1SQQD

Crystal structure analysis of bovine bc1 with methoxy acrylate stilbene (moas)
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 51
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1sqqD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1sqqD02
1HRCA 1BCCD 3A0HV 1DVVA 1C6OA 3PXTA 4Q5PA 1W2LA 1ETPA 2CA3B 1NTKD 1BL9A 1A8CA 1CXAA 2C1UA 5AURA 2N18C 3SWSA 3H1HD 4WQ7A 3ZOXA 4AALA 3PRJA 3VRDA 1N50A 1SQVD 2KS1A 1C7MA 2LITA 3SXTA 1MG3D 1LC1A 4O1QA 5CIBB 3ZOYA 1N90A 3DR0A 3ZIYA 1KYOW 2QJYB 3L71D 1CTZA 5CICB 1CTYA 3DMIA 4FANA 2AXTV 4AANA 4J20A 3TGUD 2BGVX 3WFCC 1HCMA 3TDKA 1JDLA 3WUIA 1IRWA 4L1QA 4N0KA 2I8FA 1H32A 3FWLA 2B4ZA 4WQEA 1HROA 4UB6V 3WU2V 2D0WA 4WQAA 5CIEB 3RN0A 1IZL0 1CRIA 1H32B 1HJ4A 3A0BV 3ZOOA 1LC2A 1OCDA 1CCRA 2ZZS1 3KZIV 3SVWA 3WFDC 5B66V 1CRCA 2ZBOA 4PJ0V 5DFSA 3WFBC 1I6EA 1NTZD 2PCBB 1L9BC 4AAMA 2L91A 3L75D 1N15A 3O20A 2Q3EA 3L70D 4EICA 1CCHA 1CIFA 1H31A 4IL6V 3VNWA 1WVEC 1QYZA 4GYDA 1DW1A 4AX3A 1R0QA 1A56A 1KYOD 1YICA 3MK7B 1W5CT 2MTAC 1H31B 1YTCA 3CX5D 1EZVD 4WQ8A 3NBTA 1DT1A 2YIUB 3ZBMA 2Y0EA 2YQBA 1RAPA 3H1ID 3CU4A 3HQ6A 1CORA 2N18B 1OAEA 5DF5A 1HZUA 2FRCA 3HQ7A 4L3HA 4QAOA 4WQ9A 4YE1A 3L4MA 3L72D 2BPBB 2QG4A 4PW9B 2QJPB 3OA8B 5TISV 1U75B 1CIHA 1E8EA 2ZOOA 1HJ3A 2JQRA 4WQCA 5KLIB 5CIFB 1C75A 1KB9D 2CA4B 2Y0DA 2OZ1B 1KX2A 5DJQC 4FA1A 1IQCA 4V2KA 4EIEA 4Y5RA 1SQXD 2B0ZB 3VYMA 1M70A 3C2CA 1L0ND 2GB8B 3TF5A 1NMLA 3VMAA 1I55A 4FB1A 5CIGB 3GG2A 2N3YA 2HV4A 3O1YA 2B11B 1CSVA 4P4QB 4WQBA 4XYDB 2JTIB 1KB0A 2C1DA 5IY51 3L73D 1I5TA 2B12B 1NNOA 1CC5A 1CYJA 3CX5W 1AOFA 1A2SA 155CA 2N9JA 2AI5A 5B5EV 3O0RC 2C9XB 3SJLA 1YIQA 1F1FA 2C1DB 2YCCA 3DP5A 1KX7A 1YNRA 1YEBA 5E79V 3L4OA 1DIIC 1HH7A 2MHMA 2LIRA 1CRGA 4JCGA 2QJKB 5EXQA 1SQBD 351CA 2C1VA 1CRYA 5GTIV 4A7PA 5B6QA 3SLEA 2DVHA 1GQ1A 3RLMA 1CXCA 5TJHA 3PXSA 1QL4A 1F1CA 2EXVA 3PTZA 1COTA 4WQDA 2BH4X 1M6ZA 2D0SA 3PXWA 1C6RA 1KIBA 4XXLA 3H1KD 2C8SA 3OCDB 1C52A 2PACA 4FA9A 3RN1A 1C6SA 1CIEA 1I8OA 2A06D 2BCCD 1CNOA 1B7VA 2B10B 4K3IA 1DVHA 2BCNB 3BCCD 3PLNA 2CXBA 1CRHA 1GJQA 3O5CA 4MU8A 1DW3A 4RJTA 3L74D 2KNCB 1C2NA 1J3SA 1GIWA 1S6VB 2RMZA 2GC7D 1FCDC 3JBTB 3ZCFA 4DY9A 2C2CA 2V08A 1PPJD 3ZOWA 1CTJA 2BLFB 3OA8A 2O3JA 4FAVA 5DJQB 1H1OA 1H9XA 1P84D 1AOQA 2Y0CA 4FA4A 1L9JC 1U74B 4U3FD 2BH5X 2OZ1A 1H33B 4PD4D 2DGEA 1E29A 1HJ5A 1QL3A 4H0KA 2PCCB 1GKSA 1CYIA 2YK3A 3M97X 3ORVA 3KHUA 1FHBA 3GW6A 5KAIV 5CYTR 1CHJA 1I6DA 1FI9A 1LS9A 2XTSB 1HZVA 3RMZA 2RN0A 2JWAA 4AAOA 1RZ5A 2CE1A 2ZONG 1AYGA 4LJIA 1CSUA 1RAQA 5KLVD 3NWVA 2FYNB 1C2RA 1I54A 2N3BA 1CHIA 3HQ9A 3CXHW 3CWBD 3PHLA 1ZZHA 4L3GA 1FI3A 1QN2A 1CIGA 1KV9A 3WC8A 1GDVA 5CIDB 4KMGA 3H1JD 4PWAA 1L0LD 2N9IA 3X39A 1FI7A 1BGYD 2AIUA 1NTMD 3PH2B 1IO3A 5H2FV 2L4DA 2ORLA 3OCDA 4UB8V 1CRJA 5C0ZA 1I8PA 1S5LV 1IRVA 1FOCA 1ZRTD 1CEDA 4FA5A 4NFGB 1GU2A 3CP5A 4GEDB 5GTHV 451CA 2VHDA 2N9YB 4D6TD 1NIRA 2GC4D 3CYTI 3A9FA 1NMIA 1WEJF 1LMSA 1E2RA 1CYCA 4H0JA 1YFCA 5KKZB 1SQPD 4RSZA 1MG2D 5KAFV 1BE3D 1FJ0A 4EDFA 2FYUD 1SQQD 2GIWA 2V07A 1M60A 1YCCA 3CXHD 4EIFA 2CE0A 1H33A 1PP9D 3H1LD 1K3GA 2ZXYA 3ITKA 1DW0A 2FWLA 3HQ8A 1EB7A 1CHHA 1LFMA 2IBZD 1H9YA 1K3HA 1RZ6A 1N9CA 1CO6A 1NU1D 1CSWA 1DW2A 3TYIA 4O1WA 1QKSA 3NBSA 1CSXA 1AKKA 1YEAA 1MZ4A 1DIQC 5CIHB 2K9JB 1VYDA 3MK7C 4EIDA 5C9MA 3WFEC
chains in the Genus database with same CATH superfamily
1BCCD 5AVRB 4MN4C 1H89A 1NTZK 1EQ7A 2CA3B 3L70G 1BL9A 1ZLLA 1GK4A 3UIAA 2OTJP 3H1HD 4AALA 3PRJA 1SQVD 1X8YA 2WZ7A 4BRYB 1HGVA 2BASA 3IAOA 4LLHA 3SXTA 4GODA 2POHA 4EOTA 1LC1A 4O1QA 3ZOYA 3DR0A 2CPSA 1N73C 1GL2C 2QJYB 2M0BA 3L71D 1USDA 1M1KQ 1LTTC 1CTYA 3A3YB 4D6TE 3GF7A 4J20A 3VP9A 1FDIA 3RL0C 2YNYA 2P1JA 1JDLA 1IRWA 3H25A 3PP5A 3CCJP 4WWIA 2WSEH 2B4ZA 3JCUH 1BSNA 4UB6V 1SQXG 4U3FJ 5GTHH 3L70E 1PP9E 3HE4B 3AEFC 3RN0A 1HJ4A 1IFJA 3M06A 1CCRA 3SVWA 2ZT9D 5B66V 4AUWA 5DFSA 1I6EA 2QJKC 2PCBB 1L9BC 1PV3A 3L75D 2KZIA 1T8ZA 3H32A 1CIFA 5CCGC 1H31A 1LTJB 5CCHC 3P7KA 2ZJSE 2WSCJ 1A56A 1IFDA 4WY4D 2FYZA 1HUCA 4C46A 3MK7B 4JQ0D 1T3UA 1VQKP 2AEMA 1SQBG 1DIPA 3B8EB 3NBTA 3WUUA 2YIUB 1PGJA 3ZBMA 4KT0J 3M0DC 1DEEG 1WT6A 3H1ID 3HQ6A 1PGOA 2N18B 5DF5A 3BRVB 1SVFA 2E5TA 2IX7C 4PV1C 3L4MA 3L72D 3H1JJ 1N73A 4PW9B 1GL2A 4L73A 1ZV8A 3CI9A 2A06G 1BGYJ 2BCCG 2JR8A 1NTMJ 5KLIB 5CIFB 1C75A 1KB9D 2CA4B 2C9LY 2N1TB 4H44B 3AECC 3RK2C 4Y5RA 3VYMA 2NZ2A 1M70A 1U7MA 2QVAA 2E43A 3L74G 3C1LA 1E79H 1S4XA 2IFNA 4GOEA 2KLUA 3QH9A 2N3YA 4H0LC 2HV4A 2I1KA 4ZKPA 2O01N 3O6QA 4XYDB 3MHVA 1S2EA 4H13B 4WBAA 1CYJA 1SQBE 1AVOA 1BE3J 2N9JA 3V4WA 3D6ZA 3IR9A 2YCCA 3VYIA 2PAJA 1VQ6P 4DOJA 3PJSK 1KQGB 3MTUE 2QRXA 4HYTB 1QLED 1NTZE 3VMZA 3L4OA 1NGMB 1DIIC 2A45H 4UB6H 1NOHA 2LIRA 4RESB 5AW8B 2BCCE 1K73Q 4JCGA 5AW4B 5CCHA 1ZP0C 3FGAD 1LWUA 2O01J 1FZCB 2KIKA 2N1TD 5GTHE 2DVHA 3RLMA 1CXCA 1JMBA 5CBNA 2R3SA 4R4MA 5B66H 1RQVA 3G4SP 3PTZA 4ZKUA 2HODB 1C6RA 4XXLA 1L4AA 3L73G 2PP6A 2NRGA 1RE4A 3CX5E 3V2RA 1CIEA 1N7SC 2L5GB 1N86A 1J1DB 1NTKJ 1YJNP 1JO5A 3PLNA 3O5CA 1KFMA 2GC7D 2WWWA 1FCDC 2KOGA 4Y99C 1H0TA 3ZCFA 3ZOWA 2OGUA 2HG5D 2O3JA 1NTMK 2Q7CA 1H9XA 1P84D 1L9JC 1DH3A 2OZ1A 2FBWC 3P8CE 5M1BA 1HJ5A 1R8EA 2WPRA 1QX8A 2R3CA 3VP8A 1J1EC 2M3BA 1OVVA 4I1LA 3L73E 5CYTR 1IFIA 1CHJA 3HTKB 1FI9A 1LS9A 1QVFO 2XTSB 3RMZA 2E42A 1SS1A 4YTPC 1RZ5A 2CE1A 2OYOA 2FYUK 1N7LA 4IOIH 2LKMA 3L35A 5KLVD 3NWVA 1C2RA 1I54A 2N3BA 3OAKA 1KFNA 1VPCA 2IBZG 4JPZB 2ZYDA 4L3GA 1NU1G 3CD6P 1QN2A 1QEXA 3L70J 1EXIA 2O1JA 3U1AA 1DX7A 2Q9IA 4KMGA 1X0TA 1BDCA 5BU8B 2N9IA 3RBZA 3X39A 1FI7A 1BCCG 2IZ1A 1U57A 2R5DA 4UB6E 4Y28J 1JNMA 1CSBA 3B4SA 1GD2E 2QJYC 3SWYA 1S5LV 1IRVA 1FOCA 1BDDA 2XNXA 1ZRTD 1NAYA 2GA1A 3H1HG 4FA5A 1RE3C 1S9KD 3K5BA 3CP5A 4GEDB 1SQVG 5B66E 4N6JA 451CA 3RL0D 2VHDA 4IFDK 4M3LA 2FFDA 1PPJE 2YKQA 2GC4D 3CYTI 2KNCA 1WEJF 1CYCA 3Q1MA 4U3FE 3L71G 1SQPD 1MG2D 2IBZE 3SFDC 5KAFV 1SQXJ 2W6BA 1IFMA 1FJ0A 1LP1A 1K04A 4EDFA 3FXEA 2V07A 1H33A 1G2CA 3H1LD 1K05A 3AE7C 5AW7B 1IC2A 2IYOA 3HD7B 1BCCE 2AXCA 1KB9H 1LFMA 2ITAA 4XA4A 1ZOYC 5CCGD 5K5GB 1Q81Q 1N9CA 1CO6A 1YQ4C 1VF5B 1LTJC 3KYQA 3H1HE 1CZQA 1MZ4A 3MK7C 4WB4A 3OW2O 3A0HV 1DVVA 3MIWA 1SQBJ 3L75G 2I8DA 1ETPA 1RQUA 2YIUC 4KHXA 1CXAA 3L71E 2ZYAA 1YIJP 3CCUP 2N18C 1LT1A 4IL6X 2YO3A 4PV1D 4DZOA 3H6PA 3VRDA 4NPFX 1GTWA 1NHLA 1D7MA 1NTZJ 1NTME 2MKVA 4OGQB 5KLIC 2BCCJ 1NJIQ 2M3EA 1IZNB 2WSEJ 2QSIA 1N90A 3HD7D 4LC1A 3ZIYA 2N1TC 3CX5I 3RK2D 4H44C 3G71P 3Q3DA 4WY4A 1R5SA 1KYOW 1Q90D 5AW2B 3RK3B 3H1IG 1KN7A 1CTZA 5CICB 4FANA 3GF3A 3L72G 2I1JA 5APQA 3V2QA 3L74J 1VF5D 1SFCB 1LTIC 1MFTA 4H0LD 3WFCC 1IK9A 3CPWO 2Z5IA 1ZXGA 4JYCA 2JWDA 4N0KA 3B71A 1FOSE 2V4HA 1BE3E 2M8RA 4H13C 3P8MC 1HROA 3WU2V 4K3AA 2FYUE 2W83C 1FZFA 1EC5A 5CIEB 1IZL0 1JM0A 1HVVA 1SQXK 1H32B 3WUTA 3WFDC 2FXOA 1CRCA 4PJ0V 4L76A 1PIXA 3M0AA 4ZMDA 4HH2A 2B9BA 5KAFH 1OW6A 1ZMEC 1EDKA 1LT9A 4BXLA 1FZCC 4EYYQ 1P84H 4TT3H 3RK3D 3H1IE 4IL6H 3WMM0 3VNWA 2D2CB 2M5AB 1DW1A 1KYOD 3L73J 4ASVA 1N7SD 1W5CT 3WUVA 2PGDA 2OARA 1YTCA 1RF1A 1EZVD 3USSA 1KB9E 1FC2C 1J1DC 4GOFA 2YQBA 3RGUA 1SQBK 3CU4A 3U1CA 1QGKB 4L3HA 1GW3A 2XKMA 2GM4A 2N1TA 3A0HH 2KZJA 3OA8B 5TISV 1KILB 1RF0C 1YTZT 1CIHA 5APWA 3FX0A 1KX2A 1IQCA 3TK1A 1CW5A 2A45I 3I55P 2B0ZB 1MKMA 1T3JA 1Q7YQ 1BSHA 2ZYGA 2QM7A 3VMAA 4FB1A 5CIGB 3GG2A 2D2CD 1X22A 2B11B 4P4QB 1KB0A 3LIEA 3IN6A 2NPSB 2B87B 1AOFA 5B5EH 3SJLA 4PD4I 1YIQA 5APSA 3DP5A 1KX7A 1VQLP 1NKZB 1H8AA 5E79V 3BASA 3WU2H 1S5LE 2CK3H 5EXQA 1OWAA 1N2DC 2C1VA 3CMEP 4DCKA 4A7PA 5B6QA 1IK7A 3SLEA 1FZGA 1GQ1A 2CPBA 1IFPA 2XZRA 3B5NA 3E1IA 3CC7P 2EXVA 4PJ0H 1COTA 2LR2A 3V6IA 5KLVG 2D0SA 1KIBA 3H1KD 3OCDB 2XU6A 1C6SA 1I8OA 1BCCJ 1JUNA 1CNOA 5KAFE 2B10B 3I5CA 2WPVB 2OYHB 2BCNB 1P84E 3BCCD 3MUDC 2OYIB 1CRHA 1GJQA 1VQ9P 1CI6B 3H1HJ 1DW3A 4RJTA 1SQVJ 1URQB 2RMZA 3TYYA 2YMKA 3CCLP 2V08A 2IPPA 4ZNCA 4W7YA 4FAVA 1JTHB 2W90A 1SQXE 5DJQB 1Y9BA 2Y0CA 3L71J 3CCRP 3FWNA 2Y9ZA 5TISH 1JY3O 2WT7B 1QVGO 4H0KA 4JF7A 2PCCB 2LXBA 2E74B 1JY2O 3A0HE 2YK3A 5KLVE 3KHUA 1FZEA 3EFGA 1FHBA 3HD7C 4QMAA 2YKOA 3MD0A 3NTNA 1SQPG 1AQTA 1I6DA 1M1JB 3S4RA 2RN0A 3VTPC 2W6AA 4AAOA 1AYGA 1VF5C 2KUBA 4LJIA 2K1AA 1CSUA 1RAQA 3H1LG 2WQYC 4C7NB 3AE8C 2W6JH 1URQD 2OTLP 2HYNA 5AVYB 2FYNB 1CHIA 3CXHW 3CWBD 1VQPP 1KQLA 2FYUJ 1Q2NA 3L75J 1FI3A 1KORA 3WC8A 1GDVA 1NU1K 5E79H 3PH0A 4PWAA 1L0LD 5CCGA 2A06E 2E74D 2HLOA 2ZAEB 3JCUE 4OGQC 3WU2E 1MV8A 4UB8H 4H44D 1OFCX 3ZDMA 5AVQB 2JO1A 5APTA 1CRJA 3OA7A 1FZAA 5C0ZA 1I8PA 3RK3C 1SQPE 3H1IJ 4GIFA 3L74E 1GU2A 3M0DA 1SFCC 3L72J 4PJ0E 2K9YA 4D6TD 1NIRA 3H1LE 1VQ5P 1SQVK 1KYOH 4WVZA 1E2RA 4H13D 2IZ0A 3G6EP 4GKGA 1USEA 3TNUA 5AVSB 5AVXB 1SQQD 3HD7A 1M60A 1YCCA 3CXHD 4EIFA 2JDIH 1OVRA 1PP9D 2JJLA 1H88A 2ZXYA 4IFMA 1DW0A 4JBZA 1EB7A 2Y9YA 1GK6A 4HB1A 1OZHA 2YMYA 1Q86Q 1H9YA 1K3HA 2LXCB 2J58A 3G3ZA 1KMIZ 1CSWA 3D0WA 1QKSA 5TISE 1YEAA 2D2CC 5BU5A 4EIDA 1DD3A 5C9MA 1GMJA 3D71A 1HRCA 1TU3F 1C6OA 3PXTA 4Q5PA 1X9VA 3AE4C 2KK7A 3AE9C 1A8CA 3E1RA 1HTLC 5AVVB 1YBKA 3MGNA 4IFFA 4WQ7A 1JOCA 3CL3D 1C7MA 2LITA 4W7ZA 1KILC 1EZVG 1S3JA 1G1JA 2KS1B 3V4QA 1N7SA 2C9NY 1HWTC 4RKUJ 1ZR2A 2RKLA 2AXTV 3AEAC 3TGUD 1AV1A 2B88A 5E79E 2BGVX 3RL0g 1OXZA 3O6QB 1Q82Q 3GMAA 3WUIA 5APVA 2I8FA 1H32A 2NPSC 3FWLA 3CCEP 3AE6C 2XV5A 2D0WA 1EXJA 2P67A 3A7OA 3A0BH 1LC2A 2ZZS1 3KZIV 1IFNA 2ZBOA 1KYOE 4OH8B 1OX3A 3CMAP 1W2BO 1LWUB 1NTZD 2HR3A 1XTCC 1EZVE 1NU1E 2M5AA 2L91A 3EQ2A 1CCHA 2ZVNB 2E5YA 1L4AB 1AVYA 1FAVA 4IL6V 4N78E 1JY3P 1WVEC 3Q5PA 1QYZA 5CBOA 4GYDA 2YO2A 3MZWB 1R0QA 5KLVJ 3Q2YA 2QIWA 1HBWA 5EFWB 2MTAC 2K9JA 3CX5D 4AYCA 1DT1A 2OYHC 1FOSF 1QL2A 2Y0EA 2B89A 2OYIC 1CORA 1SQVE 2QA4P 1OAEA 3CCVP 3TSIA 2HFED 2FRCA 4EIJA 4WQ9A 1URQC 1SP4A 3H1KG 2BPBB 2QG4A 3KQGA 2QJPB 4DT0A 3KPEA 1E8EA 4BRYA 2ZOOA 1HJ3A 2JQRA 1ZN5A 2Y0DA 2P7JA 2OZ1B 5DJQC 3BCCG 5C39A 1HH0A 1OMIA 3C2CA 3L36A 1KC8Q 1M7LA 1L0ND 2GB8B 1M56D 3SSUA 2R32A 2E74C 1RE3A 1OW7A 3HE5B 3F89A 1UIXA 1CSVA 1E5WA 4WQBA 3JSVC 1U7JA 5IY51 3M9QA 3KXDA 1M1JC 3VMXA 3L73D 5CJ0A 1I5TA 1SQPJ 1NNOA 5KJ7C 1A2SA 2AXTH 155CA 5APXA 5B5EV 3CC2P 2C9XB 2VRSA 3SWFA 3S9OA 2JEEA 2C1DB 3H1LJ 3O8ZA 3HE4A 1YNRA 2K88A 3H1KE 2FYNC 4YXDC 2MHMA 4I2LC 1LTSC 1YJ9P 3L75E 1CRGA 1KD1Q 1T2KD 1K9MQ 2OTKE 1CRYA 3SWKA 5GTIV 3KZIH 3T97B 5TJHA 4GT1A 5CMZA 2KSJA 3CXHH 2BH4X 3R4YA 2C8SA 2PACA 1LTJA 4OGQD 2Q3IA 3CWBG 5KLVK 4K3IA 1URQA 2AEJA 4YPCA 3L72E 2FFDB 1SFCD 2AEFA 5AW3B 1L0LG 2KNCB 1C2NA 1J3SA 1GIWA 3JBTB 1YITP 1PPJD 4L75A 1CTJA 5AVZB 2BLFB 2WT7A 3G9RA 1LP1B 1H1OA 2W8ZA 2XDJA 4U3FD 1NAFA 3AE3C 1H33B 4PD4D 1E29A 1QL3A 3GLMA 4D6TG 4HJGH 2HPCB 3U59A 1GKSA 1CYIA 4O9BA 2K37A 2R5BA 3ORVA 5KAIV 3CWBE 4EI2A 1N8RQ 2UWJE 3S1KA 1SQQG 1SQPK 2H43A 2ZONG 1VQNP 1S72P 1PP9G 1RHZB 3BATA 2Q5UA 1PL5A 2E75C 1L0LE 2ZT9B 3IF4A 3HQ9A 1X79B 1PGQA 1K8AQ 1JCCA 4AQRD 1ZZHA 2QM8A 1KYOI 1T6AA 2P58A 3GHGB 2IBZI 2AXTE 2RH0A 2V7QH 2WPQA 3E7KA 1EZVI 1FZCA 1FE6A 3H1JD 1NWQA 3Q5SA 3CCSP 1KILD 2HODA 1BGYD 4WY4B 2AIUA 1NTMD 3PH2B 5H2FV 5GTIH 1R5LA 2L4DA 2ORLA 4UB8V 4KJMA 5AW9B 1NU1J 4I7ZB 1LTGC 1FDOA 3AEDC 3EWKA 3CLQA 1CEDA 5APYA 4NFGB 2GUVA 3KZIE 2Z5HA 3MP7B 1SQQE 3HUSB 3CXHE 1ZW0A 1LTBC 2WSFH 1W5CE 1WRGA 2W27A 3AEEC 2C0XA 1LMSA 2NPSD 1L0NK 3N4XA 1GDTA 1YFCA 5KKZB 3CX5H 1OW8A 2OQQA 1RF0A 3V2PA 1BE3D 4IL6E 2FYUD 2GIWA 3TGUG 1G1IA 2PFXA 3M9HA 2FWLA 3HQ8A 1OVUA 1LT9B 1LWUC 2MJZA 3C8VA 2FXPA 5AVWB 3HTKA 2KXPB 2JKVA 3SFEC 1FZBA 3TYIA 1L4AC 1GU4A 1HJ0A 4O1WA 2H89C 3NBSA 1AKKA 1RE4C 4NPEA 4B86A 2N9BA 5KAIH 2WMMA 4I6MC 1NO4A 2E76B 1RF1B 1VYDA 4DJGA 2WVRA 1NTZG 3WFEC 1VQ8P 1YYCA 5AW5B 4Z1MH 2WPSA 1KTMA 5APUA 1W2LA 1J2JB 1NTKD 2C1UA 5AURA 2WITA 3SWSA 3ZOXA 5CHXA 1N50A 2KS1A 3TGUE 2QJPC 3H1KJ 3AEGC 2BEQD 1RH5B 1MG3D 1VQMP 1T2KC 5CIBB 3BRTB 2G3AA 5B5EE 1FJPA 1ZRTE 1FBMA 1S9KE 1PZQA 3BCCJ 2C0WA 3DMIA 1M90Q 4AANA 1NH4A 2O1KA 3MUDA 3OJAB 3N7NA 5H2FH 1HCMA 5AW1B 1EDJA 3TDKA 2DW3A 2KLVA 1JMMA 4L1QA 2E76D 2IDBA 5GTIE 5KJ7D 1KB9I 4WQEA 3KDPB 2K3RA 2KI7B 3D70A 4WQAA 5AW0B 1NYHA 3CC4P 1L0NG 1JCDA 3VMYA 1CRIA 3VOPA 3A0BV 3ZOOA 1OCDA 1DD4A 1EDIA 4ASWA 1UIIA 1Z56A 3AE5C 1W2EA 3V2NA 3WFBC 3RBXA 1NKNA 1KV4A 4AAMA 1LNQA 3B5NB 1LTAC 1N15A 3O20A 2Q3EA 3L70D 4EICA 4C7RA 4PD4H 2FKWB 2H7HA 4LGDE 3C9IA 4RO0A 4AX3A 1LGHB 1Y47A 4XE5B 1YICA 1NVOA 1ZR4A 3H32B 1H31B 3CWBJ 4CPGA 4WQ8A 2XNDH 1SLQA 1M57D 2YXQB 1RAPA 3VN0A 1S1CX 2WSSH 2E75B 2FFDC 1HZUA 3HQ7A 4QAOA 4YE1A 3L4FA 1L0NE 1L0LJ 5KAIE 1YI2P 2WSCH 3CCQP 3CCMP 1U75B 4WQCA 2A45G 4U7JA 3HRNA 4FA1A 1N73B 4V2KA 1GL2B 3HE5A 4EIEA 1SQXD 1Y8AA 3B5ND 2ZVOB 1L2PA 2KP8A 1A02J 1VQ7P 1M8OB 3TF5A 1NMLA 3W67A 4D6TJ 1I55A 3RL0B 1PPJG 1SFCA 3CXHI 3O1YA 2JTIB 2C1DA 2B12B 1CC5A 3CX5W 4U3FG 1P84I 2AI5A 3M91A 2J5UA 3O0RC 2QE7H 3NFQA 1SQQJ 1F1FA 1PP9J 2E75D 4JYBA 1YEBA 5H2FE 4UB8E 2ZT9C 2GUSA 1HH7A 1GW4A 3ABVC 3T97A 1YJWP 3II6A 1YTZI 5AW6B 2QJKB 1SQBD 351CA 3RK3E 3LW5J 3GHGC 4OVNF 1GL2D 2IYPA 2ZFCA 1RY3A 3PXSA 1QL4A 4HKZH 4N3YB 2Z4EA 1F1CA 4WQDA 1NTKK 1M6ZA 3PXWA 2IFMA 1C52A 4FA9A 5AVTB 3RN1A 1IO4A 1JY3N 4WY4C 3P32A 3AE1C 2A06D 1KZUB 2BCCD 2KSEA 3JC22 1B7VA 1JY2N 1GU5A 4I7ZC 1DVHA 4L74A 1AFOA 2H88C 2O01H 2WTYA 2CXBA 3A5TA 4PD4E 1XTGB 4MU8A 3H1JG 2R44A 1JY2P 3HUSC 3L74D 4PV1B 1S6VB 2BEZF 4NPDA 3F5HA 1BGYG 4DY9A 2C2CA 1NTMG 1YHQP 1L0LK 1IJDB 3OA8A 5KKZC 3W68A 1KILA 3TNUB 1S5LX 1FDMA 1DEBA 1AOQA 2HPCA 4FA4A 4TLFA 1H0TB 3RK2B 1U74B 4R4LA 2BH5X 2DGEA 2KB7P 2YKPA 2G8YA 2KYVA 3TGUJ 3AEBC 2H8PD 5AVUB 3EFFK 5CCHD 4H0LB 3M97X 1LT9C 3GW6A 3NXSA 3D6YA 1AJYA 1HZVA 1BE3G 3V5BA 2Q1KA 2JWAA 2V7QJ 2FYUG 2YXRB 1L4AD 2NPSA 2B87A 3P8CD 1EDLA 1HF9A 2P10A 2FY8A 5CJ4A 1SQQK 2FXMA 3H1JE 3QWOC 3GHGA 3FXDA 2E76C 4BWNA 1RF1C 1KILE 1HGZA 4W80A 3I56P 1BGYE 3PHLA 3BVHA 1CIGA 1KV9A 1FJKA 5CIDB 2P2UA 3Q5RA 2WSFJ 1JB0J 1AQ5A 1PFIA 1LJ2A 1MUUA 1IO3A 1N7SB 2QEXP 3OCDA 1VQ4P 3HUSA 1NTKG 3BCCE 1AA0A 1OIPA 1S5LH 3A0BE 1GZLA 2OYHA 1PGPA 3M9BA 5GTHV 2OYIA 3LIDA 1HJBA 2SPZA 2N9YB 1CI6A 1VQOP 4Y99B 3NMDA 5DJTB 3A9FA 1NMIA 5BVZA 4YXWH 1KQFB 4GDOA 1YQ3C 3LW5H 4H0JA 1QL1A 1VL2A 4RSZA 2PRRA 1JTHA 3AE2C 2Q6QA 3R2PA 1L0NJ 2CE0A 1K3GA 1J1EB 1A02F 3ITKA 1MFZA 2ZXEB 4K35A 1CHHA 5KTBA 4XFJA 1VDFA 1JEKA 2J59M 1G2CB 2ZXXA 2IBZD 3B5NC 1RZ6A 1NTKE 5DJUB 3L37A 1M1JA 1NU1D 3A2AA 1DW2A 5KJ7A 2JP3A 1CSXA 1FU1A 1MZ9A 1WMKA 3IFMA 4OWFA 1DIQC 5CIHB 2K9JB 1FS0E 4N78D 5L8RJ 4C7NA 1KQSO
chains in the Genus database with same CATH topology
1HRCA 1BCCD 3A0HV 1DVVA 1C6OA 3PXTA 4Q5PA 1W2LA 1ETPA 2CA3B 1NTKD 1BL9A 1A8CA 1CXAA 2C1UA 5AURA 2N18C 3SWSA 3H1HD 4WQ7A 3ZOXA 4AALA 3PRJA 3VRDA 1N50A 1SQVD 2KS1A 1C7MA 2LITA 3SXTA 1MG3D 1LC1A 4O1QA 5CIBB 3ZOYA 1N90A 3DR0A 3ZIYA 1KYOW 2QJYB 3L71D 1CTZA 5CICB 1CTYA 3DMIA 4FANA 2AXTV 4AANA 4J20A 3TGUD 2BGVX 3WFCC 1HCMA 3TDKA 1JDLA 3WUIA 1IRWA 4L1QA 4N0KA 2I8FA 1H32A 3FWLA 2B4ZA 4WQEA 1HROA 4UB6V 3WU2V 2D0WA 4WQAA 5CIEB 3RN0A 1IZL0 1CRIA 1H32B 1HJ4A 3A0BV 3ZOOA 1LC2A 1OCDA 1CCRA 2ZZS1 3KZIV 3SVWA 3WFDC 5B66V 1CRCA 2ZBOA 4PJ0V 5DFSA 3WFBC 1I6EA 1NTZD 2PCBB 1L9BC 4AAMA 2L91A 3L75D 1N15A 3O20A 2Q3EA 3L70D 4EICA 1CCHA 1CIFA 1H31A 4IL6V 3VNWA 1WVEC 1QYZA 4GYDA 1DW1A 4AX3A 1R0QA 1A56A 1KYOD 1YICA 3MK7B 1W5CT 2MTAC 1H31B 1YTCA 3CX5D 1EZVD 4WQ8A 3NBTA 1DT1A 2YIUB 3ZBMA 2Y0EA 2YQBA 1RAPA 3H1ID 3CU4A 3HQ6A 1CORA 2N18B 1OAEA 5DF5A 1HZUA 2FRCA 3HQ7A 4L3HA 4QAOA 4WQ9A 4YE1A 3L4MA 3L72D 2BPBB 2QG4A 4PW9B 2QJPB 3OA8B 5TISV 1U75B 1CIHA 1E8EA 2ZOOA 1HJ3A 2JQRA 4WQCA 5KLIB 5CIFB 1C75A 1KB9D 2CA4B 2Y0DA 2OZ1B 1KX2A 5DJQC 4FA1A 1IQCA 4V2KA 4EIEA 4Y5RA 1SQXD 2B0ZB 3VYMA 1M70A 3C2CA 1L0ND 2GB8B 3TF5A 1NMLA 3VMAA 1I55A 4FB1A 5CIGB 3GG2A 2N3YA 2HV4A 3O1YA 2B11B 1CSVA 4P4QB 4WQBA 4XYDB 2JTIB 1KB0A 2C1DA 5IY51 3L73D 1I5TA 2B12B 1NNOA 1CC5A 1CYJA 3CX5W 1AOFA 1A2SA 155CA 2N9JA 2AI5A 5B5EV 3O0RC 2C9XB 3SJLA 1YIQA 1F1FA 2C1DB 2YCCA 3DP5A 1KX7A 1YNRA 1YEBA 5E79V 3L4OA 1DIIC 1HH7A 2MHMA 2LIRA 1CRGA 4JCGA 2QJKB 5EXQA 1SQBD 351CA 2C1VA 1CRYA 5GTIV 4A7PA 5B6QA 3SLEA 2DVHA 1GQ1A 3RLMA 1CXCA 5TJHA 3PXSA 1QL4A 1F1CA 2EXVA 3PTZA 1COTA 4WQDA 2BH4X 1M6ZA 2D0SA 3PXWA 1C6RA 1KIBA 4XXLA 3H1KD 2C8SA 3OCDB 1C52A 2PACA 4FA9A 3RN1A 1C6SA 1CIEA 1I8OA 2A06D 2BCCD 1CNOA 1B7VA 2B10B 4K3IA 1DVHA 2BCNB 3BCCD 3PLNA 2CXBA 1CRHA 1GJQA 3O5CA 4MU8A 1DW3A 4RJTA 3L74D 2KNCB 1C2NA 1J3SA 1GIWA 1S6VB 2RMZA 2GC7D 1FCDC 3JBTB 3ZCFA 4DY9A 2C2CA 2V08A 1PPJD 3ZOWA 1CTJA 2BLFB 3OA8A 2O3JA 4FAVA 5DJQB 1H1OA 1H9XA 1P84D 1AOQA 2Y0CA 4FA4A 1L9JC 1U74B 4U3FD 2BH5X 2OZ1A 1H33B 4PD4D 2DGEA 1E29A 1HJ5A 1QL3A 4H0KA 2PCCB 1GKSA 1CYIA 2YK3A 3M97X 3ORVA 3KHUA 1FHBA 3GW6A 5KAIV 5CYTR 1CHJA 1I6DA 1FI9A 1LS9A 2XTSB 1HZVA 3RMZA 2RN0A 2JWAA 4AAOA 1RZ5A 2CE1A 2ZONG 1AYGA 4LJIA 1CSUA 1RAQA 5KLVD 3NWVA 2FYNB 1C2RA 1I54A 2N3BA 1CHIA 3HQ9A 3CXHW 3CWBD 3PHLA 1ZZHA 4L3GA 1FI3A 1QN2A 1CIGA 1KV9A 3WC8A 1GDVA 5CIDB 4KMGA 3H1JD 4PWAA 1L0LD 2N9IA 3X39A 1FI7A 1BGYD 2AIUA 1NTMD 3PH2B 1IO3A 5H2FV 2L4DA 2ORLA 3OCDA 4UB8V 1CRJA 5C0ZA 1I8PA 1S5LV 1IRVA 1FOCA 1ZRTD 1CEDA 4FA5A 4NFGB 1GU2A 3CP5A 4GEDB 5GTHV 451CA 2VHDA 2N9YB 4D6TD 1NIRA 2GC4D 3CYTI 3A9FA 1NMIA 1WEJF 1LMSA 1E2RA 1CYCA 4H0JA 1YFCA 5KKZB 1SQPD 4RSZA 1MG2D 5KAFV 1BE3D 1FJ0A 4EDFA 2FYUD 1SQQD 2GIWA 2V07A 1M60A 1YCCA 3CXHD 4EIFA 2CE0A 1H33A 1PP9D 3H1LD 1K3GA 2ZXYA 3ITKA 1DW0A 2FWLA 3HQ8A 1EB7A 1CHHA 1LFMA 2IBZD 1H9YA 1K3HA 1RZ6A 1N9CA 1CO6A 1NU1D 1CSWA 1DW2A 3TYIA 4O1WA 1QKSA 3NBSA 1CSXA 1AKKA 1YEAA 1MZ4A 1DIQC 5CIHB 2K9JB 1VYDA 3MK7C 4EIDA 5C9MA 3WFEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HRC A;  1BCC D;  3A0H V;  1DVV A;  1C6O A;  3PXT A;  4Q5P A;  1W2L A;  1ETP A;  2CA3 B;  1NTK D;  1BL9 A;  1A8C A;  1CXA A;  2C1U A;  5AUR A;  2N18 C;  3SWS A;  3H1H D;  4WQ7 A;  3ZOX A;  4AAL A;  3PRJ A;  3VRD A;  1N50 A;  1SQV D;  2KS1 A;  1C7M A;  2LIT A;  3SXT A;  1MG3 D;  1LC1 A;  4O1Q A;  5CIB B;  3ZOY A;  1N90 A;  3DR0 A;  3ZIY A;  1KYO W;  2QJY B;  3L71 D;  1CTZ A;  5CIC B;  1CTY A;  3DMI A;  4FAN A;  2AXT V;  4AAN A;  4J20 A;  3TGU D;  2BGV X;  3WFC C;  1HCM A;  3TDK A;  1JDL A;  3WUI A;  1IRW A;  4L1Q A;  4N0K A;  2I8F A;  1H32 A;  3FWL A;  2B4Z A;  4WQE A;  1HRO A;  4UB6 V;  3WU2 V;  2D0W A;  4WQA A;  5CIE B;  3RN0 A;  1IZL 0;  1CRI A;  1H32 B;  1HJ4 A;  3A0B V;  3ZOO A;  1LC2 A;  1OCD A;  1CCR A;  2ZZS 1;  3KZI V;  3SVW A;  3WFD C;  5B66 V;  1CRC A;  2ZBO A;  4PJ0 V;  5DFS A;  3WFB C;  1I6E A;  1NTZ D;  2PCB B;  1L9B C;  4AAM A;  2L91 A;  3L75 D;  1N15 A;  3O20 A;  2Q3E A;  3L70 D;  4EIC A;  1CCH A;  1CIF A;  1H31 A;  4IL6 V;  3VNW A;  1WVE C;  1QYZ A;  4GYD A;  1DW1 A;  4AX3 A;  1R0Q A;  1A56 A;  1KYO D;  1YIC A;  3MK7 B;  1W5C T;  2MTA C;  1H31 B;  1YTC A;  3CX5 D;  1EZV D;  4WQ8 A;  3NBT A;  1DT1 A;  2YIU B;  3ZBM A;  2Y0E A;  2YQB A;  1RAP A;  3H1I D;  3CU4 A;  3HQ6 A;  1COR A;  2N18 B;  1OAE A;  5DF5 A;  1HZU A;  2FRC A;  3HQ7 A;  4L3H A;  4QAO A;  4WQ9 A;  4YE1 A;  3L4M A;  3L72 D;  2BPB B;  2QG4 A;  4PW9 B;  2QJP B;  3OA8 B;  5TIS V;  1U75 B;  1CIH A;  1E8E A;  2ZOO A;  1HJ3 A;  2JQR A;  4WQC A;  5KLI B;  5CIF B;  1C75 A;  1KB9 D;  2CA4 B;  2Y0D A;  2OZ1 B;  1KX2 A;  5DJQ C;  4FA1 A;  1IQC A;  4V2K A;  4EIE A;  4Y5R A;  1SQX D;  2B0Z B;  3VYM A;  1M70 A;  3C2C A;  1L0N D;  2GB8 B;  3TF5 A;  1NML A;  3VMA A;  1I55 A;  4FB1 A;  5CIG B;  3GG2 A;  2N3Y A;  2HV4 A;  3O1Y A;  2B11 B;  1CSV A;  4P4Q B;  4WQB A;  4XYD B;  2JTI B;  1KB0 A;  2C1D A;  5IY5 1;  3L73 D;  1I5T A;  2B12 B;  1NNO A;  1CC5 A;  1CYJ A;  3CX5 W;  1AOF A;  1A2S A;  155C A;  2N9J A;  2AI5 A;  5B5E V;  3O0R C;  2C9X B;  3SJL A;  1YIQ A;  1F1F A;  2C1D B;  2YCC A;  3DP5 A;  1KX7 A;  1YNR A;  1YEB A;  5E79 V;  3L4O A;  1DII C;  1HH7 A;  2MHM A;  2LIR A;  1CRG A;  4JCG A;  2QJK B;  5EXQ A;  1SQB D;  351C A;  2C1V A;  1CRY A;  5GTI V;  4A7P A;  5B6Q A;  3SLE A;  2DVH A;  1GQ1 A;  3RLM A;  1CXC A;  5TJH A;  3PXS A;  1QL4 A;  1F1C A;  2EXV A;  3PTZ A;  1COT A;  4WQD A;  2BH4 X;  1M6Z A;  2D0S A;  3PXW A;  1C6R A;  1KIB A;  4XXL A;  3H1K D;  2C8S A;  3OCD B;  1C52 A;  2PAC A;  4FA9 A;  3RN1 A;  1C6S A;  1CIE A;  1I8O A;  2A06 D;  2BCC D;  1CNO A;  1B7V A;  2B10 B;  4K3I A;  1DVH A;  2BCN B;  3BCC D;  3PLN A;  2CXB A;  1CRH A;  1GJQ A;  3O5C A;  4MU8 A;  1DW3 A;  4RJT A;  3L74 D;  2KNC B;  1C2N A;  1J3S A;  1GIW A;  1S6V B;  2RMZ A;  2GC7 D;  1FCD C;  3JBT B;  3ZCF A;  4DY9 A;  2C2C A;  2V08 A;  1PPJ D;  3ZOW A;  1CTJ A;  2BLF B;  3OA8 A;  2O3J A;  4FAV A;  5DJQ B;  1H1O A;  1H9X A;  1P84 D;  1AOQ A;  2Y0C A;  4FA4 A;  1L9J C;  1U74 B;  4U3F D;  2BH5 X;  2OZ1 A;  1H33 B;  4PD4 D;  2DGE A;  1E29 A;  1HJ5 A;  1QL3 A;  4H0K A;  2PCC B;  1GKS A;  1CYI A;  2YK3 A;  3M97 X;  3ORV A;  3KHU A;  1FHB A;  3GW6 A;  5KAI V;  5CYT R;  1CHJ A;  1I6D A;  1FI9 A;  1LS9 A;  2XTS B;  1HZV A;  3RMZ A;  2RN0 A;  2JWA A;  4AAO A;  1RZ5 A;  2CE1 A;  2ZON G;  1AYG A;  4LJI A;  1CSU A;  1RAQ A;  5KLV D;  3NWV A;  2FYN B;  1C2R A;  1I54 A;  2N3B A;  1CHI A;  3HQ9 A;  3CXH W;  3CWB D;  3PHL A;  1ZZH A;  4L3G A;  1FI3 A;  1QN2 A;  1CIG A;  1KV9 A;  3WC8 A;  1GDV A;  5CID B;  4KMG A;  3H1J D;  4PWA A;  1L0L D;  2N9I A;  3X39 A;  1FI7 A;  1BGY D;  2AIU A;  1NTM D;  3PH2 B;  1IO3 A;  5H2F V;  2L4D A;  2ORL A;  3OCD A;  4UB8 V;  1CRJ A;  5C0Z A;  1I8P A;  1S5L V;  1IRV A;  1FOC A;  1ZRT D;  1CED A;  4FA5 A;  4NFG B;  1GU2 A;  3CP5 A;  4GED B;  5GTH V;  451C A;  2VHD A;  2N9Y B;  4D6T D;  1NIR A;  2GC4 D;  3CYT I;  3A9F A;  1NMI A;  1WEJ F;  1LMS A;  1E2R A;  1CYC A;  4H0J A;  1YFC A;  5KKZ B;  1SQP D;  4RSZ A;  1MG2 D;  5KAF V;  1BE3 D;  1FJ0 A;  4EDF A;  2FYU D;  1SQQ D;  2GIW A;  2V07 A;  1M60 A;  1YCC A;  3CXH D;  4EIF A;  2CE0 A;  1H33 A;  1PP9 D;  3H1L D;  1K3G A;  2ZXY A;  3ITK A;  1DW0 A;  2FWL A;  3HQ8 A;  1EB7 A;  1CHH A;  1LFM A;  2IBZ D;  1H9Y A;  1K3H A;  1RZ6 A;  1N9C A;  1CO6 A;  1NU1 D;  1CSW A;  1DW2 A;  3TYI A;  4O1W A;  1QKS A;  3NBS A;  1CSX A;  1AKK A;  1YEA A;  1MZ4 A;  1DIQ C;  5CIH B;  2K9J B;  1VYD A;  3MK7 C;  4EID A;  5C9M A;  3WFE C; 
#chains in the Genus database with same CATH topology
 1BCC D;  5AVR B;  4MN4 C;  1H89 A;  1NTZ K;  1EQ7 A;  2CA3 B;  3L70 G;  1BL9 A;  1ZLL A;  1GK4 A;  3UIA A;  2OTJ P;  3H1H D;  4AAL A;  3PRJ A;  1SQV D;  1X8Y A;  2WZ7 A;  4BRY B;  1HGV A;  2BAS A;  3IAO A;  4LLH A;  3SXT A;  4GOD A;  2POH A;  4EOT A;  1LC1 A;  4O1Q A;  3ZOY A;  3DR0 A;  2CPS A;  1N73 C;  1GL2 C;  2QJY B;  2M0B A;  3L71 D;  1USD A;  1M1K Q;  1LTT C;  1CTY A;  3A3Y B;  4D6T E;  3GF7 A;  4J20 A;  3VP9 A;  1FDI A;  3RL0 C;  2YNY A;  2P1J A;  1JDL A;  1IRW A;  3H25 A;  3PP5 A;  3CCJ P;  4WWI A;  2WSE H;  2B4Z A;  3JCU H;  1BSN A;  4UB6 V;  1SQX G;  4U3F J;  5GTH H;  3L70 E;  1PP9 E;  3HE4 B;  3AEF C;  3RN0 A;  1HJ4 A;  1IFJ A;  3M06 A;  1CCR A;  3SVW A;  2ZT9 D;  5B66 V;  4AUW A;  5DFS A;  1I6E A;  2QJK C;  2PCB B;  1L9B C;  1PV3 A;  3L75 D;  2KZI A;  1T8Z A;  3H32 A;  1CIF A;  5CCG C;  1H31 A;  1LTJ B;  5CCH C;  3P7K A;  2ZJS E;  2WSC J;  1A56 A;  1IFD A;  4WY4 D;  2FYZ A;  1HUC A;  4C46 A;  3MK7 B;  4JQ0 D;  1T3U A;  1VQK P;  2AEM A;  1SQB G;  1DIP A;  3B8E B;  3NBT A;  3WUU A;  2YIU B;  1PGJ A;  3ZBM A;  4KT0 J;  3M0D C;  1DEE G;  1WT6 A;  3H1I D;  3HQ6 A;  1PGO A;  2N18 B;  5DF5 A;  3BRV B;  1SVF A;  2E5T A;  2IX7 C;  4PV1 C;  3L4M A;  3L72 D;  3H1J J;  1N73 A;  4PW9 B;  1GL2 A;  4L73 A;  1ZV8 A;  3CI9 A;  2A06 G;  1BGY J;  2BCC G;  2JR8 A;  1NTM J;  5KLI B;  5CIF B;  1C75 A;  1KB9 D;  2CA4 B;  2C9L Y;  2N1T B;  4H44 B;  3AEC C;  3RK2 C;  4Y5R A;  3VYM A;  2NZ2 A;  1M70 A;  1U7M A;  2QVA A;  2E43 A;  3L74 G;  3C1L A;  1E79 H;  1S4X A;  2IFN A;  4GOE A;  2KLU A;  3QH9 A;  2N3Y A;  4H0L C;  2HV4 A;  2I1K A;  4ZKP A;  2O01 N;  3O6Q A;  4XYD B;  3MHV A;  1S2E A;  4H13 B;  4WBA A;  1CYJ A;  1SQB E;  1AVO A;  1BE3 J;  2N9J A;  3V4W A;  3D6Z A;  3IR9 A;  2YCC A;  3VYI A;  2PAJ A;  1VQ6 P;  4DOJ A;  3PJS K;  1KQG B;  3MTU E;  2QRX A;  4HYT B;  1QLE D;  1NTZ E;  3VMZ A;  3L4O A;  1NGM B;  1DII C;  2A45 H;  4UB6 H;  1NOH A;  2LIR A;  4RES B;  5AW8 B;  2BCC E;  1K73 Q;  4JCG A;  5AW4 B;  5CCH A;  1ZP0 C;  3FGA D;  1LWU A;  2O01 J;  1FZC B;  2KIK A;  2N1T D;  5GTH E;  2DVH A;  3RLM A;  1CXC A;  1JMB A;  5CBN A;  2R3S A;  4R4M A;  5B66 H;  1RQV A;  3G4S P;  3PTZ A;  4ZKU A;  2HOD B;  1C6R A;  4XXL A;  1L4A A;  3L73 G;  2PP6 A;  2NRG A;  1RE4 A;  3CX5 E;  3V2R A;  1CIE A;  1N7S C;  2L5G B;  1N86 A;  1J1D B;  1NTK J;  1YJN P;  1JO5 A;  3PLN A;  3O5C A;  1KFM A;  2GC7 D;  2WWW A;  1FCD C;  2KOG A;  4Y99 C;  1H0T A;  3ZCF A;  3ZOW A;  2OGU A;  2HG5 D;  2O3J A;  1NTM K;  2Q7C A;  1H9X A;  1P84 D;  1L9J C;  1DH3 A;  2OZ1 A;  2FBW C;  3P8C E;  5M1B A;  1HJ5 A;  1R8E A;  2WPR A;  1QX8 A;  2R3C A;  3VP8 A;  1J1E C;  2M3B A;  1OVV A;  4I1L A;  3L73 E;  5CYT R;  1IFI A;  1CHJ A;  3HTK B;  1FI9 A;  1LS9 A;  1QVF O;  2XTS B;  3RMZ A;  2E42 A;  1SS1 A;  4YTP C;  1RZ5 A;  2CE1 A;  2OYO A;  2FYU K;  1N7L A;  4IOI H;  2LKM A;  3L35 A;  5KLV D;  3NWV A;  1C2R A;  1I54 A;  2N3B A;  3OAK A;  1KFN A;  1VPC A;  2IBZ G;  4JPZ B;  2ZYD A;  4L3G A;  1NU1 G;  3CD6 P;  1QN2 A;  1QEX A;  3L70 J;  1EXI A;  2O1J A;  3U1A A;  1DX7 A;  2Q9I A;  4KMG A;  1X0T A;  1BDC A;  5BU8 B;  2N9I A;  3RBZ A;  3X39 A;  1FI7 A;  1BCC G;  2IZ1 A;  1U57 A;  2R5D A;  4UB6 E;  4Y28 J;  1JNM A;  1CSB A;  3B4S A;  1GD2 E;  2QJY C;  3SWY A;  1S5L V;  1IRV A;  1FOC A;  1BDD A;  2XNX A;  1ZRT D;  1NAY A;  2GA1 A;  3H1H G;  4FA5 A;  1RE3 C;  1S9K D;  3K5B A;  3CP5 A;  4GED B;  1SQV G;  5B66 E;  4N6J A;  451C A;  3RL0 D;  2VHD A;  4IFD K;  4M3L A;  2FFD A;  1PPJ E;  2YKQ A;  2GC4 D;  3CYT I;  2KNC A;  1WEJ F;  1CYC A;  3Q1M A;  4U3F E;  3L71 G;  1SQP D;  1MG2 D;  2IBZ E;  3SFD C;  5KAF V;  1SQX J;  2W6B A;  1IFM A;  1FJ0 A;  1LP1 A;  1K04 A;  4EDF A;  3FXE A;  2V07 A;  1H33 A;  1G2C A;  3H1L D;  1K05 A;  3AE7 C;  5AW7 B;  1IC2 A;  2IYO A;  3HD7 B;  1BCC E;  2AXC A;  1KB9 H;  1LFM A;  2ITA A;  4XA4 A;  1ZOY C;  5CCG D;  5K5G B;  1Q81 Q;  1N9C A;  1CO6 A;  1YQ4 C;  1VF5 B;  1LTJ C;  3KYQ A;  3H1H E;  1CZQ A;  1MZ4 A;  3MK7 C;  4WB4 A;  3OW2 O;  3A0H V;  1DVV A;  3MIW A;  1SQB J;  3L75 G;  2I8D A;  1ETP A;  1RQU A;  2YIU C;  4KHX A;  1CXA A;  3L71 E;  2ZYA A;  1YIJ P;  3CCU P;  2N18 C;  1LT1 A;  4IL6 X;  2YO3 A;  4PV1 D;  4DZO A;  3H6P A;  3VRD A;  4NPF X;  1GTW A;  1NHL A;  1D7M A;  1NTZ J;  1NTM E;  2MKV A;  4OGQ B;  5KLI C;  2BCC J;  1NJI Q;  2M3E A;  1IZN B;  2WSE J;  2QSI A;  1N90 A;  3HD7 D;  4LC1 A;  3ZIY A;  2N1T C;  3CX5 I;  3RK2 D;  4H44 C;  3G71 P;  3Q3D A;  4WY4 A;  1R5S A;  1KYO W;  1Q90 D;  5AW2 B;  3RK3 B;  3H1I G;  1KN7 A;  1CTZ A;  5CIC B;  4FAN A;  3GF3 A;  3L72 G;  2I1J A;  5APQ A;  3V2Q A;  3L74 J;  1VF5 D;  1SFC B;  1LTI C;  1MFT A;  4H0L D;  3WFC C;  1IK9 A;  3CPW O;  2Z5I A;  1ZXG A;  4JYC A;  2JWD A;  4N0K A;  3B71 A;  1FOS E;  2V4H A;  1BE3 E;  2M8R A;  4H13 C;  3P8M C;  1HRO A;  3WU2 V;  4K3A A;  2FYU E;  2W83 C;  1FZF A;  1EC5 A;  5CIE B;  1IZL 0;  1JM0 A;  1HVV A;  1SQX K;  1H32 B;  3WUT A;  3WFD C;  2FXO A;  1CRC A;  4PJ0 V;  4L76 A;  1PIX A;  3M0A A;  4ZMD A;  4HH2 A;  2B9B A;  5KAF H;  1OW6 A;  1ZME C;  1EDK A;  1LT9 A;  4BXL A;  1FZC C;  4EYY Q;  1P84 H;  4TT3 H;  3RK3 D;  3H1I E;  4IL6 H;  3WMM 0;  3VNW A;  2D2C B;  2M5A B;  1DW1 A;  1KYO D;  3L73 J;  4ASV A;  1N7S D;  1W5C T;  3WUV A;  2PGD A;  2OAR A;  1YTC A;  1RF1 A;  1EZV D;  3USS A;  1KB9 E;  1FC2 C;  1J1D C;  4GOF A;  2YQB A;  3RGU A;  1SQB K;  3CU4 A;  3U1C A;  1QGK B;  4L3H A;  1GW3 A;  2XKM A;  2GM4 A;  2N1T A;  3A0H H;  2KZJ A;  3OA8 B;  5TIS V;  1KIL B;  1RF0 C;  1YTZ T;  1CIH A;  5APW A;  3FX0 A;  1KX2 A;  1IQC A;  3TK1 A;  1CW5 A;  2A45 I;  3I55 P;  2B0Z B;  1MKM A;  1T3J A;  1Q7Y Q;  1BSH A;  2ZYG A;  2QM7 A;  3VMA A;  4FB1 A;  5CIG B;  3GG2 A;  2D2C D;  1X22 A;  2B11 B;  4P4Q B;  1KB0 A;  3LIE A;  3IN6 A;  2NPS B;  2B87 B;  1AOF A;  5B5E H;  3SJL A;  4PD4 I;  1YIQ A;  5APS A;  3DP5 A;  1KX7 A;  1VQL P;  1NKZ B;  1H8A A;  5E79 V;  3BAS A;  3WU2 H;  1S5L E;  2CK3 H;  5EXQ A;  1OWA A;  1N2D C;  2C1V A;  3CME P;  4DCK A;  4A7P A;  5B6Q A;  1IK7 A;  3SLE A;  1FZG A;  1GQ1 A;  2CPB A;  1IFP A;  2XZR A;  3B5N A;  3E1I A;  3CC7 P;  2EXV A;  4PJ0 H;  1COT A;  2LR2 A;  3V6I A;  5KLV G;  2D0S A;  1KIB A;  3H1K D;  3OCD B;  2XU6 A;  1C6S A;  1I8O A;  1BCC J;  1JUN A;  1CNO A;  5KAF E;  2B10 B;  3I5C A;  2WPV B;  2OYH B;  2BCN B;  1P84 E;  3BCC D;  3MUD C;  2OYI B;  1CRH A;  1GJQ A;  1VQ9 P;  1CI6 B;  3H1H J;  1DW3 A;  4RJT A;  1SQV J;  1URQ B;  2RMZ A;  3TYY A;  2YMK A;  3CCL P;  2V08 A;  2IPP A;  4ZNC A;  4W7Y A;  4FAV A;  1JTH B;  2W90 A;  1SQX E;  5DJQ B;  1Y9B A;  2Y0C A;  3L71 J;  3CCR P;  3FWN A;  2Y9Z A;  5TIS H;  1JY3 O;  2WT7 B;  1QVG O;  4H0K A;  4JF7 A;  2PCC B;  2LXB A;  2E74 B;  1JY2 O;  3A0H E;  2YK3 A;  5KLV E;  3KHU A;  1FZE A;  3EFG A;  1FHB A;  3HD7 C;  4QMA A;  2YKO A;  3MD0 A;  3NTN A;  1SQP G;  1AQT A;  1I6D A;  1M1J B;  3S4R A;  2RN0 A;  3VTP C;  2W6A A;  4AAO A;  1AYG A;  1VF5 C;  2KUB A;  4LJI A;  2K1A A;  1CSU A;  1RAQ A;  3H1L G;  2WQY C;  4C7N B;  3AE8 C;  2W6J H;  1URQ D;  2OTL P;  2HYN A;  5AVY B;  2FYN B;  1CHI A;  3CXH W;  3CWB D;  1VQP P;  1KQL A;  2FYU J;  1Q2N A;  3L75 J;  1FI3 A;  1KOR A;  3WC8 A;  1GDV A;  1NU1 K;  5E79 H;  3PH0 A;  4PWA A;  1L0L D;  5CCG A;  2A06 E;  2E74 D;  2HLO A;  2ZAE B;  3JCU E;  4OGQ C;  3WU2 E;  1MV8 A;  4UB8 H;  4H44 D;  1OFC X;  3ZDM A;  5AVQ B;  2JO1 A;  5APT A;  1CRJ A;  3OA7 A;  1FZA A;  5C0Z A;  1I8P A;  3RK3 C;  1SQP E;  3H1I J;  4GIF A;  3L74 E;  1GU2 A;  3M0D A;  1SFC C;  3L72 J;  4PJ0 E;  2K9Y A;  4D6T D;  1NIR A;  3H1L E;  1VQ5 P;  1SQV K;  1KYO H;  4WVZ A;  1E2R A;  4H13 D;  2IZ0 A;  3G6E P;  4GKG A;  1USE A;  3TNU A;  5AVS B;  5AVX B;  1SQQ D;  3HD7 A;  1M60 A;  1YCC A;  3CXH D;  4EIF A;  2JDI H;  1OVR A;  1PP9 D;  2JJL A;  1H88 A;  2ZXY A;  4IFM A;  1DW0 A;  4JBZ A;  1EB7 A;  2Y9Y A;  1GK6 A;  4HB1 A;  1OZH A;  2YMY A;  1Q86 Q;  1H9Y A;  1K3H A;  2LXC B;  2J58 A;  3G3Z A;  1KMI Z;  1CSW A;  3D0W A;  1QKS A;  5TIS E;  1YEA A;  2D2C C;  5BU5 A;  4EID A;  1DD3 A;  5C9M A;  1GMJ A;  3D71 A;  1HRC A;  1TU3 F;  1C6O A;  3PXT A;  4Q5P A;  1X9V A;  3AE4 C;  2KK7 A;  3AE9 C;  1A8C A;  3E1R A;  1HTL C;  5AVV B;  1YBK A;  3MGN A;  4IFF A;  4WQ7 A;  1JOC A;  3CL3 D;  1C7M A;  2LIT A;  4W7Z A;  1KIL C;  1EZV G;  1S3J A;  1G1J A;  2KS1 B;  3V4Q A;  1N7S A;  2C9N Y;  1HWT C;  4RKU J;  1ZR2 A;  2RKL A;  2AXT V;  3AEA C;  3TGU D;  1AV1 A;  2B88 A;  5E79 E;  2BGV X;  3RL0 g;  1OXZ A;  3O6Q B;  1Q82 Q;  3GMA A;  3WUI A;  5APV A;  2I8F A;  1H32 A;  2NPS C;  3FWL A;  3CCE P;  3AE6 C;  2XV5 A;  2D0W A;  1EXJ A;  2P67 A;  3A7O A;  3A0B H;  1LC2 A;  2ZZS 1;  3KZI V;  1IFN A;  2ZBO A;  1KYO E;  4OH8 B;  1OX3 A;  3CMA P;  1W2B O;  1LWU B;  1NTZ D;  2HR3 A;  1XTC C;  1EZV E;  1NU1 E;  2M5A A;  2L91 A;  3EQ2 A;  1CCH A;  2ZVN B;  2E5Y A;  1L4A B;  1AVY A;  1FAV A;  4IL6 V;  4N78 E;  1JY3 P;  1WVE C;  3Q5P A;  1QYZ A;  5CBO A;  4GYD A;  2YO2 A;  3MZW B;  1R0Q A;  5KLV J;  3Q2Y A;  2QIW A;  1HBW A;  5EFW B;  2MTA C;  2K9J A;  3CX5 D;  4AYC A;  1DT1 A;  2OYH C;  1FOS F;  1QL2 A;  2Y0E A;  2B89 A;  2OYI C;  1COR A;  1SQV E;  2QA4 P;  1OAE A;  3CCV P;  3TSI A;  2HFE D;  2FRC A;  4EIJ A;  4WQ9 A;  1URQ C;  1SP4 A;  3H1K G;  2BPB B;  2QG4 A;  3KQG A;  2QJP B;  4DT0 A;  3KPE A;  1E8E A;  4BRY A;  2ZOO A;  1HJ3 A;  2JQR A;  1ZN5 A;  2Y0D A;  2P7J A;  2OZ1 B;  5DJQ C;  3BCC G;  5C39 A;  1HH0 A;  1OMI A;  3C2C A;  3L36 A;  1KC8 Q;  1M7L A;  1L0N D;  2GB8 B;  1M56 D;  3SSU A;  2R32 A;  2E74 C;  1RE3 A;  1OW7 A;  3HE5 B;  3F89 A;  1UIX A;  1CSV A;  1E5W A;  4WQB A;  3JSV C;  1U7J A;  5IY5 1;  3M9Q A;  3KXD A;  1M1J C;  3VMX A;  3L73 D;  5CJ0 A;  1I5T A;  1SQP J;  1NNO A;  5KJ7 C;  1A2S A;  2AXT H;  155C A;  5APX A;  5B5E V;  3CC2 P;  2C9X B;  2VRS A;  3SWF A;  3S9O A;  2JEE A;  2C1D B;  3H1L J;  3O8Z A;  3HE4 A;  1YNR A;  2K88 A;  3H1K E;  2FYN C;  4YXD C;  2MHM A;  4I2L C;  1LTS C;  1YJ9 P;  3L75 E;  1CRG A;  1KD1 Q;  1T2K D;  1K9M Q;  2OTK E;  1CRY A;  3SWK A;  5GTI V;  3KZI H;  3T97 B;  5TJH A;  4GT1 A;  5CMZ A;  2KSJ A;  3CXH H;  2BH4 X;  3R4Y A;  2C8S A;  2PAC A;  1LTJ A;  4OGQ D;  2Q3I A;  3CWB G;  5KLV K;  4K3I A;  1URQ A;  2AEJ A;  4YPC A;  3L72 E;  2FFD B;  1SFC D;  2AEF A;  5AW3 B;  1L0L G;  2KNC B;  1C2N A;  1J3S A;  1GIW A;  3JBT B;  1YIT P;  1PPJ D;  4L75 A;  1CTJ A;  5AVZ B;  2BLF B;  2WT7 A;  3G9R A;  1LP1 B;  1H1O A;  2W8Z A;  2XDJ A;  4U3F D;  1NAF A;  3AE3 C;  1H33 B;  4PD4 D;  1E29 A;  1QL3 A;  3GLM A;  4D6T G;  4HJG H;  2HPC B;  3U59 A;  1GKS A;  1CYI A;  4O9B A;  2K37 A;  2R5B A;  3ORV A;  5KAI V;  3CWB E;  4EI2 A;  1N8R Q;  2UWJ E;  3S1K A;  1SQQ G;  1SQP K;  2H43 A;  2ZON G;  1VQN P;  1S72 P;  1PP9 G;  1RHZ B;  3BAT A;  2Q5U A;  1PL5 A;  2E75 C;  1L0L E;  2ZT9 B;  3IF4 A;  3HQ9 A;  1X79 B;  1PGQ A;  1K8A Q;  1JCC A;  4AQR D;  1ZZH A;  2QM8 A;  1KYO I;  1T6A A;  2P58 A;  3GHG B;  2IBZ I;  2AXT E;  2RH0 A;  2V7Q H;  2WPQ A;  3E7K A;  1EZV I;  1FZC A;  1FE6 A;  3H1J D;  1NWQ A;  3Q5S A;  3CCS P;  1KIL D;  2HOD A;  1BGY D;  4WY4 B;  2AIU A;  1NTM D;  3PH2 B;  5H2F V;  5GTI H;  1R5L A;  2L4D A;  2ORL A;  4UB8 V;  4KJM A;  5AW9 B;  1NU1 J;  4I7Z B;  1LTG C;  1FDO A;  3AED C;  3EWK A;  3CLQ A;  1CED A;  5APY A;  4NFG B;  2GUV A;  3KZI E;  2Z5H A;  3MP7 B;  1SQQ E;  3HUS B;  3CXH E;  1ZW0 A;  1LTB C;  2WSF H;  1W5C E;  1WRG A;  2W27 A;  3AEE C;  2C0X A;  1LMS A;  2NPS D;  1L0N K;  3N4X A;  1GDT A;  1YFC A;  5KKZ B;  3CX5 H;  1OW8 A;  2OQQ A;  1RF0 A;  3V2P A;  1BE3 D;  4IL6 E;  2FYU D;  2GIW A;  3TGU G;  1G1I A;  2PFX A;  3M9H A;  2FWL A;  3HQ8 A;  1OVU A;  1LT9 B;  1LWU C;  2MJZ A;  3C8V A;  2FXP A;  5AVW B;  3HTK A;  2KXP B;  2JKV A;  3SFE C;  1FZB A;  3TYI A;  1L4A C;  1GU4 A;  1HJ0 A;  4O1W A;  2H89 C;  3NBS A;  1AKK A;  1RE4 C;  4NPE A;  4B86 A;  2N9B A;  5KAI H;  2WMM A;  4I6M C;  1NO4 A;  2E76 B;  1RF1 B;  1VYD A;  4DJG A;  2WVR A;  1NTZ G;  3WFE C;  1VQ8 P;  1YYC A;  5AW5 B;  4Z1M H;  2WPS A;  1KTM A;  5APU A;  1W2L A;  1J2J B;  1NTK D;  2C1U A;  5AUR A;  2WIT A;  3SWS A;  3ZOX A;  5CHX A;  1N50 A;  2KS1 A;  3TGU E;  2QJP C;  3H1K J;  3AEG C;  2BEQ D;  1RH5 B;  1MG3 D;  1VQM P;  1T2K C;  5CIB B;  3BRT B;  2G3A A;  5B5E E;  1FJP A;  1ZRT E;  1FBM A;  1S9K E;  1PZQ A;  3BCC J;  2C0W A;  3DMI A;  1M90 Q;  4AAN A;  1NH4 A;  2O1K A;  3MUD A;  3OJA B;  3N7N A;  5H2F H;  1HCM A;  5AW1 B;  1EDJ A;  3TDK A;  2DW3 A;  2KLV A;  1JMM A;  4L1Q A;  2E76 D;  2IDB A;  5GTI E;  5KJ7 D;  1KB9 I;  4WQE A;  3KDP B;  2K3R A;  2KI7 B;  3D70 A;  4WQA A;  5AW0 B;  1NYH A;  3CC4 P;  1L0N G;  1JCD A;  3VMY A;  1CRI A;  3VOP A;  3A0B V;  3ZOO A;  1OCD A;  1DD4 A;  1EDI A;  4ASW A;  1UII A;  1Z56 A;  3AE5 C;  1W2E A;  3V2N A;  3WFB C;  3RBX A;  1NKN A;  1KV4 A;  4AAM A;  1LNQ A;  3B5N B;  1LTA C;  1N15 A;  3O20 A;  2Q3E A;  3L70 D;  4EIC A;  4C7R A;  4PD4 H;  2FKW B;  2H7H A;  4LGD E;  3C9I A;  4RO0 A;  4AX3 A;  1LGH B;  1Y47 A;  4XE5 B;  1YIC A;  1NVO A;  1ZR4 A;  3H32 B;  1H31 B;  3CWB J;  4CPG A;  4WQ8 A;  2XND H;  1SLQ A;  1M57 D;  2YXQ B;  1RAP A;  3VN0 A;  1S1C X;  2WSS H;  2E75 B;  2FFD C;  1HZU A;  3HQ7 A;  4QAO A;  4YE1 A;  3L4F A;  1L0N E;  1L0L J;  5KAI E;  1YI2 P;  2WSC H;  3CCQ P;  3CCM P;  1U75 B;  4WQC A;  2A45 G;  4U7J A;  3HRN A;  4FA1 A;  1N73 B;  4V2K A;  1GL2 B;  3HE5 A;  4EIE A;  1SQX D;  1Y8A A;  3B5N D;  2ZVO B;  1L2P A;  2KP8 A;  1A02 J;  1VQ7 P;  1M8O B;  3TF5 A;  1NML A;  3W67 A;  4D6T J;  1I55 A;  3RL0 B;  1PPJ G;  1SFC A;  3CXH I;  3O1Y A;  2JTI B;  2C1D A;  2B12 B;  1CC5 A;  3CX5 W;  4U3F G;  1P84 I;  2AI5 A;  3M91 A;  2J5U A;  3O0R C;  2QE7 H;  3NFQ A;  1SQQ J;  1F1F A;  1PP9 J;  2E75 D;  4JYB A;  1YEB A;  5H2F E;  4UB8 E;  2ZT9 C;  2GUS A;  1HH7 A;  1GW4 A;  3ABV C;  3T97 A;  1YJW P;  3II6 A;  1YTZ I;  5AW6 B;  2QJK B;  1SQB D;  351C A;  3RK3 E;  3LW5 J;  3GHG C;  4OVN F;  1GL2 D;  2IYP A;  2ZFC A;  1RY3 A;  3PXS A;  1QL4 A;  4HKZ H;  4N3Y B;  2Z4E A;  1F1C A;  4WQD A;  1NTK K;  1M6Z A;  3PXW A;  2IFM A;  1C52 A;  4FA9 A;  5AVT B;  3RN1 A;  1IO4 A;  1JY3 N;  4WY4 C;  3P32 A;  3AE1 C;  2A06 D;  1KZU B;  2BCC D;  2KSE A;  3JC2 2;  1B7V A;  1JY2 N;  1GU5 A;  4I7Z C;  1DVH A;  4L74 A;  1AFO A;  2H88 C;  2O01 H;  2WTY A;  2CXB A;  3A5T A;  4PD4 E;  1XTG B;  4MU8 A;  3H1J G;  2R44 A;  1JY2 P;  3HUS C;  3L74 D;  4PV1 B;  1S6V B;  2BEZ F;  4NPD A;  3F5H A;  1BGY G;  4DY9 A;  2C2C A;  1NTM G;  1YHQ P;  1L0L K;  1IJD B;  3OA8 A;  5KKZ C;  3W68 A;  1KIL A;  3TNU B;  1S5L X;  1FDM A;  1DEB A;  1AOQ A;  2HPC A;  4FA4 A;  4TLF A;  1H0T B;  3RK2 B;  1U74 B;  4R4L A;  2BH5 X;  2DGE A;  2KB7 P;  2YKP A;  2G8Y A;  2KYV A;  3TGU J;  3AEB C;  2H8P D;  5AVU B;  3EFF K;  5CCH D;  4H0L B;  3M97 X;  1LT9 C;  3GW6 A;  3NXS A;  3D6Y A;  1AJY A;  1HZV A;  1BE3 G;  3V5B A;  2Q1K A;  2JWA A;  2V7Q J;  2FYU G;  2YXR B;  1L4A D;  2NPS A;  2B87 A;  3P8C D;  1EDL A;  1HF9 A;  2P10 A;  2FY8 A;  5CJ4 A;  1SQQ K;  2FXM A;  3H1J E;  3QWO C;  3GHG A;  3FXD A;  2E76 C;  4BWN A;  1RF1 C;  1KIL E;  1HGZ A;  4W80 A;  3I56 P;  1BGY E;  3PHL A;  3BVH A;  1CIG A;  1KV9 A;  1FJK A;  5CID B;  2P2U A;  3Q5R A;  2WSF J;  1JB0 J;  1AQ5 A;  1PFI A;  1LJ2 A;  1MUU A;  1IO3 A;  1N7S B;  2QEX P;  3OCD A;  1VQ4 P;  3HUS A;  1NTK G;  3BCC E;  1AA0 A;  1OIP A;  1S5L H;  3A0B E;  1GZL A;  2OYH A;  1PGP A;  3M9B A;  5GTH V;  2OYI A;  3LID A;  1HJB A;  2SPZ A;  2N9Y B;  1CI6 A;  1VQO P;  4Y99 B;  3NMD A;  5DJT B;  3A9F A;  1NMI A;  5BVZ A;  4YXW H;  1KQF B;  4GDO A;  1YQ3 C;  3LW5 H;  4H0J A;  1QL1 A;  1VL2 A;  4RSZ A;  2PRR A;  1JTH A;  3AE2 C;  2Q6Q A;  3R2P A;  1L0N J;  2CE0 A;  1K3G A;  1J1E B;  1A02 F;  3ITK A;  1MFZ A;  2ZXE B;  4K35 A;  1CHH A;  5KTB A;  4XFJ A;  1VDF A;  1JEK A;  2J59 M;  1G2C B;  2ZXX A;  2IBZ D;  3B5N C;  1RZ6 A;  1NTK E;  5DJU B;  3L37 A;  1M1J A;  1NU1 D;  3A2A A;  1DW2 A;  5KJ7 A;  2JP3 A;  1CSX A;  1FU1 A;  1MZ9 A;  1WMK A;  3IFM A;  4OWF A;  1DIQ C;  5CIH B;  2K9J B;  1FS0 E;  4N78 D;  5L8R J;  4C7N A;  1KQS O; 
#chains in the Genus database with same CATH homology
 1HRC A;  1BCC D;  3A0H V;  1DVV A;  1C6O A;  3PXT A;  4Q5P A;  1W2L A;  1ETP A;  2CA3 B;  1NTK D;  1BL9 A;  1A8C A;  1CXA A;  2C1U A;  5AUR A;  2N18 C;  3SWS A;  3H1H D;  4WQ7 A;  3ZOX A;  4AAL A;  3PRJ A;  3VRD A;  1N50 A;  1SQV D;  2KS1 A;  1C7M A;  2LIT A;  3SXT A;  1MG3 D;  1LC1 A;  4O1Q A;  5CIB B;  3ZOY A;  1N90 A;  3DR0 A;  3ZIY A;  1KYO W;  2QJY B;  3L71 D;  1CTZ A;  5CIC B;  1CTY A;  3DMI A;  4FAN A;  2AXT V;  4AAN A;  4J20 A;  3TGU D;  2BGV X;  3WFC C;  1HCM A;  3TDK A;  1JDL A;  3WUI A;  1IRW A;  4L1Q A;  4N0K A;  2I8F A;  1H32 A;  3FWL A;  2B4Z A;  4WQE A;  1HRO A;  4UB6 V;  3WU2 V;  2D0W A;  4WQA A;  5CIE B;  3RN0 A;  1IZL 0;  1CRI A;  1H32 B;  1HJ4 A;  3A0B V;  3ZOO A;  1LC2 A;  1OCD A;  1CCR A;  2ZZS 1;  3KZI V;  3SVW A;  3WFD C;  5B66 V;  1CRC A;  2ZBO A;  4PJ0 V;  5DFS A;  3WFB C;  1I6E A;  1NTZ D;  2PCB B;  1L9B C;  4AAM A;  2L91 A;  3L75 D;  1N15 A;  3O20 A;  2Q3E A;  3L70 D;  4EIC A;  1CCH A;  1CIF A;  1H31 A;  4IL6 V;  3VNW A;  1WVE C;  1QYZ A;  4GYD A;  1DW1 A;  4AX3 A;  1R0Q A;  1A56 A;  1KYO D;  1YIC A;  3MK7 B;  1W5C T;  2MTA C;  1H31 B;  1YTC A;  3CX5 D;  1EZV D;  4WQ8 A;  3NBT A;  1DT1 A;  2YIU B;  3ZBM A;  2Y0E A;  2YQB A;  1RAP A;  3H1I D;  3CU4 A;  3HQ6 A;  1COR A;  2N18 B;  1OAE A;  5DF5 A;  1HZU A;  2FRC A;  3HQ7 A;  4L3H A;  4QAO A;  4WQ9 A;  4YE1 A;  3L4M A;  3L72 D;  2BPB B;  2QG4 A;  4PW9 B;  2QJP B;  3OA8 B;  5TIS V;  1U75 B;  1CIH A;  1E8E A;  2ZOO A;  1HJ3 A;  2JQR A;  4WQC A;  5KLI B;  5CIF B;  1C75 A;  1KB9 D;  2CA4 B;  2Y0D A;  2OZ1 B;  1KX2 A;  5DJQ C;  4FA1 A;  1IQC A;  4V2K A;  4EIE A;  4Y5R A;  1SQX D;  2B0Z B;  3VYM A;  1M70 A;  3C2C A;  1L0N D;  2GB8 B;  3TF5 A;  1NML A;  3VMA A;  1I55 A;  4FB1 A;  5CIG B;  3GG2 A;  2N3Y A;  2HV4 A;  3O1Y A;  2B11 B;  1CSV A;  4P4Q B;  4WQB A;  4XYD B;  2JTI B;  1KB0 A;  2C1D A;  5IY5 1;  3L73 D;  1I5T A;  2B12 B;  1NNO A;  1CC5 A;  1CYJ A;  3CX5 W;  1AOF A;  1A2S A;  155C A;  2N9J A;  2AI5 A;  5B5E V;  3O0R C;  2C9X B;  3SJL A;  1YIQ A;  1F1F A;  2C1D B;  2YCC A;  3DP5 A;  1KX7 A;  1YNR A;  1YEB A;  5E79 V;  3L4O A;  1DII C;  1HH7 A;  2MHM A;  2LIR A;  1CRG A;  4JCG A;  2QJK B;  5EXQ A;  1SQB D;  351C A;  2C1V A;  1CRY A;  5GTI V;  4A7P A;  5B6Q A;  3SLE A;  2DVH A;  1GQ1 A;  3RLM A;  1CXC A;  5TJH A;  3PXS A;  1QL4 A;  1F1C A;  2EXV A;  3PTZ A;  1COT A;  4WQD A;  2BH4 X;  1M6Z A;  2D0S A;  3PXW A;  1C6R A;  1KIB A;  4XXL A;  3H1K D;  2C8S A;  3OCD B;  1C52 A;  2PAC A;  4FA9 A;  3RN1 A;  1C6S A;  1CIE A;  1I8O A;  2A06 D;  2BCC D;  1CNO A;  1B7V A;  2B10 B;  4K3I A;  1DVH A;  2BCN B;  3BCC D;  3PLN A;  2CXB A;  1CRH A;  1GJQ A;  3O5C A;  4MU8 A;  1DW3 A;  4RJT A;  3L74 D;  2KNC B;  1C2N A;  1J3S A;  1GIW A;  1S6V B;  2RMZ A;  2GC7 D;  1FCD C;  3JBT B;  3ZCF A;  4DY9 A;  2C2C A;  2V08 A;  1PPJ D;  3ZOW A;  1CTJ A;  2BLF B;  3OA8 A;  2O3J A;  4FAV A;  5DJQ B;  1H1O A;  1H9X A;  1P84 D;  1AOQ A;  2Y0C A;  4FA4 A;  1L9J C;  1U74 B;  4U3F D;  2BH5 X;  2OZ1 A;  1H33 B;  4PD4 D;  2DGE A;  1E29 A;  1HJ5 A;  1QL3 A;  4H0K A;  2PCC B;  1GKS A;  1CYI A;  2YK3 A;  3M97 X;  3ORV A;  3KHU A;  1FHB A;  3GW6 A;  5KAI V;  5CYT R;  1CHJ A;  1I6D A;  1FI9 A;  1LS9 A;  2XTS B;  1HZV A;  3RMZ A;  2RN0 A;  2JWA A;  4AAO A;  1RZ5 A;  2CE1 A;  2ZON G;  1AYG A;  4LJI A;  1CSU A;  1RAQ A;  5KLV D;  3NWV A;  2FYN B;  1C2R A;  1I54 A;  2N3B A;  1CHI A;  3HQ9 A;  3CXH W;  3CWB D;  3PHL A;  1ZZH A;  4L3G A;  1FI3 A;  1QN2 A;  1CIG A;  1KV9 A;  3WC8 A;  1GDV A;  5CID B;  4KMG A;  3H1J D;  4PWA A;  1L0L D;  2N9I A;  3X39 A;  1FI7 A;  1BGY D;  2AIU A;  1NTM D;  3PH2 B;  1IO3 A;  5H2F V;  2L4D A;  2ORL A;  3OCD A;  4UB8 V;  1CRJ A;  5C0Z A;  1I8P A;  1S5L V;  1IRV A;  1FOC A;  1ZRT D;  1CED A;  4FA5 A;  4NFG B;  1GU2 A;  3CP5 A;  4GED B;  5GTH V;  451C A;  2VHD A;  2N9Y B;  4D6T D;  1NIR A;  2GC4 D;  3CYT I;  3A9F A;  1NMI A;  1WEJ F;  1LMS A;  1E2R A;  1CYC A;  4H0J A;  1YFC A;  5KKZ B;  1SQP D;  4RSZ A;  1MG2 D;  5KAF V;  1BE3 D;  1FJ0 A;  4EDF A;  2FYU D;  1SQQ D;  2GIW A;  2V07 A;  1M60 A;  1YCC A;  3CXH D;  4EIF A;  2CE0 A;  1H33 A;  1PP9 D;  3H1L D;  1K3G A;  2ZXY A;  3ITK A;  1DW0 A;  2FWL A;  3HQ8 A;  1EB7 A;  1CHH A;  1LFM A;  2IBZ D;  1H9Y A;  1K3H A;  1RZ6 A;  1N9C A;  1CO6 A;  1NU1 D;  1CSW A;  1DW2 A;  3TYI A;  4O1W A;  1QKS A;  3NBS A;  1CSX A;  1AKK A;  1YEA A;  1MZ4 A;  1DIQ C;  5CIH B;  2K9J B;  1VYD A;  3MK7 C;  4EID A;  5C9M A;  3WFE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...