 A;  1JY3 P;  3L37 A;  1FDM A;  4LGD E;  3A2A A;  1MZ9 A;  2N1T D;  2YKQ A;  1XTG B;  1FOS E;  3VP8 A;  3SWY A;  3HD7 B;  2IPP A;  1RE3 A;  1DEB A;  3BAS A;  2Q5U A;  1NKZ B;  2FKW B;  1J2J B;  5APW A;  3V2N A;  4ZKP A;  4C7N B;  2P7J A;  3CI9 A;  1IK9 A;  1LT9 A;  2NPS D;  3NXS A;  4Y99 C;  3VYI A;  1T2K D;  1ZV8 A;  2N1T C;  2OYH B;  1G1J A;  3GHG C;  3P8C E;  2OYI B;  1Z56 A;  3B5N A;  2WSC H;  2XU6 A;  1JTH A;  2W6A A;  5AW0 B;  1SVF A;  3NTN A;  2IX7 C;  2C9L Y;  3A7O A;  1J1E C;  3M0A A;  1NHL A;  5APY A;  3M0D A;  3RK2 B;  4RES B;  2NPS C;  1IFM A;  4EOT A;  1IFD A;  2VRS A;  1T2K C;  2M3B A;  4N6J A;  1RE4 A;  5APX A;  3A3Y B;  1LTT C;  2Z5H A;  2Z4E A;  3MIW A;  1N7S D;  1NWQ A;  3M9B A;  3CLQ A;  5CCG D;  5AVR B;  1H89 A;  4AUW A;  1AQ5 A;  2J58 A;  2WSE H;  1M1J C;  1HWT C;  1LTJ B;  3VN0 A;  3N7N A;  1G2C A;  5KTB A;  1J1D C;  1FU1 A;  3T97 A;  1IFN A;  2GUS A;  4XE5 B;  3TSI A;  1LTS C;  2WPS A;  1T3J A;  5CCH A;  1YTZ I;  3HD7 D;  3RL0 B;  2FXM A;  1SQQ K;  1SP4 A;  5AW9 B;  1SFC A;  3V2P A;  4W80 A;  1CI6 A;  2IFM A;  3TNU B;  4KHX A;  1N7S C;  1PFI A;  1L4A B;  2WSF H;  5CCG C;  1FZC A;  1IC2 A;  3TNU A;  1MV8 A;  2FYZ A;  1T3U A;  2FFD A;  1URQ B;  1KZU B;  2H8P D;  3M91 A;  2KP8 A;  1QL2 A;  4LC1 A;  5AW2 B;  2POH A;  2ZFC A;  3HD7 C;  2KB7 P;  2HOD B;  2Q7C A;  5AVW B;  3P7K A;  3H32 A;  2WIT A;  3OAK A;  1RF1 A;  2BAS A;  3HTK A;  4WBA A;  2YKO A;  4C46 A;  1LGH B;  3L35 A;  1KIL A;  3NFQ A;  2CPB A;  5BVZ A;  3KDP B;  3RK2 D;  1FZB A;  2YKP A;  1RY3 A;  2M8R A;  3NMD A;  1RF0 C;  2J59 M;  4JYB A;  3V2Q A;  4M3L A;  1M1J A;  3EFG A;  1GL2 B;  1X9V A;  1N73 C;  1NU1 K;  3L4F A;  4WY4 A;  2OYI C;  4B86 A;  1GL2 A;  5AW6 B;  2O01 H;  2A45 H;  2E42 A;  5BU8 B;  1L0N K;  2I1J A;  1FZG A;  1N86 A;  3O8Z A;  1LT9 B;  4AYC A;  1NOH A;  1SQV K;  3RK2 C;  4LLH A;  1A02 F;  3VOP A;  1GDT A;  3VMZ A;  1LTA C;  1HTL C;  4OH8 B;  3RL0 D;  1GZL A;  4JF7 A;  2R3C A;  1LWU A;  2FYU K;  3B5N B;  1JO5 A;  3M06 A;  1L4A D;  3HUS A;  5AW3 B;  1JTH B;  3UIA A;  4DZO A;  5KJ7 A;  2WTY A;  4DOJ A;  1OWA A;  5AW1 B;  1CSB A;  1URQ D;  2GUV A;  5CJ0 A;  3VTP C;  2YNY A;  1FZF A;  5AVX B;  1AFO A;  2KYV A;  1T8Z A;  3LIE A;  1H8A A;  4I2L C;  1FJK A;  3RL0 C;  1E5W A;  5CHX A;  1HGV A;  2KOG A;  2R32 A;  4HYT B;  1GK4 A;  1RF0 A;  1L4A C;  1JOC A;  2H7H A;  1SQB K;  5APU A;  2YMY A;  3KQG A;  1FZE A;  1G2C B;  1N73 A;  1JCC A;  1X8Y A;  3H6P A;  1URQ C;  1SLQ A;  1GD2 E;  3HE5 A;  3KYQ A;  2QM8 A;  1JY2 N;  5AVY B;  2HPC A;  1JY3 N;  2HG5 D;  2E43 A;  3V4W A;  1SFC B;  2WPQ A;  4N78 E;  1CI6 B;  2PP6 A;  3P32 A;  1DX7 A;  1N7L A;  1LTG C;  4I6M C;  1S9K E;  2WPR A;  1FZC B;  1CW5 A;  2Z5I A;  4GIF A;  1JNM A;  5AVT B;  3P8C D;  1QL1 A;  2Q9I A;  2FFD B;  3B8E B;  2N1T A;  2A45 I;  2C0W A;  1FZA A;  4W7Z A;  3GHG A;  5AVQ B;  1ZR2 A;  1J1E B;  2XV5 A;  3MD0 A;  1LTB C;  5CJ4 A;  2WT7 B;  2HLO A;  1RE3 C;  3H32 B;  5AVV B;  2NPS B;  3B5N D;  5AW4 B;  5KLV K;  3RK3 B;  4JYC A;  3EQ2 A;  1RF1 B;  3HTK B;  1EQ7 A;  2WT7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...