1SQQD

Crystal structure analysis of bovine bc1 with methoxy acrylate stilbene (moas)
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 51
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1sqqD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1sqqD02
1L9BC 5DF5A 1COTA 1DW2A 1YNRA 1HJ3A 4XXLA 1A8CA 2B12B 4AANA 4UB6V 2QJPB 3NBSA 1L0ND 1P84D 3H1LD 2L4DA 1DVVA 3GW6A 1IZL0 4GEDB 3C2CA 1R0QA 1DT1A 1I54A 1K3GA 4WQ7A 1CCRA 3L4OA 2JQRA 1J3SA 1YTCA 4IL6V 1CRCA 3SLEA 5CICB 3ZOXA 4A7PA 2CXBA 3L74D 1OAEA 1WVEC 3A0BV 3O0RC 3TGUD 4L3GA 1CIFA 4WQAA 3CU4A 1F1CA 4NFGB 1CRGA 4L3HA 1AYGA 1I55A 5CIGB 1KX7A 1KYOD 3CX5D 2FYNB 4EDFA 5KAFV 1MG3D 1N90A 2FWLA 1CYCA 1HH7A 1FI9A 3HQ6A 1VYDA 1I5TA 2Y0EA 3A0HV 2C1DA 1IQCA 5E79V 1W2LA 1B7VA 451CA 1ETPA 2VHDA 4WQ9A 4EIFA 3DP5A 1I6DA 2AXTV 2Y0DA 2CA4B 1CORA 2GIWA 3VNWA 1ZRTD 3WFBC 4FANA 4O1WA 3CP5A 5EXQA 2MTAC 3JBTB 5DFSA 4D6TD 4RJTA 4H0JA 1CEDA 2KNCB 3RMZA 2B0ZB 1L9JC 1FI7A 3MK7B 3OCDB 1C52A 2I8FA 1MZ4A 1YCCA 1LC1A 3SWSA 1GQ1A 1CHIA 5CIHB 1KB0A 3PXWA 4FA9A 1N15A 2ZXYA 1AOQA 1GKSA 1FOCA 1E8EA 3O5CA 3A9FA 3L72D 4FA4A 2N3YA 3FWLA 1CHJA 3SJLA 4DY9A 1S5LV 4RSZA 1HRCA 1NNOA 1NTZD 1KX2A 1MG2D 1I8OA 1CHHA 1C6SA 4AX3A 1H9XA 5AURA 4FB1A 2C9XB 4XYDB 1C2NA 1CRHA 2BPBB 1NIRA 1U74B 2Q3EA 5KLVD 2ZZS1 4WQ8A 5C0ZA 2N18C 2QJYB 1CTJA 3WFCC 2YQBA 3X39A 1YFCA 2FRCA 3CXHW 5DJQB 5TJHA 3ZIYA 1SQBD 5KLIB 1CSUA 1H33B 3WC8A 2BGVX 4FA1A 3HQ9A 1CRYA 1BE3D 1C7MA 1I6EA 2XTSB 1GU2A 4QAOA 2QG4A 3PRJA 2BCNB 2LITA 1FI3A 2LIRA 1CIHA 2D0SA 4Y5RA 2PCBB 2N9YB 1M70A 3ZOWA 1NU1D 4UB8V 4AAOA 1EZVD 1DW0A 3ZCFA 1C6RA 4EIDA 1FJ0A 2N3BA 1DIIC 5B66V 3KHUA 2D0WA 1KB9D 2YCCA 4P4QB 1OCDA 3H1HD 1PPJD 2BH5X 2GC7D 1H31B 1C75A 2AI5A 1BCCD 4FAVA 1YIQA 3NWVA 2ORLA 3PXTA 2B11B 3H1JD 2HV4A 3L70D 1GIWA 4J20A 1CO6A 3VRDA 3H1KD 2V07A 3O1YA 2BLFB 2MHMA 1S6VB 2EXVA 1EB7A 2YK3A 3SXTA 1CTYA 1H32B 2PCCB 2CE0A 3ZBMA 2B4ZA 1AOFA 1QN2A 2FYUD 2DGEA 1CYIA 5C9MA 3OCDA 4PJ0V 5GTIV 1SQVD 5CIBB 3L71D 1ZZHA 1CYJA 351CA 2RN0A 3TF5A 4MU8A 4O1QA 1CNOA 1CSVA 1DVHA 2C8SA 2BCCD 3WFEC 1SQQD 1YEAA 2CA3B 1DIQC 2AIUA 2Y0CA 1NMIA 1BGYD 1RAQA 1CCHA 1CRJA 1CTZA 1IRVA 2K9JB 4AALA 4Q5PA 3CWBD 1CIEA 1KYOW 1M6ZA 3ORVA 3CX5W 2KS1A 2YIUB 4WQCA 3SVWA 2OZ1B 1H9YA 1LMSA 2C1UA 2JWAA 1E29A 1W5CT 1PP9D 2JTIB 1FCDC 1HCMA 4FA5A 1C6OA 1SQXD 3PXSA 1NMLA 1AKKA 1CSWA 3VMAA 2BH4X 2OZ1A 2GB8B 4PD4D 3RN0A 1CRIA 4EIEA 4N0KA 1H33A 1DW1A 1H1OA 3ITKA 3PTZA 1N9CA 3KZIV 1C2RA 5GTHV 5H2FV 3HQ7A 3RLMA 3TDKA 1QL4A 1HJ5A 5TISV 1JDLA 3DMIA 1L0LD 1RZ5A 4JCGA 1I8PA 1GJQA 4AAMA 1F1FA 1NTKD 1LFMA 3OA8B 1LC2A 1NTMD 2N18B 3MK7C 3O20A 2N9IA 3GG2A 2C1DB 2CE1A 2V08A 1HZVA 1QYZA 4V2KA 5CIDB 1BL9A 1A2SA 1RAPA 3M97X 3CXHD 3WFDC 1IRWA 1LS9A 1KV9A 4YE1A 3HQ8A 1YEBA 2N9JA 5CIEB 1HJ4A 5IY51 3OA8A 1CXCA 4WQBA 3TYIA 1A56A 3L73D 1H31A 1IO3A 1DW3A 2ZONG 3WU2V 2GC4D 1N50A 3RN1A 2ZBOA 1K3HA 2PACA 4H0KA 4WQEA 2L91A 5B5EV 2RMZA 1QL3A 1U75B 5KAIV 3ZOYA 1CSXA 2A06D 4WQDA 1QKSA 5KKZB 1H32A 1CIGA 1WEJF 3BCCD 4K3IA 5CYTR 3WUIA 2DVHA 1M60A 1HZUA 1YICA 5DJQC 3PLNA 2B10B 155CA 4KMGA 2O3JA 3ZOOA 3PH2B 4LJIA 1CXAA 3L75D 1SQPD 1GDVA 1RZ6A 3VYMA 2QJKB 3CYTI 1CC5A 4U3FD 2ZOOA 4GYDA 4L1QA 4EICA 1E2RA 2IBZD 4PW9B 1HROA 3L4MA 1KIBA 1FHBA 5CIFB 3NBTA 4PWAA 3DR0A 5B6QA 3H1ID 3PHLA 2C2CA 2C1VA
chains in the Genus database with same CATH superfamily
2LKMA 2BCCJ 3P7KA 1NU1G 1R5SA 2UWJE 1KILE 3B5ND 1OWAA 4RKUJ 1DW2A 2AXCA 2K9JA 3CPWO 4AANA 4W7YA 1P84D 2KOGA 1L2PA 3GW6A 5CCGD 3C2CA 1R0QA 3H1HG 2J58A 2GUSA 2P1JA 1VL2A 3A0BH 1E79H 2J59M 3H1IJ 3SFEC 4A7PA 2A45H 2CXBA 3RBXA 2ZAEB 1OAEA 3A0BV 2M5AB 1FZCB 1SQXJ 4WWIA 5KAFH 3L73G 1SFCA 4N3YB 2W83C 1SFCD 1RF1C 4IOIH 3E1RA 3IN6A 1SQXE 3CX5D 3MP7B 3JCUH 4EDFA 5KAFV 1J1DB 1HH7A 1FI9A 3HQ6A 1LTJC 1AQ5A 1GW3A 1I5TA 2Y0EA 1SLQA 1RQUA 451CA 4JYBA 4YXWH 1YJ9P 4WQ9A 4EIFA 1N86A 3GMAA 1GZLA 1T2KD 2CA4B 2HFED 5AVXB 3WFBC 4O1WA 1GMJA 1NTKE 1CW5A 4D6TD 3AEFC 1IFNA 1CEDA 1CZQA 2CK3H 1H8AA 2AEMA 1MZ4A 5B66E 2I1JA 5CIHB 3PXWA 2ZXYA 3L73E 4JQ0D 1JM0A 1SQBK 4FA4A 1G1IA 3VP9A 3FWLA 1YQ4C 1DH3A 1CHJA 1N73A 4Y28J 2Q7CA 4H13D 3G3ZA 1CHHA 3RL0D 1LTAC 2C9XB 1C2NA 2R3CA 3PP5A 2WPVB 1U74B 1SQPJ 2Q3EA 5KLVD 1NKZB 4YXDC 1L0LG 2QJYB 2YQBA 3X39A 4BWNA 1DD4A 1Q7YQ 1URQB 1SQBD 1NTMK 3L75E 5GTIE 1SQPE 1H33B 4LC1A 3M91A 1VQKP 3G71P 3SFDC 4FA1A 3HQ9A 1BE3D 3AEEC 1FC2C 1N7SC 1HUCA 1I6EA 2D2CC 3O8ZA 2XTSB 1OMIA 1GU2A 4QAOA 2QG4A 3G9RA 4GDOA 4WY4D 5B66H 4M3LA 1L0NJ 3RK3E 1DEBA 1DW0A 1GW4A 1FJ0A 4YPCA 5B66V 1L0NE 2YCCA 4XA4A 1YQ3C 3E7KA 1HJ0A 1H31B 5AW5B 2I8DA 1M1JB 3CLQA 3PXTA 2W6JH 1PFIA 2JR8A 1L4AA 3TGUE 2WTYA 4UB8E 3H1KD 1MV8A 3B5NC 2BLFB 2O1KA 4WVZA 5TISE 2V7QJ 1OW8A 3NMDA 2WSCJ 1H32B 3VMZA 4U3FG 4EIJA 1KYOE 3BVHA 1FDIA 1HWTC 2CE0A 3OW2O 2B4ZA 5CCGC 2QIWA 3GLMA 1IFDA 2IYOA 2JKVA 3NTNA 3H1JJ 5C39A 3VYIA 2YMKA 2HR3A 4W7ZA 3L70J 5GTIV 1KILD 1QX8A 1ZZHA 1CYJA 3TF5A 1NWQA 1D7MA 2WITA 4WBAA 1DVHA 4ZKUA 2BCCD 3QWOC 2QEXP 1VF5D 1EDKA 2HLOA 3RL0g 2YNYA 1T3UA 1DIQC 1PGPA 3M0AA 2FYUJ 2M3EA 1ZW0A 5AVRB 2V4HA 3TYYA 1OX3A 1IRVA 2K9JB 1CIEA 1RE4C 1M6ZA 3ORVA 3CX5W 4WQCA 2VRSA 3SVWA 1LMSA 5BVZA 1VQ8P 1T2KC 1E29A 4ZKPA 2YO3A 4KHXA 3TNUA 1IZNB 1EZVG 2WVRA 3CMEP 4FA5A 1SQXD 1IFMA 3V2PA 2KUBA 1YJWP 3HE4A 1FZFA 2GUVA 4IL6H 3RN0A 1KYOH 3JSVC 1H1OA 1VQ4P 1N9CA 3CWBJ 5AW6B 3I55P 1C2RA 1K8AQ 1VQ7P 2E75B 2YO2A 2V7QH 1QL4A 5TISV 3H6PA 3CCSP 1GL2B 2WSCH 2OARA 1UIIA 3DMIA 1RZ5A 2G8YA 3L36A 2FBWC 1NTKD 2WSFJ 1S1CX 1FOSF 3OA8B 3MK7C 2M0BA 2N9IA 3GG2A 1AQTA 1NYHA 3D0WA 1QYZA 2WSSH 3CMAP 1UIXA 1BL9A 1KV9A 4YE1A 2YXQB 1R8EA 1A56A 3R4YA 3L73D 3RL0C 2PRRA 2KXPB 3RK2B 5H2FE 1JY2P 3AE6C 1EZVE 1RF0C 1N50A 4H0LB 1WMKA 1KB9E 2ZYDA 3K5BA 2E5YA 2L91A 2C0WA 4K3AA 1KTMA 3N4XA 1PPJE 1IFJA 1S2EA 3FGAD 1KQGB 4WQDA 2R44A 1KYOI 3AEGC 1PL5A 4GODA 1RF1A 4WY4C 1HZUA 1YICA 5DJQC 4KJMA 5KLVG 3B8EB 2O1JA 1MUUA 1YITP 5E79E 1N73B 2BEZF 1LTJA 1HJBA 1BDCA 1GU4A 3L75D 2Q9IA 1SQPD 1GDVA 4IL6X 3V6IA 5AVZB 1KMIZ 1SQBG 2QJKB 2HG5D 2E43A 1CC5A 3GHGC 2OTKE 1CSBA 1QEXA 4HH2A 4PW9B 3L4MA 1USDA 3L71J 4OH8B 2WSFH 4C7NA 3RK3D 1IC2A 2C2CA 5DF5A 3L71E 1LNQA 2B12B 2QJPB 1AVYA 1L0ND 2IYPA 1DVVA 5AVTB 3KDPB 2LR2A 2PP6A 1S9KE 1I54A 1KB9H 1KQFB 3L4OA 2JQRA 1YTCA 3HE5B 5CICB 2OYOA 2IPPA 1PP9J 1J1EC 3GF3A 1WVEC 3TGUD 2QM8A 4L3GA 1CIFA 1KILC 3AE5C 3HUSB 3CU4A 3H1KG 1F1CA 1XTGB 1JMMA 5E79H 3AE2C 1CRGA 3IAOA 1KYOD 2WQYC 1QVFO 2FYNB 2FWLA 5KTBA 3CCJP 1KQLA 2PGDA 4NPEA 5KKZC 3GF7A 2R3SA 5E79V 1PZQA 1L4AB 2Q6QA 1H0TA 1Y9BA 2FYUK 4DCKA 1B7VA 2A06G 1G2CA 3AEDC 1NTMJ 1I6DA 1Q90D 2Y0DA 3VNWA 4ASWA 2YKPA 2WZ7A 1ZMEC 1S3JA 1N7SA 3WUVA 3CP5A 2MTAC 5EFWB 4L76A 4GT1A 2BCCG 1NTME 2HPCA 2E74D 3RMZA 3AE3C 1FI7A 1OXZA 5KAFE 1KB9I 1NJIQ 3CXHE 3I56P 4TLFA 1WT6A 1GK4A 2YIUC 3SWSA 2IBZG 1GQ1A 1ZOYC 1R5LA 1KB0A 4FA9A 3HD7D 2XNXA 1E8EA 5AVUB 3I5CA 1JMBA 2N3YA 1T3JA 4R4LA 1SQXG 4CPGA 1AV1A 2BEQD 4RSZA 2W6AA 1HRCA 2MJZA 1NNOA 1A02J 1KX2A 2QM7A 2A06E 1I8OA 1C6SA 3B5NA 1OW7A 2LXBA 3KQGA 2P10A 2WPRA 3TNUB 1CRHA 1NIRA 1SP4A 4WQ8A 2QSIA 1CTJA 1T8ZA 4N6JA 3D70A 3HE4B 1NKNA 3CCLP 2BCCE 5CCGA 1NTKG 4DJGA 1LTTC 5TJHA 3PJSK 1KZUB 1JY3P 1NTZJ 3VTPC 1CRYA 2NPSD 1FDOA 3AE9C 4L73A 2IBZE 2JO1A 2Y9ZA 1PGOA 1CIHA 1VQ6P 2D0SA 2PCBB 3CXHH 5CJ0A 4PV1D 1M70A 3CL3D 3ZOWA 3H1IE 3G4SP 1H89A 4AAOA 5AW8B 2WWWA 1EZVD 1Q2NA 2E76B 2KSJA 1VQNP 2N3BA 1DIIC 2D0WA 1KB9D 1KORA 1Q81Q 3SWFA 1PPJD 1JY2N 1RE4A 2GC7D 3OA7A 5KJ7D 3CCEP 3KXDA 1PIXA 1H88A 1VQ9P 1NU1J 3NWVA 2ORLA 1VQOP 5K5GB 4L74A 3RK3C 1MZ9A 1CO6A 2GM4A 4HJGH 3G6EP 2OYHB 1BDDA 1JY2O 1IFPA 4OGQD 2Q5UA 2EXVA 3L75G 3O6QB 1SQPG 3SXTA 4MN4C 3Q3DA 2PCCB 4PJ0H 3ZBMA 1RF1B 4BRYA 4Y99B 3L37A 5APVA 4Z1MH 1JEKA 3VOPA 1KFNA 1LP1A 4TT3H 2DGEA 1CYIA 1LTJB 3OCDA 2A45I 1LTSC 4PJ0V 4JF7A 4AUWA 3CXHI 3L71D 351CA 2XNDH 2OQQA 1ZRTE 4O1QA 4I7ZC 1L0NG 2P7JA 2CA3B 2FYZA 1S9KD 1E5WA 1HGZA 4C7NB 1NMIA 4GOFA 3V5BA 3AE4C 4LLHA 1JUNA 2W27A 1HVVA 3BRVB 2FFDC 1SQVJ 1OW6A 4Q5PA 1KYOW 2OZ1B 3TGUG 2K37A 1PP9D 1FCDC 5AW2B 1K73Q 1C6OA 1NMLA 2PAJA 4WY4A 1CSWA 3AEBC 4B86A 2E74C 2GB8B 4N0KA 3ITKA 1FZEA 4L75A 5APTA 2FXMA 3TK1A 1ZV8A 1M1JC 2IBZI 3GHGA 1JDLA 3EWKA 3HD7C 4EYYQ 3LW5J 3S1KA 3IR9A 3IFMA 2KYVA 3S9OA 3H1JG 3L70G 1NTMD 1VDFA 2WPSA 2ZT9D 5CCHD 3O20A 5CBOA 1FZAA 1AVOA 1G2CB 1QL2A 2JJLA 1A2SA 1RAPA 1W2EA 3WFDC 3CXHD 1IRWA 3Q5PA 3HQ8A 1YEBA 3A3YB 1N7SB 1KQSO 2D2CB 1L0LJ 2FYUG 5CBNA 3CI9A 5CJ4A 2HODA 3T97A 3H32A 5KAIH 3A7OA 4IL6E 4HB1A 3RN1A 2O01J 1BCCJ 3AE7C 1U75B 5KAIV 3ZOYA 1NTZK 2A06D 2N1TD 4JYCA 4IFDK 1KILA 1QKSA 2NPSC 2G3AA 1MFZA 1BCCE 1NAFA 1WEJF 3SWKA 4K3IA 5BU8B 2DVHA 3H1JE 3M9HA 1QLED 1AFOA 1DEEG 3P8CE 3L70E 4PV1C 5KLIC 3CWBG 3ZOOA 1CXAA 1RZ6A 1CI6A 4WB4A 3CYTI 3B5NB 4GYDA 4L1QA 1LWUC 4QMAA 3C1LA 1E2RA 1PV3A 4H44B 2IBZD 1M1KQ 1FHBA 1KC8Q 3NBTA 1NOHA 3LW5H 4PWAA 1W2BO 3BCCJ 2FYUE 3P32A 5KJ7C 3EFFK 3H1ID 1JY3N 1GL2C 5M1BA 3C8VA 2OYIC 1NU1K 1SQQJ 2JEEA 2Q3IA 3V2QA 1GK6A 1FDMA 3NBSA 3RBZA 1BGYJ 2KLVA 5CMZA 3UIAA 4C7RA 1SQQE 4OGQC 1IZL0 4GEDB 1DT1A 1PPJG 1K3GA 3MHVA 4WQ7A 1JY3O 5APQA 1SFCB 1BGYE 1J3SA 4IL6V 5APUA 2ZYAA 1S5LE 1QGKB 1X0TA 3ZOXA 1HF9A 2O01H 3RK2C 3CWBE 2W6BA 2RKLA 1JTHA 3A0HH 1KV4A 4NFGB 4H0LC 1I55A 5CIGB 3BASA 2B87A 1CYCA 3A0HV 2KLUA 2ZXEB 2IZ0A 1W2LA 1FBMA 3N7NA 3DP5A 3MGNA 2IDBA 1SQVK 2YKQA 3L71G 1ZRTD 4FANA 5EXQA 3QH9A 3RGUA 1M57D 2YMYA 2B88A 4BRYB 3JBTB 3S4RA 2MKVA 5DFSA 1YTZI 4RJTA 2QJKC 3WUTA 1LP1B 2FXOA 1BSNA 2GA1A 2B0ZB 1L9JC 3MK7B 3OCDB 1C52A 1YCCA 2L5GB 5AW9B 1LC1A 2Q1KA 1N15A 4RO0A 1DX7A 2K3RA 3C9IA 3KYQA 1AOQA 1ZN5A 1GKSA 4H13B 4LGDE 1S5LH 1GDTA 3RL0B 5APYA 4D6TJ 2QJPC 3BATA 1PP9G 1U57A 2M3BA 1S5LV 2ZT9C 2QE7H 5CCHC 3V2RA 5AW7B 4O9BA 1LTGC 1USEA 3Q1MA 1YI2P 4YTPC 2BASA 3HTKA 4GKGA 1P84H 4AX3A 1H9XA 5AURA 2RH0A 2BPBB 1IK7A 1EDLA 1FJKA 2ZZS1 1XTCC 4JPZB 5APWA 4XFJA 2N18C 3MUDC 1L0LK 1W5CE 3HUSC 4WY4B 2FRCA 3CXHW 5DJQB 1EDIA 1NTMG 1OIPA 2OTJP 1CSUA 2OGUA 3WC8A 2BGVX 2A45G 2WPQA 2E42A 1NHLA 3AECC 2KZIA 1FI3A 2LIRA 2JDIH 2N1TC 3TSIA 2ZXXA 4Y5RA 5KLVJ 1URQD 1VQMP 3H1LJ 2FY8A 4NPFX 3AE8C 1FJPA 2QRXA 3ZCFA 1PP9E 1QVGO 1C6RA 3CC2P 3V4WA 2FKWB 3KHUA 1YIJP 3H1LE 3WMM0 1KD1Q 2FFDA 1OCDA 5AW0B 1BE3J 2BH5X 1N7LA 2IFMA 2H43A 1PGQA 3A2AA 3M9QA 3OAKA 1NAYA 2KIKA 3L74J 1C75A 2HODB 1VQ5P 3T97B 1S5LX 2AI5A 1BCCD 3JC22 3V4QA 1YIQA 3IF4A 4R4MA 4ZNCA 2B11B 3H1JD 3Q5RA 2HV4A 3P8CD 3L70D 3L74E 2V07A 1SQQK 3O1YA 3A5TA 2ITAA 1K04A 1LT9C 1KILB 3CCUP 4BXLA 1S72P 1M1JA 4N78E 1K05A 1BSHA 5APXA 1OVUA 3P8MC 1EXJA 3HD7A 1U7JA 3E1IA 1QN2A 2FYUD 2KNCA 5C9MA 2ZJSE 1VF5B 1NTZG 3MZWB 3D6ZA 3H1IG 5CIBB 3H1KJ 2RN0A 4MU8A 1CNOA 1CSVA 5CHXA 2C8SA 2QVAA 4U7JA 1SQQD 4XE5B 3CCQP 3D6YA 2Y0CA 2M8RA 1BGYD 4JBZA 2IZ1A 2KSEA 1FZCC 3PH0A 3L72J 1CTZA 5B5EE 1FOSE 3CWBD 2ZFCA 4DT0A 4ASVA 2ZVOB 3CD6P 2KS1A 2YIUB 4PJ0E 2P67A 3U1AA 2JWAA 4EI2A 3L72E 2NPSA 1J1DC 1NVOA 3B71A 3KZIH 3PXSA 2WT7A 2ZYGA 4H44D 1AKKA 2C9LY 1CRIA 4EIEA 1NTZE 1Z56A 1DW1A 3PTZA 5AW1B 1Y8AA 3KZIV 2N9BA 3MTUE 3RLMA 1JTHB 3KPEA 1LWUA 1I8PA 1OZHA 3OJAB 1RY3A 1GJQA 2OYHC 1F1FA 2B87B 1LFMA 1LC2A 5KJ7A 2CE1A 3VN0A 2V08A 2E75D 1GL2A 1JO5A 4W80A 3LIDA 2OYIA 1GL2D 4UB6E 4Y99C 4RESB 4V2KA 5CIDB 1LS9A 4NPDA 3WU2H 5CIEB 3OA8A 4DZOA 1IFIA 3AEAC 1MFTA 5APSA 2YKOA 1RE3C 1NU1E 1NTKJ 5B5EH 1M7LA 5AW3B 1DW3A 3H1HJ 2XDJA 3WU2V 1SQVG 5AVQB 2ZBOA 1K3HA 2PACA 1HTLC 5B5EV 2RMZA 1QL3A 3H1HE 3RK2D 2JP3A 3L73J 1YYCA 4K35A 2QJYC 3L4FA 4H0LD 3WUIA 1M60A 3PLNA 1URQC 5KLVK 2B10B 1SS1A 2AEJA 4KMGA 3PH2B 4LJIA 3RK3B 3VYMA 3HTKB 2AXTE 2K1AA 4AQRD 2ZOOA 4OVNF 1RQVA 1RF0A 1LT1A 1KIBA 5CIFB 5KAIE 4UB6H 2XV5A 1FAVA 3DR0A 5B6QA 4IFMA 2C1VA 3FXDA 1L9BC 1SQVE 3FXEA 1COTA 1KN7A 3L75J 1YNRA 3CCVP 1HJ3A 4XXLA 1A8CA 1KFMA 4UB6V 3H1LD 3CC4P 2L4DA 4I7ZB 2E5TA 1CCRA 3V2NA 4KT0J 1CRCA 3SLEA 1BCCG 3F5HA 1JCCA 3L74D 4ZMDA 3O0RC 2XZRA 5CCHA 2FFDB 3M0DC 4C46A 4WQAA 2CPBA 1H0TB 3ZDMA 2H89C 3HE5A 4N78D 4L3HA 1AYGA 1KX7A 1MG3D 1N90A 1X8YA 1X79B 2AXTH 1VYDA 3MUDA 4PD4E 4HKZH 1X9VA 3HUSA 1LTIC 2C1DA 3ABVC 1IQCA 4DOJA 2Z5IA 2E74B 1ETPA 2VHDA 3EFGA 2HPCB 3M9BA 3TGUJ 1Y47A 2IX7C 3F89A 2AXTV 2GIWA 1CORA 1L0LE 3BCCG 1YTZT 3H25A 4AYCA 3HD7B 1GD2E 1L4AD 2N1TA 2HYNA 1SQQG 2B9BA 4H0JA 2AEFA 2KNCB 1VPCA 3CCRP 2I8FA 4H44C 1BGYG 2YXRB 3NXSA 1AA0A 5GTIH 1YJNP 1CHIA 3A0HE 1OVRA 1DIPA 1SVFA 1FOCA 3O5CA 1JOCA 3A9FA 3L72D 2PFXA 4IFFA 3CC7P 3B4SA 2QA4P 1SQXK 3SJLA 4DY9A 1DD3A 1Q86Q 1NTZD 1TU3F 1SFCC 2E75C 2K88A 2KS1B 1MG2D 4FB1A 1LJ2A 1VQLP 4XYDB 4PD4H 1LT9A 2XU6A 3BCCE 2NPSB 3FX0A 1JCDA 1Q82Q 2P2UA 5C0ZA 2WT7B 4U3FJ 3WFCC 1ZP0C 2Z4EA 3R2PA 1YFCA 1NTKK 4HYTB 1T6AA 1U7MA 3ZIYA 4PV1B 5KLIB 1ZLLA 1OVVA 1FE6A 4U3FE 2POHA 3II6A 4UB8H 1C7MA 1NGMB 5AVYB 5TISH 1LWUB 3PRJA 1JB0J 2BCNB 2LITA 3MD0A 1X22A 2N9YB 1IJDB 1NU1D 4UB8V 3U1CA 3SSUA 3D71A 4EIDA 2OYIB 2JWDA 1P84E 2M5AA 1FZCA 2B89A 2WSEJ 4P4QB 1A02F 3CCMP 2R5DA 3H1HD 3Q2YA 2H7HA 4D6TG 1RHZB 5AVSB 1EQ7A 1FZBA 4GIFA 4OGQB 2E76D 2O01N 4FAVA 1NO4A 2R5BA 1N73C 2IFNA 4PD4I 3U59A 4H13C 1GIWA 4J20A 3VRDA 1S4XA 2MHMA 5GTHE 1S6VB 2YK3A 1EB7A 3MIWA 1SQPK 1GTWA 1CTYA 1AJYA 3CX5E 2NZ2A 3VP8A 1IO4A 1AOFA 2OYHA 1JNMA 3O6QA 5DJTB 1SQVD 2Z5HA 3W67A 3VMXA 4I1LA 1FS0E 5AW4B 1J2JB 3WUUA 1L0NK 3H1LG 3HRNA 3WFEC 4D6TE 1YEAA 1FU1A 2XKMA 2AIUA 1RE3A 1VQPP 1M90Q 1RAQA 1CCHA 1CRJA 5AVWB 1BE3G 1NH4A 3USSA 4AALA 1HH0A 2DW3A 2WSEH 2KZJA 3LIEA 3L74G 2OTLP 1LGHB 1H9YA 2ZVNB 2C9NY 2C1UA 2W8ZA 2WMMA 1W5CT 2FYNC 2JTIB 4EOTA 1HCMA 2H8PD 5GTHH 3GHGB 5H2FH 1G1JA 1K9MQ 1YBKA 1L4AC 3VMAA 2BH4X 1URQA 2OZ1A 1RH5B 4PD4D 3CX5H 1H33A 2KP8A 2ZT9B 1ZR2A 2W90A 2SPZA 3AE1C 1HBWA 5GTHV 5H2FV 3HQ7A 3TDKA 3W68A 1EDJA 1HJ5A 1SQBJ 1LTBC 2NRGA 1L0LD 4JCGA 5KLVE 1N8RQ 4AAMA 4OWFA 1OFCX 1EC5A 2N18B 1SQBE 2C1DB 1HZVA 2LXCB 1QL1A 3H32B 3NFQA 1P84I 1BE3E 3M97X 5DJUB 2N9JA 5AVVB 1HJ4A 5IY51 1VF5C 1CXCA 4WQBA 3EQ2A 3TYIA 1EXIA 2R32A 1YHQP 1GU5A 1H31A 1IO3A 3L35A 1J1EB 3KZIE 4I2LC 2KB7P 1WRGA 2N1TB 2ZONG 2J5UA 3L72G 1ZXGA 1HGVA 2GC4D 3BRTB 2FXPA 5L8RJ 3FWNA 4GOEA 3A0BE 4H0KA 4WQEA 1N7SD 2D2CD 3VMYA 1CSXA 1N2DC 3M0DA 1EZVI 5KKZB 1H32A 1M56D 3CX5I 1MKMA 2KI7B 1CIGA 1CI6B 3BCCD 1ZR4A 5CYTR 2Y9YA 1M8OB 1FZGA 155CA 2KK7A 2H88C 2K9YA 2O3JA 4I6MC 3H1KE 5BU5A 3JCUE 3WU2E 3M06A 2C0XA 2CPSA 1IK9A 4U3FD 2I1KA 4EICA 3SWYA 1LT9B 3Q5SA 1HROA 1PGJA 2P58A 3PHLA 2E76C
chains in the Genus database with same CATH topology
1L9BC 5DF5A 1COTA 1DW2A 1YNRA 1HJ3A 4XXLA 1A8CA 2B12B 4AANA 4UB6V 2QJPB 3NBSA 1L0ND 1P84D 3H1LD 2L4DA 1DVVA 3GW6A 1IZL0 4GEDB 3C2CA 1R0QA 1DT1A 1I54A 1K3GA 4WQ7A 1CCRA 3L4OA 2JQRA 1J3SA 1YTCA 4IL6V 1CRCA 3SLEA 5CICB 3ZOXA 4A7PA 2CXBA 3L74D 1OAEA 1WVEC 3A0BV 3O0RC 3TGUD 4L3GA 1CIFA 4WQAA 3CU4A 1F1CA 4NFGB 1CRGA 4L3HA 1AYGA 1I55A 5CIGB 1KX7A 1KYOD 3CX5D 2FYNB 4EDFA 5KAFV 1MG3D 1N90A 2FWLA 1CYCA 1HH7A 1FI9A 3HQ6A 1VYDA 1I5TA 2Y0EA 3A0HV 2C1DA 1IQCA 5E79V 1W2LA 1B7VA 451CA 1ETPA 2VHDA 4WQ9A 4EIFA 3DP5A 1I6DA 2AXTV 2Y0DA 2CA4B 1CORA 2GIWA 3VNWA 1ZRTD 3WFBC 4FANA 4O1WA 3CP5A 5EXQA 2MTAC 3JBTB 5DFSA 4D6TD 4RJTA 4H0JA 1CEDA 2KNCB 3RMZA 2B0ZB 1L9JC 1FI7A 3MK7B 3OCDB 1C52A 2I8FA 1MZ4A 1YCCA 1LC1A 3SWSA 1GQ1A 1CHIA 5CIHB 1KB0A 3PXWA 4FA9A 1N15A 2ZXYA 1AOQA 1GKSA 1FOCA 1E8EA 3O5CA 3A9FA 3L72D 4FA4A 2N3YA 3FWLA 1CHJA 3SJLA 4DY9A 1S5LV 4RSZA 1HRCA 1NNOA 1NTZD 1KX2A 1MG2D 1I8OA 1CHHA 1C6SA 4AX3A 1H9XA 5AURA 4FB1A 2C9XB 4XYDB 1C2NA 1CRHA 2BPBB 1NIRA 1U74B 2Q3EA 5KLVD 2ZZS1 4WQ8A 5C0ZA 2N18C 2QJYB 1CTJA 3WFCC 2YQBA 3X39A 1YFCA 2FRCA 3CXHW 5DJQB 5TJHA 3ZIYA 1SQBD 5KLIB 1CSUA 1H33B 3WC8A 2BGVX 4FA1A 3HQ9A 1CRYA 1BE3D 1C7MA 1I6EA 2XTSB 1GU2A 4QAOA 2QG4A 3PRJA 2BCNB 2LITA 1FI3A 2LIRA 1CIHA 2D0SA 4Y5RA 2PCBB 2N9YB 1M70A 3ZOWA 1NU1D 4UB8V 4AAOA 1EZVD 1DW0A 3ZCFA 1C6RA 4EIDA 1FJ0A 2N3BA 1DIIC 5B66V 3KHUA 2D0WA 1KB9D 2YCCA 4P4QB 1OCDA 3H1HD 1PPJD 2BH5X 2GC7D 1H31B 1C75A 2AI5A 1BCCD 4FAVA 1YIQA 3NWVA 2ORLA 3PXTA 2B11B 3H1JD 2HV4A 3L70D 1GIWA 4J20A 1CO6A 3VRDA 3H1KD 2V07A 3O1YA 2BLFB 2MHMA 1S6VB 2EXVA 1EB7A 2YK3A 3SXTA 1CTYA 1H32B 2PCCB 2CE0A 3ZBMA 2B4ZA 1AOFA 1QN2A 2FYUD 2DGEA 1CYIA 5C9MA 3OCDA 4PJ0V 5GTIV 1SQVD 5CIBB 3L71D 1ZZHA 1CYJA 351CA 2RN0A 3TF5A 4MU8A 4O1QA 1CNOA 1CSVA 1DVHA 2C8SA 2BCCD 3WFEC 1SQQD 1YEAA 2CA3B 1DIQC 2AIUA 2Y0CA 1NMIA 1BGYD 1RAQA 1CCHA 1CRJA 1CTZA 1IRVA 2K9JB 4AALA 4Q5PA 3CWBD 1CIEA 1KYOW 1M6ZA 3ORVA 3CX5W 2KS1A 2YIUB 4WQCA 3SVWA 2OZ1B 1H9YA 1LMSA 2C1UA 2JWAA 1E29A 1W5CT 1PP9D 2JTIB 1FCDC 1HCMA 4FA5A 1C6OA 1SQXD 3PXSA 1NMLA 1AKKA 1CSWA 3VMAA 2BH4X 2OZ1A 2GB8B 4PD4D 3RN0A 1CRIA 4EIEA 4N0KA 1H33A 1DW1A 1H1OA 3ITKA 3PTZA 1N9CA 3KZIV 1C2RA 5GTHV 5H2FV 3HQ7A 3RLMA 3TDKA 1QL4A 1HJ5A 5TISV 1JDLA 3DMIA 1L0LD 1RZ5A 4JCGA 1I8PA 1GJQA 4AAMA 1F1FA 1NTKD 1LFMA 3OA8B 1LC2A 1NTMD 2N18B 3MK7C 3O20A 2N9IA 3GG2A 2C1DB 2CE1A 2V08A 1HZVA 1QYZA 4V2KA 5CIDB 1BL9A 1A2SA 1RAPA 3M97X 3CXHD 3WFDC 1IRWA 1LS9A 1KV9A 4YE1A 3HQ8A 1YEBA 2N9JA 5CIEB 1HJ4A 5IY51 3OA8A 1CXCA 4WQBA 3TYIA 1A56A 3L73D 1H31A 1IO3A 1DW3A 2ZONG 3WU2V 2GC4D 1N50A 3RN1A 2ZBOA 1K3HA 2PACA 4H0KA 4WQEA 2L91A 5B5EV 2RMZA 1QL3A 1U75B 5KAIV 3ZOYA 1CSXA 2A06D 4WQDA 1QKSA 5KKZB 1H32A 1CIGA 1WEJF 3BCCD 4K3IA 5CYTR 3WUIA 2DVHA 1M60A 1HZUA 1YICA 5DJQC 3PLNA 2B10B 155CA 4KMGA 2O3JA 3ZOOA 3PH2B 4LJIA 1CXAA 3L75D 1SQPD 1GDVA 1RZ6A 3VYMA 2QJKB 3CYTI 1CC5A 4U3FD 2ZOOA 4GYDA 4L1QA 4EICA 1E2RA 2IBZD 4PW9B 1HROA 3L4MA 1KIBA 1FHBA 5CIFB 3NBTA 4PWAA 3DR0A 5B6QA 3H1ID 3PHLA 2C2CA 2C1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L9B C;  5DF5 A;  1COT A;  1DW2 A;  1YNR A;  1HJ3 A;  4XXL A;  1A8C A;  2B12 B;  4AAN A;  4UB6 V;  2QJP B;  3NBS A;  1L0N D;  1P84 D;  3H1L D;  2L4D A;  1DVV A;  3GW6 A;  1IZL 0;  4GED B;  3C2C A;  1R0Q A;  1DT1 A;  1I54 A;  1K3G A;  4WQ7 A;  1CCR A;  3L4O A;  2JQR A;  1J3S A;  1YTC A;  4IL6 V;  1CRC A;  3SLE A;  5CIC B;  3ZOX A;  4A7P A;  2CXB A;  3L74 D;  1OAE A;  1WVE C;  3A0B V;  3O0R C;  3TGU D;  4L3G A;  1CIF A;  4WQA A;  3CU4 A;  1F1C A;  4NFG B;  1CRG A;  4L3H A;  1AYG A;  1I55 A;  5CIG B;  1KX7 A;  1KYO D;  3CX5 D;  2FYN B;  4EDF A;  5KAF V;  1MG3 D;  1N90 A;  2FWL A;  1CYC A;  1HH7 A;  1FI9 A;  3HQ6 A;  1VYD A;  1I5T A;  2Y0E A;  3A0H V;  2C1D A;  1IQC A;  5E79 V;  1W2L A;  1B7V A;  451C A;  1ETP A;  2VHD A;  4WQ9 A;  4EIF A;  3DP5 A;  1I6D A;  2AXT V;  2Y0D A;  2CA4 B;  1COR A;  2GIW A;  3VNW A;  1ZRT D;  3WFB C;  4FAN A;  4O1W A;  3CP5 A;  5EXQ A;  2MTA C;  3JBT B;  5DFS A;  4D6T D;  4RJT A;  4H0J A;  1CED A;  2KNC B;  3RMZ A;  2B0Z B;  1L9J C;  1FI7 A;  3MK7 B;  3OCD B;  1C52 A;  2I8F A;  1MZ4 A;  1YCC A;  1LC1 A;  3SWS A;  1GQ1 A;  1CHI A;  5CIH B;  1KB0 A;  3PXW A;  4FA9 A;  1N15 A;  2ZXY A;  1AOQ A;  1GKS A;  1FOC A;  1E8E A;  3O5C A;  3A9F A;  3L72 D;  4FA4 A;  2N3Y A;  3FWL A;  1CHJ A;  3SJL A;  4DY9 A;  1S5L V;  4RSZ A;  1HRC A;  1NNO A;  1NTZ D;  1KX2 A;  1MG2 D;  1I8O A;  1CHH A;  1C6S A;  4AX3 A;  1H9X A;  5AUR A;  4FB1 A;  2C9X B;  4XYD B;  1C2N A;  1CRH A;  2BPB B;  1NIR A;  1U74 B;  2Q3E A;  5KLV D;  2ZZS 1;  4WQ8 A;  5C0Z A;  2N18 C;  2QJY B;  1CTJ A;  3WFC C;  2YQB A;  3X39 A;  1YFC A;  2FRC A;  3CXH W;  5DJQ B;  5TJH A;  3ZIY A;  1SQB D;  5KLI B;  1CSU A;  1H33 B;  3WC8 A;  2BGV X;  4FA1 A;  3HQ9 A;  1CRY A;  1BE3 D;  1C7M A;  1I6E A;  2XTS B;  1GU2 A;  4QAO A;  2QG4 A;  3PRJ A;  2BCN B;  2LIT A;  1FI3 A;  2LIR A;  1CIH A;  2D0S A;  4Y5R A;  2PCB B;  2N9Y B;  1M70 A;  3ZOW A;  1NU1 D;  4UB8 V;  4AAO A;  1EZV D;  1DW0 A;  3ZCF A;  1C6R A;  4EID A;  1FJ0 A;  2N3B A;  1DII C;  5B66 V;  3KHU A;  2D0W A;  1KB9 D;  2YCC A;  4P4Q B;  1OCD A;  3H1H D;  1PPJ D;  2BH5 X;  2GC7 D;  1H31 B;  1C75 A;  2AI5 A;  1BCC D;  4FAV A;  1YIQ A;  3NWV A;  2ORL A;  3PXT A;  2B11 B;  3H1J D;  2HV4 A;  3L70 D;  1GIW A;  4J20 A;  1CO6 A;  3VRD A;  3H1K D;  2V07 A;  3O1Y A;  2BLF B;  2MHM A;  1S6V B;  2EXV A;  1EB7 A;  2YK3 A;  3SXT A;  1CTY A;  1H32 B;  2PCC B;  2CE0 A;  3ZBM A;  2B4Z A;  1AOF A;  1QN2 A;  2FYU D;  2DGE A;  1CYI A;  5C9M A;  3OCD A;  4PJ0 V;  5GTI V;  1SQV D;  5CIB B;  3L71 D;  1ZZH A;  1CYJ A;  351C A;  2RN0 A;  3TF5 A;  4MU8 A;  4O1Q A;  1CNO A;  1CSV A;  1DVH A;  2C8S A;  2BCC D;  3WFE C;  1SQQ D;  1YEA A;  2CA3 B;  1DIQ C;  2AIU A;  2Y0C A;  1NMI A;  1BGY D;  1RAQ A;  1CCH A;  1CRJ A;  1CTZ A;  1IRV A;  2K9J B;  4AAL A;  4Q5P A;  3CWB D;  1CIE A;  1KYO W;  1M6Z A;  3ORV A;  3CX5 W;  2KS1 A;  2YIU B;  4WQC A;  3SVW A;  2OZ1 B;  1H9Y A;  1LMS A;  2C1U A;  2JWA A;  1E29 A;  1W5C T;  1PP9 D;  2JTI B;  1FCD C;  1HCM A;  4FA5 A;  1C6O A;  1SQX D;  3PXS A;  1NML A;  1AKK A;  1CSW A;  3VMA A;  2BH4 X;  2OZ1 A;  2GB8 B;  4PD4 D;  3RN0 A;  1CRI A;  4EIE A;  4N0K A;  1H33 A;  1DW1 A;  1H1O A;  3ITK A;  3PTZ A;  1N9C A;  3KZI V;  1C2R A;  5GTH V;  5H2F V;  3HQ7 A;  3RLM A;  3TDK A;  1QL4 A;  1HJ5 A;  5TIS V;  1JDL A;  3DMI A;  1L0L D;  1RZ5 A;  4JCG A;  1I8P A;  1GJQ A;  4AAM A;  1F1F A;  1NTK D;  1LFM A;  3OA8 B;  1LC2 A;  1NTM D;  2N18 B;  3MK7 C;  3O20 A;  2N9I A;  3GG2 A;  2C1D B;  2CE1 A;  2V08 A;  1HZV A;  1QYZ A;  4V2K A;  5CID B;  1BL9 A;  1A2S A;  1RAP A;  3M97 X;  3CXH D;  3WFD C;  1IRW A;  1LS9 A;  1KV9 A;  4YE1 A;  3HQ8 A;  1YEB A;  2N9J A;  5CIE B;  1HJ4 A;  5IY5 1;  3OA8 A;  1CXC A;  4WQB A;  3TYI A;  1A56 A;  3L73 D;  1H31 A;  1IO3 A;  1DW3 A;  2ZON G;  3WU2 V;  2GC4 D;  1N50 A;  3RN1 A;  2ZBO A;  1K3H A;  2PAC A;  4H0K A;  4WQE A;  2L91 A;  5B5E V;  2RMZ A;  1QL3 A;  1U75 B;  5KAI V;  3ZOY A;  1CSX A;  2A06 D;  4WQD A;  1QKS A;  5KKZ B;  1H32 A;  1CIG A;  1WEJ F;  3BCC D;  4K3I A;  5CYT R;  3WUI A;  2DVH A;  1M60 A;  1HZU A;  1YIC A;  5DJQ C;  3PLN A;  2B10 B;  155C A;  4KMG A;  2O3J A;  3ZOO A;  3PH2 B;  4LJI A;  1CXA A;  3L75 D;  1SQP D;  1GDV A;  1RZ6 A;  3VYM A;  2QJK B;  3CYT I;  1CC5 A;  4U3F D;  2ZOO A;  4GYD A;  4L1Q A;  4EIC A;  1E2R A;  2IBZ D;  4PW9 B;  1HRO A;  3L4M A;  1KIB A;  1FHB A;  5CIF B;  3NBT A;  4PWA A;  3DR0 A;  5B6Q A;  3H1I D;  3PHL A;  2C2C A;  2C1V A; 
#chains in the Genus database with same CATH topology
 2LKM A;  2BCC J;  3P7K A;  1NU1 G;  1R5S A;  2UWJ E;  1KIL E;  3B5N D;  1OWA A;  4RKU J;  1DW2 A;  2AXC A;  2K9J A;  3CPW O;  4AAN A;  4W7Y A;  1P84 D;  2KOG A;  1L2P A;  3GW6 A;  5CCG D;  3C2C A;  1R0Q A;  3H1H G;  2J58 A;  2GUS A;  2P1J A;  1VL2 A;  3A0B H;  1E79 H;  2J59 M;  3H1I J;  3SFE C;  4A7P A;  2A45 H;  2CXB A;  3RBX A;  2ZAE B;  1OAE A;  3A0B V;  2M5A B;  1FZC B;  1SQX J;  4WWI A;  5KAF H;  3L73 G;  1SFC A;  4N3Y B;  2W83 C;  1SFC D;  1RF1 C;  4IOI H;  3E1R A;  3IN6 A;  1SQX E;  3CX5 D;  3MP7 B;  3JCU H;  4EDF A;  5KAF V;  1J1D B;  1HH7 A;  1FI9 A;  3HQ6 A;  1LTJ C;  1AQ5 A;  1GW3 A;  1I5T A;  2Y0E A;  1SLQ A;  1RQU A;  451C A;  4JYB A;  4YXW H;  1YJ9 P;  4WQ9 A;  4EIF A;  1N86 A;  3GMA A;  1GZL A;  1T2K D;  2CA4 B;  2HFE D;  5AVX B;  3WFB C;  4O1W A;  1GMJ A;  1NTK E;  1CW5 A;  4D6T D;  3AEF C;  1IFN A;  1CED A;  1CZQ A;  2CK3 H;  1H8A A;  2AEM A;  1MZ4 A;  5B66 E;  2I1J A;  5CIH B;  3PXW A;  2ZXY A;  3L73 E;  4JQ0 D;  1JM0 A;  1SQB K;  4FA4 A;  1G1I A;  3VP9 A;  3FWL A;  1YQ4 C;  1DH3 A;  1CHJ A;  1N73 A;  4Y28 J;  2Q7C A;  4H13 D;  3G3Z A;  1CHH A;  3RL0 D;  1LTA C;  2C9X B;  1C2N A;  2R3C A;  3PP5 A;  2WPV B;  1U74 B;  1SQP J;  2Q3E A;  5KLV D;  1NKZ B;  4YXD C;  1L0L G;  2QJY B;  2YQB A;  3X39 A;  4BWN A;  1DD4 A;  1Q7Y Q;  1URQ B;  1SQB D;  1NTM K;  3L75 E;  5GTI E;  1SQP E;  1H33 B;  4LC1 A;  3M91 A;  1VQK P;  3G71 P;  3SFD C;  4FA1 A;  3HQ9 A;  1BE3 D;  3AEE C;  1FC2 C;  1N7S C;  1HUC A;  1I6E A;  2D2C C;  3O8Z A;  2XTS B;  1OMI A;  1GU2 A;  4QAO A;  2QG4 A;  3G9R A;  4GDO A;  4WY4 D;  5B66 H;  4M3L A;  1L0N J;  3RK3 E;  1DEB A;  1DW0 A;  1GW4 A;  1FJ0 A;  4YPC A;  5B66 V;  1L0N E;  2YCC A;  4XA4 A;  1YQ3 C;  3E7K A;  1HJ0 A;  1H31 B;  5AW5 B;  2I8D A;  1M1J B;  3CLQ A;  3PXT A;  2W6J H;  1PFI A;  2JR8 A;  1L4A A;  3TGU E;  2WTY A;  4UB8 E;  3H1K D;  1MV8 A;  3B5N C;  2BLF B;  2O1K A;  4WVZ A;  5TIS E;  2V7Q J;  1OW8 A;  3NMD A;  2WSC J;  1H32 B;  3VMZ A;  4U3F G;  4EIJ A;  1KYO E;  3BVH A;  1FDI A;  1HWT C;  2CE0 A;  3OW2 O;  2B4Z A;  5CCG C;  2QIW A;  3GLM A;  1IFD A;  2IYO A;  2JKV A;  3NTN A;  3H1J J;  5C39 A;  3VYI A;  2YMK A;  2HR3 A;  4W7Z A;  3L70 J;  5GTI V;  1KIL D;  1QX8 A;  1ZZH A;  1CYJ A;  3TF5 A;  1NWQ A;  1D7M A;  2WIT A;  4WBA A;  1DVH A;  4ZKU A;  2BCC D;  3QWO C;  2QEX P;  1VF5 D;  1EDK A;  2HLO A;  3RL0 g;  2YNY A;  1T3U A;  1DIQ C;  1PGP A;  3M0A A;  2FYU J;  2M3E A;  1ZW0 A;  5AVR B;  2V4H A;  3TYY A;  1OX3 A;  1IRV A;  2K9J B;  1CIE A;  1RE4 C;  1M6Z A;  3ORV A;  3CX5 W;  4WQC A;  2VRS A;  3SVW A;  1LMS A;  5BVZ A;  1VQ8 P;  1T2K C;  1E29 A;  4ZKP A;  2YO3 A;  4KHX A;  3TNU A;  1IZN B;  1EZV G;  2WVR A;  3CME P;  4FA5 A;  1SQX D;  1IFM A;  3V2P A;  2KUB A;  1YJW P;  3HE4 A;  1FZF A;  2GUV A;  4IL6 H;  3RN0 A;  1KYO H;  3JSV C;  1H1O A;  1VQ4 P;  1N9C A;  3CWB J;  5AW6 B;  3I55 P;  1C2R A;  1K8A Q;  1VQ7 P;  2E75 B;  2YO2 A;  2V7Q H;  1QL4 A;  5TIS V;  3H6P A;  3CCS P;  1GL2 B;  2WSC H;  2OAR A;  1UII A;  3DMI A;  1RZ5 A;  2G8Y A;  3L36 A;  2FBW C;  1NTK D;  2WSF J;  1S1C X;  1FOS F;  3OA8 B;  3MK7 C;  2M0B A;  2N9I A;  3GG2 A;  1AQT A;  1NYH A;  3D0W A;  1QYZ A;  2WSS H;  3CMA P;  1UIX A;  1BL9 A;  1KV9 A;  4YE1 A;  2YXQ B;  1R8E A;  1A56 A;  3R4Y A;  3L73 D;  3RL0 C;  2PRR A;  2KXP B;  3RK2 B;  5H2F E;  1JY2 P;  3AE6 C;  1EZV E;  1RF0 C;  1N50 A;  4H0L B;  1WMK A;  1KB9 E;  2ZYD A;  3K5B A;  2E5Y A;  2L91 A;  2C0W A;  4K3A A;  1KTM A;  3N4X A;  1PPJ E;  1IFJ A;  1S2E A;  3FGA D;  1KQG B;  4WQD A;  2R44 A;  1KYO I;  3AEG C;  1PL5 A;  4GOD A;  1RF1 A;  4WY4 C;  1HZU A;  1YIC A;  5DJQ C;  4KJM A;  5KLV G;  3B8E B;  2O1J A;  1MUU A;  1YIT P;  5E79 E;  1N73 B;  2BEZ F;  1LTJ A;  1HJB A;  1BDC A;  1GU4 A;  3L75 D;  2Q9I A;  1SQP D;  1GDV A;  4IL6 X;  3V6I A;  5AVZ B;  1KMI Z;  1SQB G;  2QJK B;  2HG5 D;  2E43 A;  1CC5 A;  3GHG C;  2OTK E;  1CSB A;  1QEX A;  4HH2 A;  4PW9 B;  3L4M A;  1USD A;  3L71 J;  4OH8 B;  2WSF H;  4C7N A;  3RK3 D;  1IC2 A;  2C2C A;  5DF5 A;  3L71 E;  1LNQ A;  2B12 B;  2QJP B;  1AVY A;  1L0N D;  2IYP A;  1DVV A;  5AVT B;  3KDP B;  2LR2 A;  2PP6 A;  1S9K E;  1I54 A;  1KB9 H;  1KQF B;  3L4O A;  2JQR A;  1YTC A;  3HE5 B;  5CIC B;  2OYO A;  2IPP A;  1PP9 J;  1J1E C;  3GF3 A;  1WVE C;  3TGU D;  2QM8 A;  4L3G A;  1CIF A;  1KIL C;  3AE5 C;  3HUS B;  3CU4 A;  3H1K G;  1F1C A;  1XTG B;  1JMM A;  5E79 H;  3AE2 C;  1CRG A;  3IAO A;  1KYO D;  2WQY C;  1QVF O;  2FYN B;  2FWL A;  5KTB A;  3CCJ P;  1KQL A;  2PGD A;  4NPE A;  5KKZ C;  3GF7 A;  2R3S A;  5E79 V;  1PZQ A;  1L4A B;  2Q6Q A;  1H0T A;  1Y9B A;  2FYU K;  4DCK A;  1B7V A;  2A06 G;  1G2C A;  3AED C;  1NTM J;  1I6D A;  1Q90 D;  2Y0D A;  3VNW A;  4ASW A;  2YKP A;  2WZ7 A;  1ZME C;  1S3J A;  1N7S A;  3WUV A;  3CP5 A;  2MTA C;  5EFW B;  4L76 A;  4GT1 A;  2BCC G;  1NTM E;  2HPC A;  2E74 D;  3RMZ A;  3AE3 C;  1FI7 A;  1OXZ A;  5KAF E;  1KB9 I;  1NJI Q;  3CXH E;  3I56 P;  4TLF A;  1WT6 A;  1GK4 A;  2YIU C;  3SWS A;  2IBZ G;  1GQ1 A;  1ZOY C;  1R5L A;  1KB0 A;  4FA9 A;  3HD7 D;  2XNX A;  1E8E A;  5AVU B;  3I5C A;  1JMB A;  2N3Y A;  1T3J A;  4R4L A;  1SQX G;  4CPG A;  1AV1 A;  2BEQ D;  4RSZ A;  2W6A A;  1HRC A;  2MJZ A;  1NNO A;  1A02 J;  1KX2 A;  2QM7 A;  2A06 E;  1I8O A;  1C6S A;  3B5N A;  1OW7 A;  2LXB A;  3KQG A;  2P10 A;  2WPR A;  3TNU B;  1CRH A;  1NIR A;  1SP4 A;  4WQ8 A;  2QSI A;  1CTJ A;  1T8Z A;  4N6J A;  3D70 A;  3HE4 B;  1NKN A;  3CCL P;  2BCC E;  5CCG A;  1NTK G;  4DJG A;  1LTT C;  5TJH A;  3PJS K;  1KZU B;  1JY3 P;  1NTZ J;  3VTP C;  1CRY A;  2NPS D;  1FDO A;  3AE9 C;  4L73 A;  2IBZ E;  2JO1 A;  2Y9Z A;  1PGO A;  1CIH A;  1VQ6 P;  2D0S A;  2PCB B;  3CXH H;  5CJ0 A;  4PV1 D;  1M70 A;  3CL3 D;  3ZOW A;  3H1I E;  3G4S P;  1H89 A;  4AAO A;  5AW8 B;  2WWW A;  1EZV D;  1Q2N A;  2E76 B;  2KSJ A;  1VQN P;  2N3B A;  1DII C;  2D0W A;  1KB9 D;  1KOR A;  1Q81 Q;  3SWF A;  1PPJ D;  1JY2 N;  1RE4 A;  2GC7 D;  3OA7 A;  5KJ7 D;  3CCE P;  3KXD A;  1PIX A;  1H88 A;  1VQ9 P;  1NU1 J;  3NWV A;  2ORL A;  1VQO P;  5K5G B;  4L74 A;  3RK3 C;  1MZ9 A;  1CO6 A;  2GM4 A;  4HJG H;  3G6E P;  2OYH B;  1BDD A;  1JY2 O;  1IFP A;  4OGQ D;  2Q5U A;  2EXV A;  3L75 G;  3O6Q B;  1SQP G;  3SXT A;  4MN4 C;  3Q3D A;  2PCC B;  4PJ0 H;  3ZBM A;  1RF1 B;  4BRY A;  4Y99 B;  3L37 A;  5APV A;  4Z1M H;  1JEK A;  3VOP A;  1KFN A;  1LP1 A;  4TT3 H;  2DGE A;  1CYI A;  1LTJ B;  3OCD A;  2A45 I;  1LTS C;  4PJ0 V;  4JF7 A;  4AUW A;  3CXH I;  3L71 D;  351C A;  2XND H;  2OQQ A;  1ZRT E;  4O1Q A;  4I7Z C;  1L0N G;  2P7J A;  2CA3 B;  2FYZ A;  1S9K D;  1E5W A;  1HGZ A;  4C7N B;  1NMI A;  4GOF A;  3V5B A;  3AE4 C;  4LLH A;  1JUN A;  2W27 A;  1HVV A;  3BRV B;  2FFD C;  1SQV J;  1OW6 A;  4Q5P A;  1KYO W;  2OZ1 B;  3TGU G;  2K37 A;  1PP9 D;  1FCD C;  5AW2 B;  1K73 Q;  1C6O A;  1NML A;  2PAJ A;  4WY4 A;  1CSW A;  3AEB C;  4B86 A;  2E74 C;  2GB8 B;  4N0K A;  3ITK A;  1FZE A;  4L75 A;  5APT A;  2FXM A;  3TK1 A;  1ZV8 A;  1M1J C;  2IBZ I;  3GHG A;  1JDL A;  3EWK A;  3HD7 C;  4EYY Q;  3LW5 J;  3S1K A;  3IR9 A;  3IFM A;  2KYV A;  3S9O A;  3H1J G;  3L70 G;  1NTM D;  1VDF A;  2WPS A;  2ZT9 D;  5CCH D;  3O20 A;  5CBO A;  1FZA A;  1AVO A;  1G2C B;  1QL2 A;  2JJL A;  1A2S A;  1RAP A;  1W2E A;  3WFD C;  3CXH D;  1IRW A;  3Q5P A;  3HQ8 A;  1YEB A;  3A3Y B;  1N7S B;  1KQS O;  2D2C B;  1L0L J;  2FYU G;  5CBN A;  3CI9 A;  5CJ4 A;  2HOD A;  3T97 A;  3H32 A;  5KAI H;  3A7O A;  4IL6 E;  4HB1 A;  3RN1 A;  2O01 J;  1BCC J;  3AE7 C;  1U75 B;  5KAI V;  3ZOY A;  1NTZ K;  2A06 D;  2N1T D;  4JYC A;  4IFD K;  1KIL A;  1QKS A;  2NPS C;  2G3A A;  1MFZ A;  1BCC E;  1NAF A;  1WEJ F;  3SWK A;  4K3I A;  5BU8 B;  2DVH A;  3H1J E;  3M9H A;  1QLE D;  1AFO A;  1DEE G;  3P8C E;  3L70 E;  4PV1 C;  5KLI C;  3CWB G;  3ZOO A;  1CXA A;  1RZ6 A;  1CI6 A;  4WB4 A;  3CYT I;  3B5N B;  4GYD A;  4L1Q A;  1LWU C;  4QMA A;  3C1L A;  1E2R A;  1PV3 A;  4H44 B;  2IBZ D;  1M1K Q;  1FHB A;  1KC8 Q;  3NBT A;  1NOH A;  3LW5 H;  4PWA A;  1W2B O;  3BCC J;  2FYU E;  3P32 A;  5KJ7 C;  3EFF K;  3H1I D;  1JY3 N;  1GL2 C;  5M1B A;  3C8V A;  2OYI C;  1NU1 K;  1SQQ J;  2JEE A;  2Q3I A;  3V2Q A;  1GK6 A;  1FDM A;  3NBS A;  3RBZ A;  1BGY J;  2KLV A;  5CMZ A;  3UIA A;  4C7R A;  1SQQ E;  4OGQ C;  1IZL 0;  4GED B;  1DT1 A;  1PPJ G;  1K3G A;  3MHV A;  4WQ7 A;  1JY3 O;  5APQ A;  1SFC B;  1BGY E;  1J3S A;  4IL6 V;  5APU A;  2ZYA A;  1S5L E;  1QGK B;  1X0T A;  3ZOX A;  1HF9 A;  2O01 H;  3RK2 C;  3CWB E;  2W6B A;  2RKL A;  1JTH A;  3A0H H;  1KV4 A;  4NFG B;  4H0L C;  1I55 A;  5CIG B;  3BAS A;  2B87 A;  1CYC A;  3A0H V;  2KLU A;  2ZXE B;  2IZ0 A;  1W2L A;  1FBM A;  3N7N A;  3DP5 A;  3MGN A;  2IDB A;  1SQV K;  2YKQ A;  3L71 G;  1ZRT D;  4FAN A;  5EXQ A;  3QH9 A;  3RGU A;  1M57 D;  2YMY A;  2B88 A;  4BRY B;  3JBT B;  3S4R A;  2MKV A;  5DFS A;  1YTZ I;  4RJT A;  2QJK C;  3WUT A;  1LP1 B;  2FXO A;  1BSN A;  2GA1 A;  2B0Z B;  1L9J C;  3MK7 B;  3OCD B;  1C52 A;  1YCC A;  2L5G B;  5AW9 B;  1LC1 A;  2Q1K A;  1N15 A;  4RO0 A;  1DX7 A;  2K3R A;  3C9I A;  3KYQ A;  1AOQ A;  1ZN5 A;  1GKS A;  4H13 B;  4LGD E;  1S5L H;  1GDT A;  3RL0 B;  5APY A;  4D6T J;  2QJP C;  3BAT A;  1PP9 G;  1U57 A;  2M3B A;  1S5L V;  2ZT9 C;  2QE7 H;  5CCH C;  3V2R A;  5AW7 B;  4O9B A;  1LTG C;  1USE A;  3Q1M A;  1YI2 P;  4YTP C;  2BAS A;  3HTK A;  4GKG A;  1P84 H;  4AX3 A;  1H9X A;  5AUR A;  2RH0 A;  2BPB B;  1IK7 A;  1EDL A;  1FJK A;  2ZZS 1;  1XTC C;  4JPZ B;  5APW A;  4XFJ A;  2N18 C;  3MUD C;  1L0L K;  1W5C E;  3HUS C;  4WY4 B;  2FRC A;  3CXH W;  5DJQ B;  1EDI A;  1NTM G;  1OIP A;  2OTJ P;  1CSU A;  2OGU A;  3WC8 A;  2BGV X;  2A45 G;  2WPQ A;  2E42 A;  1NHL A;  3AEC C;  2KZI A;  1FI3 A;  2LIR A;  2JDI H;  2N1T C;  3TSI A;  2ZXX A;  4Y5R A;  5KLV J;  1URQ D;  1VQM P;  3H1L J;  2FY8 A;  4NPF X;  3AE8 C;  1FJP A;  2QRX A;  3ZCF A;  1PP9 E;  1QVG O;  1C6R A;  3CC2 P;  3V4W A;  2FKW B;  3KHU A;  1YIJ P;  3H1L E;  3WMM 0;  1KD1 Q;  2FFD A;  1OCD A;  5AW0 B;  1BE3 J;  2BH5 X;  1N7L A;  2IFM A;  2H43 A;  1PGQ A;  3A2A A;  3M9Q A;  3OAK A;  1NAY A;  2KIK A;  3L74 J;  1C75 A;  2HOD B;  1VQ5 P;  3T97 B;  1S5L X;  2AI5 A;  1BCC D;  3JC2 2;  3V4Q A;  1YIQ A;  3IF4 A;  4R4M A;  4ZNC A;  2B11 B;  3H1J D;  3Q5R A;  2HV4 A;  3P8C D;  3L70 D;  3L74 E;  2V07 A;  1SQQ K;  3O1Y A;  3A5T A;  2ITA A;  1K04 A;  1LT9 C;  1KIL B;  3CCU P;  4BXL A;  1S72 P;  1M1J A;  4N78 E;  1K05 A;  1BSH A;  5APX A;  1OVU A;  3P8M C;  1EXJ A;  3HD7 A;  1U7J A;  3E1I A;  1QN2 A;  2FYU D;  2KNC A;  5C9M A;  2ZJS E;  1VF5 B;  1NTZ G;  3MZW B;  3D6Z A;  3H1I G;  5CIB B;  3H1K J;  2RN0 A;  4MU8 A;  1CNO A;  1CSV A;  5CHX A;  2C8S A;  2QVA A;  4U7J A;  1SQQ D;  4XE5 B;  3CCQ P;  3D6Y A;  2Y0C A;  2M8R A;  1BGY D;  4JBZ A;  2IZ1 A;  2KSE A;  1FZC C;  3PH0 A;  3L72 J;  1CTZ A;  5B5E E;  1FOS E;  3CWB D;  2ZFC A;  4DT0 A;  4ASV A;  2ZVO B;  3CD6 P;  2KS1 A;  2YIU B;  4PJ0 E;  2P67 A;  3U1A A;  2JWA A;  4EI2 A;  3L72 E;  2NPS A;  1J1D C;  1NVO A;  3B71 A;  3KZI H;  3PXS A;  2WT7 A;  2ZYG A;  4H44 D;  1AKK A;  2C9L Y;  1CRI A;  4EIE A;  1NTZ E;  1Z56 A;  1DW1 A;  3PTZ A;  5AW1 B;  1Y8A A;  3KZI V;  2N9B A;  3MTU E;  3RLM A;  1JTH B;  3KPE A;  1LWU A;  1I8P A;  1OZH A;  3OJA B;  1RY3 A;  1GJQ A;  2OYH C;  1F1F A;  2B87 B;  1LFM A;  1LC2 A;  5KJ7 A;  2CE1 A;  3VN0 A;  2V08 A;  2E75 D;  1GL2 A;  1JO5 A;  4W80 A;  3LID A;  2OYI A;  1GL2 D;  4UB6 E;  4Y99 C;  4RES B;  4V2K A;  5CID B;  1LS9 A;  4NPD A;  3WU2 H;  5CIE B;  3OA8 A;  4DZO A;  1IFI A;  3AEA C;  1MFT A;  5APS A;  2YKO A;  1RE3 C;  1NU1 E;  1NTK J;  5B5E H;  1M7L A;  5AW3 B;  1DW3 A;  3H1H J;  2XDJ A;  3WU2 V;  1SQV G;  5AVQ B;  2ZBO A;  1K3H A;  2PAC A;  1HTL C;  5B5E V;  2RMZ A;  1QL3 A;  3H1H E;  3RK2 D;  2JP3 A;  3L73 J;  1YYC A;  4K35 A;  2QJY C;  3L4F A;  4H0L D;  3WUI A;  1M60 A;  3PLN A;  1URQ C;  5KLV K;  2B10 B;  1SS1 A;  2AEJ A;  4KMG A;  3PH2 B;  4LJI A;  3RK3 B;  3VYM A;  3HTK B;  2AXT E;  2K1A A;  4AQR D;  2ZOO A;  4OVN F;  1RQV A;  1RF0 A;  1LT1 A;  1KIB A;  5CIF B;  5KAI E;  4UB6 H;  2XV5 A;  1FAV A;  3DR0 A;  5B6Q A;  4IFM A;  2C1V A;  3FXD A;  1L9B C;  1SQV E;  3FXE A;  1COT A;  1KN7 A;  3L75 J;  1YNR A;  3CCV P;  1HJ3 A;  4XXL A;  1A8C A;  1KFM A;  4UB6 V;  3H1L D;  3CC4 P;  2L4D A;  4I7Z B;  2E5T A;  1CCR A;  3V2N A;  4KT0 J;  1CRC A;  3SLE A;  1BCC G;  3F5H A;  1JCC A;  3L74 D;  4ZMD A;  3O0R C;  2XZR A;  5CCH A;  2FFD B;  3M0D C;  4C46 A;  4WQA A;  2CPB A;  1H0T B;  3ZDM A;  2H89 C;  3HE5 A;  4N78 D;  4L3H A;  1AYG A;  1KX7 A;  1MG3 D;  1N90 A;  1X8Y A;  1X79 B;  2AXT H;  1VYD A;  3MUD A;  4PD4 E;  4HKZ H;  1X9V A;  3HUS A;  1LTI C;  2C1D A;  3ABV C;  1IQC A;  4DOJ A;  2Z5I A;  2E74 B;  1ETP A;  2VHD A;  3EFG A;  2HPC B;  3M9B A;  3TGU J;  1Y47 A;  2IX7 C;  3F89 A;  2AXT V;  2GIW A;  1COR A;  1L0L E;  3BCC G;  1YTZ T;  3H25 A;  4AYC A;  3HD7 B;  1GD2 E;  1L4A D;  2N1T A;  2HYN A;  1SQQ G;  2B9B A;  4H0J A;  2AEF A;  2KNC B;  1VPC A;  3CCR P;  2I8F A;  4H44 C;  1BGY G;  2YXR B;  3NXS A;  1AA0 A;  5GTI H;  1YJN P;  1CHI A;  3A0H E;  1OVR A;  1DIP A;  1SVF A;  1FOC A;  3O5C A;  1JOC A;  3A9F A;  3L72 D;  2PFX A;  4IFF A;  3CC7 P;  3B4S A;  2QA4 P;  1SQX K;  3SJL A;  4DY9 A;  1DD3 A;  1Q86 Q;  1NTZ D;  1TU3 F;  1SFC C;  2E75 C;  2K88 A;  2KS1 B;  1MG2 D;  4FB1 A;  1LJ2 A;  1VQL P;  4XYD B;  4PD4 H;  1LT9 A;  2XU6 A;  3BCC E;  2NPS B;  3FX0 A;  1JCD A;  1Q82 Q;  2P2U A;  5C0Z A;  2WT7 B;  4U3F J;  3WFC C;  1ZP0 C;  2Z4E A;  3R2P A;  1YFC A;  1NTK K;  4HYT B;  1T6A A;  1U7M A;  3ZIY A;  4PV1 B;  5KLI B;  1ZLL A;  1OVV A;  1FE6 A;  4U3F E;  2POH A;  3II6 A;  4UB8 H;  1C7M A;  1NGM B;  5AVY B;  5TIS H;  1LWU B;  3PRJ A;  1JB0 J;  2BCN B;  2LIT A;  3MD0 A;  1X22 A;  2N9Y B;  1IJD B;  1NU1 D;  4UB8 V;  3U1C A;  3SSU A;  3D71 A;  4EID A;  2OYI B;  2JWD A;  1P84 E;  2M5A A;  1FZC A;  2B89 A;  2WSE J;  4P4Q B;  1A02 F;  3CCM P;  2R5D A;  3H1H D;  3Q2Y A;  2H7H A;  4D6T G;  1RHZ B;  5AVS B;  1EQ7 A;  1FZB A;  4GIF A;  4OGQ B;  2E76 D;  2O01 N;  4FAV A;  1NO4 A;  2R5B A;  1N73 C;  2IFN A;  4PD4 I;  3U59 A;  4H13 C;  1GIW A;  4J20 A;  3VRD A;  1S4X A;  2MHM A;  5GTH E;  1S6V B;  2YK3 A;  1EB7 A;  3MIW A;  1SQP K;  1GTW A;  1CTY A;  1AJY A;  3CX5 E;  2NZ2 A;  3VP8 A;  1IO4 A;  1AOF A;  2OYH A;  1JNM A;  3O6Q A;  5DJT B;  1SQV D;  2Z5H A;  3W67 A;  3VMX A;  4I1L A;  1FS0 E;  5AW4 B;  1J2J B;  3WUU A;  1L0N K;  3H1L G;  3HRN A;  3WFE C;  4D6T E;  1YEA A;  1FU1 A;  2XKM A;  2AIU A;  1RE3 A;  1VQP P;  1M90 Q;  1RAQ A;  1CCH A;  1CRJ A;  5AVW B;  1BE3 G;  1NH4 A;  3USS A;  4AAL A;  1HH0 A;  2DW3 A;  2WSE H;  2KZJ A;  3LIE A;  3L74 G;  2OTL P;  1LGH B;  1H9Y A;  2ZVN B;  2C9N Y;  2C1U A;  2W8Z A;  2WMM A;  1W5C T;  2FYN C;  2JTI B;  4EOT A;  1HCM A;  2H8P D;  5GTH H;  3GHG B;  5H2F H;  1G1J A;  1K9M Q;  1YBK A;  1L4A C;  3VMA A;  2BH4 X;  1URQ A;  2OZ1 A;  1RH5 B;  4PD4 D;  3CX5 H;  1H33 A;  2KP8 A;  2ZT9 B;  1ZR2 A;  2W90 A;  2SPZ A;  3AE1 C;  1HBW A;  5GTH V;  5H2F V;  3HQ7 A;  3TDK A;  3W68 A;  1EDJ A;  1HJ5 A;  1SQB J;  1LTB C;  2NRG A;  1L0L D;  4JCG A;  5KLV E;  1N8R Q;  4AAM A;  4OWF A;  1OFC X;  1EC5 A;  2N18 B;  1SQB E;  2C1D B;  1HZV A;  2LXC B;  1QL1 A;  3H32 B;  3NFQ A;  1P84 I;  1BE3 E;  3M97 X;  5DJU B;  2N9J A;  5AVV B;  1HJ4 A;  5IY5 1;  1VF5 C;  1CXC A;  4WQB A;  3EQ2 A;  3TYI A;  1EXI A;  2R32 A;  1YHQ P;  1GU5 A;  1H31 A;  1IO3 A;  3L35 A;  1J1E B;  3KZI E;  4I2L C;  2KB7 P;  1WRG A;  2N1T B;  2ZON G;  2J5U A;  3L72 G;  1ZXG A;  1HGV A;  2GC4 D;  3BRT B;  2FXP A;  5L8R J;  3FWN A;  4GOE A;  3A0B E;  4H0K A;  4WQE A;  1N7S D;  2D2C D;  3VMY A;  1CSX A;  1N2D C;  3M0D A;  1EZV I;  5KKZ B;  1H32 A;  1M56 D;  3CX5 I;  1MKM A;  2KI7 B;  1CIG A;  1CI6 B;  3BCC D;  1ZR4 A;  5CYT R;  2Y9Y A;  1M8O B;  1FZG A;  155C A;  2KK7 A;  2H88 C;  2K9Y A;  2O3J A;  4I6M C;  3H1K E;  5BU5 A;  3JCU E;  3WU2 E;  3M06 A;  2C0X A;  2CPS A;  1IK9 A;  4U3F D;  2I1K A;  4EIC A;  3SWY A;  1LT9 B;  3Q5S A;  1HRO A;  1PGJ A;  2P58 A;  3PHL A;  2E76 C; 
#chains in the Genus database with same CATH homology
 1L9B C;  5DF5 A;  1COT A;  1DW2 A;  1YNR A;  1HJ3 A;  4XXL A;  1A8C A;  2B12 B;  4AAN A;  4UB6 V;  2QJP B;  3NBS A;  1L0N D;  1P84 D;  3H1L D;  2L4D A;  1DVV A;  3GW6 A;  1IZL 0;  4GED B;  3C2C A;  1R0Q A;  1DT1 A;  1I54 A;  1K3G A;  4WQ7 A;  1CCR A;  3L4O A;  2JQR A;  1J3S A;  1YTC A;  4IL6 V;  1CRC A;  3SLE A;  5CIC B;  3ZOX A;  4A7P A;  2CXB A;  3L74 D;  1OAE A;  1WVE C;  3A0B V;  3O0R C;  3TGU D;  4L3G A;  1CIF A;  4WQA A;  3CU4 A;  1F1C A;  4NFG B;  1CRG A;  4L3H A;  1AYG A;  1I55 A;  5CIG B;  1KX7 A;  1KYO D;  3CX5 D;  2FYN B;  4EDF A;  5KAF V;  1MG3 D;  1N90 A;  2FWL A;  1CYC A;  1HH7 A;  1FI9 A;  3HQ6 A;  1VYD A;  1I5T A;  2Y0E A;  3A0H V;  2C1D A;  1IQC A;  5E79 V;  1W2L A;  1B7V A;  451C A;  1ETP A;  2VHD A;  4WQ9 A;  4EIF A;  3DP5 A;  1I6D A;  2AXT V;  2Y0D A;  2CA4 B;  1COR A;  2GIW A;  3VNW A;  1ZRT D;  3WFB C;  4FAN A;  4O1W A;  3CP5 A;  5EXQ A;  2MTA C;  3JBT B;  5DFS A;  4D6T D;  4RJT A;  4H0J A;  1CED A;  2KNC B;  3RMZ A;  2B0Z B;  1L9J C;  1FI7 A;  3MK7 B;  3OCD B;  1C52 A;  2I8F A;  1MZ4 A;  1YCC A;  1LC1 A;  3SWS A;  1GQ1 A;  1CHI A;  5CIH B;  1KB0 A;  3PXW A;  4FA9 A;  1N15 A;  2ZXY A;  1AOQ A;  1GKS A;  1FOC A;  1E8E A;  3O5C A;  3A9F A;  3L72 D;  4FA4 A;  2N3Y A;  3FWL A;  1CHJ A;  3SJL A;  4DY9 A;  1S5L V;  4RSZ A;  1HRC A;  1NNO A;  1NTZ D;  1KX2 A;  1MG2 D;  1I8O A;  1CHH A;  1C6S A;  4AX3 A;  1H9X A;  5AUR A;  4FB1 A;  2C9X B;  4XYD B;  1C2N A;  1CRH A;  2BPB B;  1NIR A;  1U74 B;  2Q3E A;  5KLV D;  2ZZS 1;  4WQ8 A;  5C0Z A;  2N18 C;  2QJY B;  1CTJ A;  3WFC C;  2YQB A;  3X39 A;  1YFC A;  2FRC A;  3CXH W;  5DJQ B;  5TJH A;  3ZIY A;  1SQB D;  5KLI B;  1CSU A;  1H33 B;  3WC8 A;  2BGV X;  4FA1 A;  3HQ9 A;  1CRY A;  1BE3 D;  1C7M A;  1I6E A;  2XTS B;  1GU2 A;  4QAO A;  2QG4 A;  3PRJ A;  2BCN B;  2LIT A;  1FI3 A;  2LIR A;  1CIH A;  2D0S A;  4Y5R A;  2PCB B;  2N9Y B;  1M70 A;  3ZOW A;  1NU1 D;  4UB8 V;  4AAO A;  1EZV D;  1DW0 A;  3ZCF A;  1C6R A;  4EID A;  1FJ0 A;  2N3B A;  1DII C;  5B66 V;  3KHU A;  2D0W A;  1KB9 D;  2YCC A;  4P4Q B;  1OCD A;  3H1H D;  1PPJ D;  2BH5 X;  2GC7 D;  1H31 B;  1C75 A;  2AI5 A;  1BCC D;  4FAV A;  1YIQ A;  3NWV A;  2ORL A;  3PXT A;  2B11 B;  3H1J D;  2HV4 A;  3L70 D;  1GIW A;  4J20 A;  1CO6 A;  3VRD A;  3H1K D;  2V07 A;  3O1Y A;  2BLF B;  2MHM A;  1S6V B;  2EXV A;  1EB7 A;  2YK3 A;  3SXT A;  1CTY A;  1H32 B;  2PCC B;  2CE0 A;  3ZBM A;  2B4Z A;  1AOF A;  1QN2 A;  2FYU D;  2DGE A;  1CYI A;  5C9M A;  3OCD A;  4PJ0 V;  5GTI V;  1SQV D;  5CIB B;  3L71 D;  1ZZH A;  1CYJ A;  351C A;  2RN0 A;  3TF5 A;  4MU8 A;  4O1Q A;  1CNO A;  1CSV A;  1DVH A;  2C8S A;  2BCC D;  3WFE C;  1SQQ D;  1YEA A;  2CA3 B;  1DIQ C;  2AIU A;  2Y0C A;  1NMI A;  1BGY D;  1RAQ A;  1CCH A;  1CRJ A;  1CTZ A;  1IRV A;  2K9J B;  4AAL A;  4Q5P A;  3CWB D;  1CIE A;  1KYO W;  1M6Z A;  3ORV A;  3CX5 W;  2KS1 A;  2YIU B;  4WQC A;  3SVW A;  2OZ1 B;  1H9Y A;  1LMS A;  2C1U A;  2JWA A;  1E29 A;  1W5C T;  1PP9 D;  2JTI B;  1FCD C;  1HCM A;  4FA5 A;  1C6O A;  1SQX D;  3PXS A;  1NML A;  1AKK A;  1CSW A;  3VMA A;  2BH4 X;  2OZ1 A;  2GB8 B;  4PD4 D;  3RN0 A;  1CRI A;  4EIE A;  4N0K A;  1H33 A;  1DW1 A;  1H1O A;  3ITK A;  3PTZ A;  1N9C A;  3KZI V;  1C2R A;  5GTH V;  5H2F V;  3HQ7 A;  3RLM A;  3TDK A;  1QL4 A;  1HJ5 A;  5TIS V;  1JDL A;  3DMI A;  1L0L D;  1RZ5 A;  4JCG A;  1I8P A;  1GJQ A;  4AAM A;  1F1F A;  1NTK D;  1LFM A;  3OA8 B;  1LC2 A;  1NTM D;  2N18 B;  3MK7 C;  3O20 A;  2N9I A;  3GG2 A;  2C1D B;  2CE1 A;  2V08 A;  1HZV A;  1QYZ A;  4V2K A;  5CID B;  1BL9 A;  1A2S A;  1RAP A;  3M97 X;  3CXH D;  3WFD C;  1IRW A;  1LS9 A;  1KV9 A;  4YE1 A;  3HQ8 A;  1YEB A;  2N9J A;  5CIE B;  1HJ4 A;  5IY5 1;  3OA8 A;  1CXC A;  4WQB A;  3TYI A;  1A56 A;  3L73 D;  1H31 A;  1IO3 A;  1DW3 A;  2ZON G;  3WU2 V;  2GC4 D;  1N50 A;  3RN1 A;  2ZBO A;  1K3H A;  2PAC A;  4H0K A;  4WQE A;  2L91 A;  5B5E V;  2RMZ A;  1QL3 A;  1U75 B;  5KAI V;  3ZOY A;  1CSX A;  2A06 D;  4WQD A;  1QKS A;  5KKZ B;  1H32 A;  1CIG A;  1WEJ F;  3BCC D;  4K3I A;  5CYT R;  3WUI A;  2DVH A;  1M60 A;  1HZU A;  1YIC A;  5DJQ C;  3PLN A;  2B10 B;  155C A;  4KMG A;  2O3J A;  3ZOO A;  3PH2 B;  4LJI A;  1CXA A;  3L75 D;  1SQP D;  1GDV A;  1RZ6 A;  3VYM A;  2QJK B;  3CYT I;  1CC5 A;  4U3F D;  2ZOO A;  4GYD A;  4L1Q A;  4EIC A;  1E2R A;  2IBZ D;  4PW9 B;  1HRO A;  3L4M A;  1KIB A;  1FHB A;  5CIF B;  3NBT A;  4PWA A;  3DR0 A;  5B6Q A;  3H1I D;  3PHL A;  2C2C A;  2C1V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...