1SQQD

Crystal structure analysis of bovine bc1 with methoxy acrylate stilbene (moas)
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
total genus 51
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1sqqD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1sqqD02
1NTZD 4EDFA 5KKZB 2HV4A 2JTIB 2CA3B 1H33A 3A9FA 1C6SA 1HH7A 4XYDB 2OZ1A 3PXTA 2PCCB 4PW9B 5TJHA 4EICA 2B11B 2QG4A 2ZZS1 4A7PA 4MU8A 1BCCD 1NMIA 1YNRA 2VHDA 1GDVA 1DIQC 5CIEB 3PXSA 1K3HA 2IBZD 1FOCA 5B66V 1CCRA 4FA1A 3WUIA 1ETPA 2GB8B 1AOFA 2OZ1B 1H9XA 3L70D 1U75B 2Y0EA 3CWBD 2XTSB 5CIGB 2DGEA 1IZL0 1M60A 1A8CA 3SWSA 451CA 5GTIV 2RMZA 2C8SA 1CSWA 2Y0CA 1YCCA 5H2FV 1OCDA 1I6DA 2MHMA 1DW0A 4DY9A 4AAOA 1QKSA 1JDLA 4FANA 155CA 3H1KD 3L72D 1COTA 4H0JA 1LC2A 1H31A 1CORA 3L74D 1N50A 1SQXD 4EIEA 1MG3D 1ZRTD 1E8EA 1W5CT 1LMSA 5CICB 1CIEA 5AURA 1CNOA 1I54A 3OA8A 1F1FA 1B7VA 3ZOOA 3CP5A 1HZUA 1DW1A 4AX3A 1DVVA 1CHIA 1KV9A 1CIGA 2LIRA 2L4DA 1ZZHA 3ZOXA 4WQDA 1E29A 1HJ3A 2PCBB 1GIWA 2C9XB 3WFBC 2V08A 1DT1A 1CTYA 3DR0A 1RAQA 2BGVX 1M70A 1FI9A 2YQBA 1FCDC 4EIFA 1I5TA 4N0KA 4K3IA 1PP9D 1QYZA 5DJQC 2GC4D 3VNWA 2AXTV 1L9JC 3VRDA 2ZBOA 2CXBA 1CRJA 5KLIB 2Y0DA 3TF5A 3O5CA 2ZXYA 4NFGB 1H9YA 3H1HD 4PWAA 1AOQA 1EB7A 4KMGA 5TISV 1L0ND 2ORLA 3SJLA 1GQ1A 2BLFB 3X39A 1CXCA 2QJKB 2FRCA 1NMLA 1A56A 2BCNB 1H32A 1C2NA 1FHBA 2B10B 2BPBB 1CSXA 3WU2V 5EXQA 2AIUA 2QJPB 1HZVA 3SVWA 1FI7A 1I6EA 1N90A 1CRGA 1AKKA 1PPJD 4RSZA 4FA4A 1CTJA 1KYOW 3ZBMA 5CIHB 3BCCD 2ZOOA 3TGUD 1S6VB 1BGYD 5CYTR 1BE3D 1R0QA 4AALA 5IY51 4O1WA 1CTZA 4L3GA 4V2KA 2YCCA 1NNOA 1KX7A 3ZCFA 4XXLA 3ZIYA 1HJ5A 2KNCB 4O1QA 1K3GA 5KAFV 3VMAA 4GYDA 1H32B 4L3HA 1DW2A 3L4MA 3ZOWA 5CIDB 1FI3A 3WFCC 4D6TD 1N9CA 2B4ZA 2D0WA 1BL9A 4WQ8A 3H1LD 4PD4D 1HCMA 2N3YA 1MG2D 4FA5A 3DMIA 1C6OA 1FJ0A 3CYTI 2DVHA 4H0KA 5KLVD 2GC7D 1WEJF 1IRVA 1YICA 2CE1A 2K9JB 3A0BV 3A0HV 3JBTB 4P4QB 3HQ9A 4UB6V 3FWLA 1KB0A 3SLEA 5CIFB 1N15A 3TDKA 4FA9A 2FYNB 3HQ6A 3CXHW 4PJ0V 1HRCA 2A06D 4AAMA 2PACA 1CC5A 3GG2A 1S5LV 2C1VA 2JWAA 3GW6A 1CHHA 3ITKA 1KX2A 2N18C 1F1CA 2YIUB 1P84D 3O1YA 1C75A 1YEBA 1CRIA 2N9JA 2KS1A 1CYCA 4GEDB 4QAOA 3RN1A 2RN0A 3HQ8A 1C6RA 4Q5PA 2EXVA 3M97X 3CXHD 1CRHA 1HJ4A 3L73D 1CCHA 1J3SA 1SQPD 2FWLA 4WQ9A 3PHLA 2C1UA 3HQ7A 1YTCA 4FAVA 1AYGA 1IO3A 5GTHV 1SQBD 2C1DA 1C52A 1RZ5A 3O20A 2CE0A 3O0RC 2B12B 1NU1D 3WFEC 3CX5D 1LFMA 1CIFA 2LITA 4IL6V 1E2RA 2YK3A 1GU2A 5CIBB 3H1JD 4FB1A 1YFCA 5DFSA 1CSUA 4JCGA 1CYIA 4YE1A 3RN0A 1H33B 4WQCA 2BH5X 3PXWA 1QL3A 2AI5A 3CX5W 2FYUD 1M6ZA 1CRYA 4WQBA 1LS9A 2N9YB 4RJTA 3ORVA 1NIRA 1OAEA 1I55A 5B5EV 3PRJA 3L4OA 1LC1A 1H1OA 3PLNA 3NBSA 5DF5A 1A2SA 3MK7B 1QN2A 5E79V 1CHJA 1NTKD 3WC8A 1DIIC 1CYJA 1KYOD 1CO6A 1CRCA 2I8FA 3KHUA 3H1ID 4L1QA 1WVEC 1IRWA 2BH4X 4J20A 2QJYB 1L9BC 1RAPA 3C2CA 5KAIV 3ZOYA 1MZ4A 1GJQA 1C7MA 3PTZA 3PH2B 351CA 4U3FD 3NBTA 3DP5A 2JQRA 2BCCD 3RMZA 1VYDA 2GIWA 1QL4A 4AANA 2ZONG 2N18B 1I8OA 4UB8V 4WQEA 1U74B 1H31B 5DJQB 1KIBA 1YEAA 4WQ7A 1I8PA 1SQQD 3TYIA 2C2CA 4LJIA 1GKSA 2N9IA 3WFDC 3OA8B 3RLMA 2C1DB 1CXAA 1EZVD 1W2LA 2CA4B 1C2RA 3SXTA 3OCDA 1IQCA 3MK7C 2L91A 3OCDB 4EIDA 1CIHA 1YIQA 3CU4A 5C0ZA 4Y5RA 2Q3EA 2V07A 1L0LD 3NWVA 1CEDA 1KB9D 3L71D 1DVHA 2O3JA 1HROA 5C9MA 2D0SA 1NTMD 5B6QA 3VYMA 1CSVA 3KZIV 3L75D 4WQAA 2B0ZB 1DW3A 2N3BA 1SQVD 1RZ6A 2MTAC
chains in the Genus database with same CATH superfamily
1NTZD 2OYIC 1NTME 1OVVA 1KV4A 4I7ZB 1N7SC 2YXQB 3ZDMA 1H33A 3CL3D 3UIAA 4KT0J 2E76D 4XYDB 1NHLA 3BRVB 2OZ1A 4PD4E 4PW9B 2GA1A 2FFDA 2AXTH 1N73C 4EICA 4L76A 2QG4A 1NMIA 2QJKC 1FZFA 5CIEB 2IBZD 3HUSB 1ETPA 4H44C 3B8EB 2OQQA 3L70D 3H1HJ 2BASA 3L4FA 2DGEA 5AVXB 1M60A 451CA 2M8RA 5CCGC 1IFNA 4GOEA 2Y0CA 1N86A 1YHQP 1DW0A 1IFIA 4AAOA 2H7HA 4FANA 4N78D 2OYHB 4ASVA 5BVZA 5H2FE 1X79B 3L71G 1MG3D 2V4HA 1E8EA 3E1IA 1UIXA 3AEFC 4R4LA 1DX7A 3JSVC 5CICB 1SQQG 5AURA 3OA8A 4YXDC 2WPRA 2LKMA 1QEXA 2GM4A 2W6AA 1CHIA 3BVHA 3CCRP 3CD6P 3ZOXA 2O1KA 3GLMA 1HJ3A 2PCBB 1VQ4P 2P2UA 3L75G 3G4SP 2V08A 3WU2E 2JEEA 2Z4EA 3DR0A 1RAQA 2NRGA 5APQA 1PFIA 1LTTC 1OW7A 1I5TA 1J1EC 4ZMDA 1M90Q 1K04A 1GW3A 4IL6E 4RKUJ 3L71J 1E5WA 1NGMB 1KILB 2Y0DA 3O5CA 3CI9A 4NFGB 1FZAA 3L70G 1KYOI 3H1HD 2K1AA 1PV3A 4PV1B 2P58A 3MZWB 4HH2A 3P32A 3KDPB 3SJLA 1VF5B 2O01H 4JBZA 1LTIC 3X39A 1S72P 1CXCA 3Q5PA 3PJSK 2QJKB 4RO0A 5B5EH 1GU5A 3H1JG 2C0WA 2WT7B 1VDFA 1SQXG 1CSXA 3WU2V 2I1KA 3GMAA 3CXHH 3RK3D 2KK7A 5DJUB 4H44B 3CXHE 1FZBA 1RE4C 1ZRTE 4JYBA 5KKZC 1KYOW 5DJTB 3BCCD 2ZOOA 1PZQA 3TGUD 2OYHA 4OVNF 1LTBC 3HE4B 4AALA 1BE3E 5CCGD 1ZMEC 4V2KA 1NOHA 3JCUE 3CCVP 4W7ZA 4NPEA 1NNOA 2E42A 1EDKA 1G2CB 4RESB 3ZCFA 4JYCA 2RH0A 2KZIA 1JMBA 5KAFE 3KZIE 1HJ5A 1P84E 2ZYGA 2JO1A 2BCCE 2R3SA 1K3GA 4L3HA 3D6ZA 3ZOWA 5CIDB 1L2PA 1EDLA 1JM0A 4BWNA 1N9CA 4IL6X 3RL0g 4WVZA 3NXSA 2FKWB 1SQPG 1URQA 3H1LD 4FA5A 1IFDA 3SSUA 1FJ0A 1OZHA 2K9JA 5KLVD 2FY8A 1WEJF 1S1CX 3AE5C 4O9BA 1SFCC 4C7NA 1GD2E 2YO3A 1IK9A 4W80A 1T3UA 1KB0A 3FWLA 4UB8E 3SLEA 3II6A 3USSA 2N1TD 3AEEC 1BGYJ 2B9BA 5E79H 1MZ9A 1GU4A 2R32A 4B86A 4PJ0V 1RE4A 1KQLA 3KQGA 1GL2C 1VF5C 2L5GB 2PACA 1CC5A 3GW6A 1KX2A 1GMJA 1P84D 5CCHA 1AVOA 5AW4B 1SQPJ 3M9BA 2KS1A 2FYUE 3RN1A 2RN0A 3HQ8A 3B5NC 1CRHA 1BDDA 3HRNA 4PD4H 1J3SA 2ZJSE 1S9KD 2AXTE 3PHLA 1GZLA 2V7QH 4FAVA 1AYGA 1IO3A 2C1DA 2YO2A 2CE0A 3O0RC 3L72E 3PP5A 1KILC 2P7JA 2E75D 1NU1D 2E43A 4CPGA 2QM7A 3MGNA 4IL6V 2P10A 1E2RA 2YK3A 2M5AA 1JCDA 5AVZB 1GU2A 2WSFJ 3KPEA 2JJLA 3H1JD 3P7KA 5M1BA 4FB1A 1YFCA 1CSUA 5BU5A 3M06A 4YE1A 2CPSA 3CWBE 1FDMA 1SQPK 1ZW0A 2BH5X 1N7SA 2AI5A 3CX5W 1DD4A 3CMAP 3FX0A 1H1OA 3PLNA 3F5HA 2ZXXA 1FZGA 1W2EA 1FE6A 2OARA 1OW6A 1CHJA 3V2NA 1KYOD 1WVEC 1IRWA 1FDIA 4U3FJ 4IFDK 2XDJA 2WSFH 3B5NA 3O6QA 1L9BC 2W90A 3OA7A 1FZCC 5APYA 1DD3A 5CBNA 351CA 2IBZG 3D6YA 5B66E 2Q5UA 4D6TJ 2JQRA 1T8ZA 3H1KE 2KIKA 1NAFA 4WB4A 1N7SB 1HVVA 1S4XA 4PJ0E 1L4AD 1H31B 3NMDA 5DJQB 1GL2B 5AVYB 2BCCG 3TYIA 4LJIA 1GKSA 1VQKP 2XNXA 3H32B 3VP8A 2ZYDA 3RLMA 2C1DB 2CA4B 3SXTA 2FYUK 1U57A 1FZCA 2FFDB 2N1TB 3OCDB 1WRGA 2Q3EA 3S4RA 4UB6H 2QIWA 4XA4A 1J1EB 1GW4A 5AVQB 4Z1MH 1NTZG 5APTA 3Q5RA 4DZOA 1CEDA 2WSCJ 4DT0A 1OMIA 1FDOA 2D0SA 1CSVA 3KZIV 3L75D 1FJKA 4BRYB 1UIIA 2R5BA 1RQVA 5KKZB 2JTIB 2CA3B 3AECC 2W27A 4NPDA 3R4YA 1HH7A 2PCCB 1L0NG 5H2FH 5TJHA 2HODB 2B11B 5KJ7C 2ZZS1 3AE9C 4PV1D 2XKMA 2VHDA 1VQ7P 1DIQC 3A5TA 2NPSD 5AW0B 5AW8B 1FOCA 2IZ0A 3A0BE 1VF5D 2PGDA 3L37A 1FZCB 4DOJA 3GHGA 2GB8B 5AW6B 3HUSA 2PP6A 1BCCG 1H9XA 1YJNP 1IZL0 3VP9A 2Q3IA 4IOIH 3SWSA 2IX7C 2J5UA 4H13C 1YCCA 5H2FV 3WUUA 3RL0B 1Q81Q 1QL2A 1I6DA 2KB7P 4JPZB 3RK3B 2FBWC 4EOTA 1LT1A 1QKSA 1VQ8P 3H1KD 4UB8H 1LC2A 1H31A 1RF1B 1ZRTD 1AQTA 1Q7YQ 2WPVB 5E79E 1LT9C 4I6MC 2IYOA 2Q1KA 1CIEA 2SPZA 1B7VA 3ZOOA 5KTBA 3CP5A 3T97A 1Y8AA 1DW1A 2WSEJ 4ASWA 3PH0A 1KV9A 2LIRA 1SQBJ 1ZZHA 2PFXA 4ZKUA 2FFDC 3A2AA 1DT1A 3L74G 2BGVX 1M70A 3L35A 3CCUP 2YKOA 1FI9A 3CPWO 3MIWA 4N0KA 4K3IA 5DJQC 3VNWA 4OGQD 3VRDA 2ZBOA 2CXBA 1CRJA 2B89A 3M9HA 3TSIA 3TF5A 1PL5A 5L8RJ 3VYIA 4H13D 3RBXA 3BRTB 1HF9A 4PWAA 2IPPA 1EZVE 3FXEA 3CCSP 1EB7A 2D2CD 3P8CD 3CC2P 3S1KA 4KMGA 2R3CA 1KYOE 2MJZA 2POHA 4C7NB 1S5LE 1SQVJ 4DCKA 3QH9A 3KZIH 1SQVE 1JY3N 2H89C 2D2CB 2FRCA 2BCNB 1FHBA 2BPBB 1VQMP 1EXJA 1IC2A 1LTJA 1OVUA 2QJPB 1FI7A 3Q5SA 1CRGA 4FA4A 4Y28J 1CTJA 3L70J 5CYTR 4O1WA 3D0WA 2YCCA 3AE4C 1KX7A 2E5TA 5K5GB 2QA4P 3NFQA 2AXCA 1FS0E 2O01J 1NU1E 3ZIYA 1LGHB 4O1QA 5KAFV 4AUWA 4GYDA 1H32B 2FXOA 3L4MA 1FI3A 4YTPC 2HPCB 3S9OA 2D0WA 1LT9B 3QWOC 4PJ0H 1VQOP 4WQ8A 3KYQA 3V5BA 3CCJP 4WY4A 3CMEP 4PD4D 1RE3C 1URQB 1WMKA 4XE5B 1A02F 2ZYAA 3CYTI 1HWTC 1BCCJ 3SWYA 2DVHA 4H0KA 1SQQJ 2K9JB 3A0BV 3JBTB 1NTZE 2MKVA 1AJYA 1ZN5A 1Q2NA 1JY3O 2WITA 2N9BA 3HQ6A 3EFGA 4UB6E 1SQBK 1FBMA 2A06D 3ITKA 3GG2A 1N7LA 1NJIQ 4PD4I 1FC2C 1C75A 1CRIA 1N73B 1LP1A 1N2DC 2XU6A 3AEBC 1C6RA 3G71P 3CXHD 4I1LA 2A45G 1CCHA 1AA0A 2C1UA 1NU1J 2JKVA 2FYNC 2ZFCA 1YTCA 1M1JB 1QGKB 5GTHV 1GK6A 1LWUC 3L74E 3O20A 3HD7C 1L4AB 5APWA 3L73E 3CX5D 3GHGC 1LFMA 1CIFA 2LITA 1ZOYC 4KJMA 4OGQB 5AW1B 5AVVB 1GL2A 3IR9A 4LC1A 1R5LA 2HR3A 2UWJE 1RF0C 1SQBG 3G6EP 1QX8A 4C7RA 4H44D 3H32A 3CCLP 5DFSA 3ABVC 1PP9G 4JCGA 1G2CA 3H1LG 4WQCA 3CCEP 3FXDA 1Q86Q 4WQBA 3WU2H 4OWFA 1LT9A 4RJTA 1VQPP 3RK2B 1OAEA 5B5EV 1IK7A 3PRJA 5GTIH 1USDA 2QEXP 3BATA 1BCCE 5DF5A 1A2SA 2M3BA 1NU1K 1VQLP 3HD7A 3A7OA 2O1JA 3WC8A 1R5SA 2KSJA 2YMYA 3CC7P 4L1QA 3M0DA 4J20A 1JB0J 2E75B 2QJYB 2H88C 2NPSB 1YJWP 1H0TB 2N1TA 1RAPA 3C2CA 1SLQA 3B5NB 3HUSC 1LTGC 5GTHH 3NBTA 2O01N 3L72G 3RMZA 1VYDA 3AE3C 4LGDE 4AANA 3IFMA 4N78E 2N18B 1I8OA 4UB8V 1N73A 4K3AA 2WPSA 1ZP0C 3AEAC 3EQ2A 3B71A 1SQXK 2QSIA 1GK4A 3SWFA 2KOGA 1SVFA 3G9RA 1DIPA 1EZVD 1W2LA 5TISH 1YTZT 1DH3A 3JCUH 2FXPA 1KYOH 1YI2P 1ZV8A 5TISE 3MK7C 4I7ZC 2HFED 2IBZE 1KQGB 3CWBJ 4EIDA 2HYNA 3C8VA 1U7JA 3CU4A 1KN7A 4JF7A 3HE4A 3W68A 2YXRB 1NYHA 1L0LD 1HH0A 1PPJG 1Q82Q 2IFMA 3OAKA 4N3YB 3L71D 3AEGC 1LWUB 1HROA 2ZAEB 3LW5H 1NTMD 3H1KG 1N8RQ 1SQVD 2MTAC 4EDFA 3CXHI 2HV4A 5AVUB 1EQ7A 1IO4A 2BCCJ 2WSSH 1E79H 1K9MQ 3WUTA 2R44A 3V4WA 2V7QJ 3PXTA 1KTMA 4A7PA 1RHZB 1JCCA 1BCCD 1YNRA 1RF1C 1NAYA 4TT3H 3KXDA 3MP7B 2LXCB 3WUIA 2OZ1B 2Z5HA 2QJYC 5AW9B 1U75B 4ZKPA 2XTSB 5CIGB 1S5LX 3W67A 1A8CA 5GTIV 2C8SA 1CSWA 3O6QB 1KB9I 3V4QA 2JP3A 4KHXA 1K05A 2XV5A 2OYIB 1COTA 4YXWH 3K5BA 1CORA 3L74D 1SQXD 1PPJE 2QM8A 1M57D 3GF3A 1D7MA 2KNCA 3V2PA 1LMSA 1RY3A 1I54A 1OXZA 2OTKE 1F1FA 3AE7C 3CC4P 2Y9ZA 1JY2O 4DJGA 3T97B 1BGYG 2L4DA 2KP8A 1JTHB 2KZJA 1L0NE 1E29A 3AEDC 3VMYA 1GIWA 3WFBC 1RQUA 1OIPA 4HKZH 2XNDH 3H1IE 2YQBA 1FCDC 4EIFA 1LWUA 2A06E 1M1KQ 2QE7H 1QYZA 4WBAA 3EWKA 3H1IG 1USEA 1URQD 4K35A 3A3YB 1L9JC 2W83C 3RK3C 2A06G 1W5CE 3B4SA 3RL0D 1JOCA 1PP9E 1KQFB 4U7JA 3NTNA 2JR8A 3I56P 2KSEA 2ZVNB 2JDIH 1T2KC 1MFTA 2BEZF 1EC5A 2ORLA 4IFFA 2HODA 2LR2A 3CCMP 2BLFB 1HJBA 3L72J 2KLVA 5APXA 4H0LB 1LTAC 1NMLA 3U59A 1A56A 2YMKA 3L75E 1H32A 4H0LC 1C2NA 5EFWB 2GUSA 2PRRA 5EXQA 2AIUA 1TU3F 3SVWA 1WT6A 1I6EA 2E74C 3V6IA 1AKKA 1N7SD 4RSZA 2C0XA 2Q7CA 3D70A 3H1JJ 5KJ7A 3RBZA 1NTMJ 1JNMA 1BGYD 2FXMA 1R0QA 5IY51 3H1KJ 1SFCB 5AVRB 5KLIC 1XTGB 1AVYA 2YNYA 3WUVA 2IYPA 5GTHE 2KLUA 5CCGA 4Y99B 2H43A 2G3AA 3V2QA 1JY2N 4L73A 2PAJA 1IFMA 2ZVOB 3H1LJ 3MHVA 1GDTA 3FWNA 2OYOA 3WFCC 3OW2O 1SQPE 1OWAA 1BL9A 1BE3G 5APUA 1QVGO 4D6TG 1LP1B 1HCMA 1MG2D 2N3YA 2OYHC 2GC7D 3H1JE 1BDCA 1IRVA 2QJPC 2W6JH 2LXBA 4P4QB 3HQ9A 1NVOA 2DW3A 4UB6V 1FOSF 3V2RA 2ZXEB 1SQXJ 1OVRA 1M1JC 1NKZB 5CIFB 1N15A 3TDKA 1KB9E 2FYNB 3U1AA 2WMMA 2C9LY 1SFCA 5AVWB 1SS1A 1KB9H 2JWDA 1VQNP 1S5LV 2JWAA 3A0BH 2N18C 2OGUA 2B87B 3I5CA 2WSCH 3Q1MA 4HYTB 1BE3J 4QAOA 4GIFA 3M97X 1DEEG 3MUDA 1VQ9P 1HJ4A 3L73D 1KILE 2E74D 2FWLA 4WQ9A 3RK2C 1OFCX 5GTIE 3AE6C 1SQBD 1MUUA 1AQ5A 1RZ5A 3WFEC 3H1IJ 4YPCA 3D71A 2FYZA 1CSBA 3TNUB 3M91A 2WQYC 1NTZJ 2KXPB 4GODA 1EDIA 1RF1A 1VPCA 2C9NY 1EZVI 1SP4A 2Q6QA 1FZEA 2IBZI 4MN4C 1T3JA 1H33B 1PGPA 3PXWA 1QL3A 1KFNA 2FYUD 2J59M 1M6ZA 2B87A 1LS9A 2N9YB 5AW5B 1LTSC 3L4OA 1MV8A 1NTMG 1PGQA 3NBSA 2WVRA 5CJ0A 2N1TC 1QN2A 1YITP 2AEFA 2H8PD 1NTKD 1KORA 1JMMA 3KHUA 1CRCA 2K3RA 3H1ID 1QVFO 2BH4X 2ZT9D 5KJ7D 3MUDC 1P84I 3H1HG 5KAIV 3ZOYA 1MZ4A 2NPSA 1IZNB 3PTZA 3TGUE 3PH2B 1ZR4A 1OW8A 5B5EE 1MKMA 2OTJP 2KYVA 3H1LE 2GIWA 4LLHA 5CJ4A 4L74A 3RK3E 1L0LK 1SQBE 4WQEA 1LTJC 2J58A 3O8ZA 2C2CA 1VL2A 2IZ1A 3E7KA 1Y9BA 2KI7B 2K9YA 4HJGH 3H1HE 1IQCA 5C39A 2I1JA 5KAFH 3HE5B 2WWWA 2W6BA 1JEKA 3JC22 1NKNA 1YIQA 3RGUA 1M8OB 4L75A 4Y5RA 1AV1A 2I8DA 3L74J 1CZQA 5KLVJ 1L4AA 2YKQA 1L4AC 1KB9D 1DVHA 2O3JA 3BCCG 5C9MA 3VN0A 1Y47A 5B6QA 3VYMA 3EFFK 4XFJA 3P8CE 1DW3A 1RZ6A 1NTKJ 3VTPC 1L0LG 1PGOA 2E74B 1CI6B 3BCCJ 3A9FA 1C6SA 2HPCA 3IAOA 4OH8B 4WY4D 1T2KD 1NTKK 1J1DC 4WY4B 4MU8A 1GDVA 1RF0A 4I2LC 1M56D 2NZ2A 3PXSA 1K3HA 1Q90D 5B66V 1CCRA 3TK1A 4FA1A 2BEQD 3Q3DA 1U7MA 1YQ4C 1AOFA 4EIJA 1G1JA 3H6PA 3TGUJ 1QL1A 2Y0EA 3CWBD 2XZRA 1HBWA 1OX3A 4N6JA 1EXIA 1JY3P 3Q2YA 2RMZA 2E5YA 4EI2A 1OCDA 1K8AQ 1LJ2A 2MHMA 4DY9A 1BGYE 3IF4A 1JDLA 1KQSO 155CA 3AE8C 5AW3B 3G3ZA 3L72D 1NTMK 4H0JA 1EZVG 3VMZA 4EYYQ 4EIEA 1N50A 3L73J 1W5CT 1KZUB 3B5ND 2OTLP 1CNOA 2ZT9B 2R5DA 1HZUA 4AX3A 1DVVA 1CIGA 1M1JA 1BSNA 2A45H 4WQDA 1YTZI 4AYCA 2C9XB 1M7LA 3A0HE 1CTYA 3A0HH 2IFNA 3L36A 1HJ0A 1Z56A 1PP9D 3MD0A 2GC4D 5CBOA 1FJPA 2AXTV 1KILA 1FAVA 5KLIB 1X9VA 3RL0C 1H88A 2ZXYA 1YJ9P 3TYYA 5KLVE 1H9YA 1KFMA 1AOQA 3BASA 5TISV 1L0ND 1NO4A 5KAIH 5CMZA 4JQ0D 1GQ1A 1NTKE 2E75C 1FOSE 1KMIZ 4GDOA 4NPFX 4M3LA 1JY2P 2B10B 3CX5E 1EDJA 1H0TA 1L0NJ 1HZVA 1KD1Q 4U3FG 4W7YA 1N90A 1PPJD 1SQXE 2FYUG 1HTLC 2P67A 5CIHB 3ZBMA 1SQQK 3I55P 3R2PA 1H8AA 1XTCC 1S6VB 4QMAA 1BE3D 1CTZA 2M3EA 4L3GA 2AEJA 3HTKB 4BXLA 3IN6A 4C46A 2QRXA 2OYIA 1NTKG 1PP9J 2P1JA 4XXLA 1URQC 2KNCB 1SQQE 1NU1G 1X22A 1IJDB 1ZXGA 3VMAA 1VQ5P 1ZLLA 1DW2A 4D6TD 5KLVG 1A02J 2B4ZA 1PIXA 2GUVA 5AW7B 1KILD 4GT1A 1HUCA 2CPBA 5CCHC 1JTHA 3DMIA 3GF7A 1C6OA 4H0LD 3C1LA 3H25A 2HLOA 4OGQC 2ZT9C 3GHGB 1YICA 5AW2B 2CE1A 1X8YA 1MFZA 3A0HV 2Q9IA 3VMXA 3N4XA 1T6AA 3LW5J 2WSEH 2VRSA 1KC8Q 1H89A 2B88A 1P84H 4FA9A 3L71E 3U1CA 2WT7A 3HTKA 3CXHW 4AQRD 1HRCA 1HGZA 3AE1C 4AAMA 1L0LE 1S2EA 2YKPA 2W8ZA 3CLQA 2C1VA 1CHHA 2NPSC 1RH5B 1R8EA 1F1CA 4PV1C 2YIUB 1VQ6P 3O1YA 3L73G 1SQVK 1YEBA 2KS1B 1CW5A 2N9JA 2AEMA 1J2JB 1J1DB 1SQVG 4WY4C 1CYCA 4GEDB 5KLVK 1YQ3C 4Q5PA 2EXVA 4WWIA 1JUNA 3M0DC 1SQPD 5APSA 1IFJA 1YBKA 3HQ7A 4IL6H 3N7NA 1G1IA 5BU8B 1NTZK 1C52A 2E76B 1IFPA 1QLED 3TGUG 1S9KE 2B12B 5CCHD 1PGJA 2HG5D 3SFDC 3MTUE 3TNUA 4Y99C 5CIBB 1CYIA 4HB1A 3RN0A 3SFEC 3HD7B 1L0NK 3OJAB 3L70E 4ZNCA 3HD7D 2Z5IA 1CRYA 2M0BA 1NWQA 4R4MA 2WZ7A 3ORVA 1NIRA 1I55A 3CWBG 1LC1A 3MK7B 1GL2D 1NH4A 3WMM0 4H13B 5E79V 1GTWA 1DIIC 2Y9YA 1DEBA 1HGVA 2WTYA 1CYJA 2KUBA 1CO6A 4IFMA 2I8FA 2YIUC 3LIDA 1CI6A 1LTJB 2K37A 1S5LH 1GJQA 1C7MA 3HE5A 3RK2D 4U3FD 3DP5A 3CCQP 2BCCD 2D2CC 3P8MC 1YIJP 1QL4A 5CHXA 5AVSB 2ZONG 1FU1A 4D6TE 3C9IA 1U74B 1S3JA 1ZR2A 1KIBA 1YEAA 4WQ7A 1I8PA 1SQQD 2M5AB 3E1RA 3AE2C 1X0TA 1L0LJ 2N9IA 3BCCE 2A45I 3WFDC 3OA8B 3VOPA 1CXAA 1C2RA 1AFOA 1W2BO 3OCDA 5KAIE 3F89A 1BSHA 2L91A 1RE3A 1YYCA 2K88A 2ITAA 5B66H 1CIHA 5APVA 1LNQA 5C0ZA 5AVTB 2IDBA 3CX5I 3M9QA 2FYUJ 1SFCD 3FGAD 2V07A 1JO5A 3CX5H 3L75J 1K73Q 4U3FE 4GOFA 3LIEA 3NWVA 4GKGA 3SWKA 2E76C 4BRYA 2CK3H 2QVAA 4WQAA 3M0AA 2B0ZB 2N3BA 2G8YA 2RKLA 2WPQA 4TLFA
chains in the Genus database with same CATH topology
1NTZD 4EDFA 5KKZB 2HV4A 2JTIB 2CA3B 1H33A 3A9FA 1C6SA 1HH7A 4XYDB 2OZ1A 3PXTA 2PCCB 4PW9B 5TJHA 4EICA 2B11B 2QG4A 2ZZS1 4A7PA 4MU8A 1BCCD 1NMIA 1YNRA 2VHDA 1GDVA 1DIQC 5CIEB 3PXSA 1K3HA 2IBZD 1FOCA 5B66V 1CCRA 4FA1A 3WUIA 1ETPA 2GB8B 1AOFA 2OZ1B 1H9XA 3L70D 1U75B 2Y0EA 3CWBD 2XTSB 5CIGB 2DGEA 1IZL0 1M60A 1A8CA 3SWSA 451CA 5GTIV 2RMZA 2C8SA 1CSWA 2Y0CA 1YCCA 5H2FV 1OCDA 1I6DA 2MHMA 1DW0A 4DY9A 4AAOA 1QKSA 1JDLA 4FANA 155CA 3H1KD 3L72D 1COTA 4H0JA 1LC2A 1H31A 1CORA 3L74D 1N50A 1SQXD 4EIEA 1MG3D 1ZRTD 1E8EA 1W5CT 1LMSA 5CICB 1CIEA 5AURA 1CNOA 1I54A 3OA8A 1F1FA 1B7VA 3ZOOA 3CP5A 1HZUA 1DW1A 4AX3A 1DVVA 1CHIA 1KV9A 1CIGA 2LIRA 2L4DA 1ZZHA 3ZOXA 4WQDA 1E29A 1HJ3A 2PCBB 1GIWA 2C9XB 3WFBC 2V08A 1DT1A 1CTYA 3DR0A 1RAQA 2BGVX 1M70A 1FI9A 2YQBA 1FCDC 4EIFA 1I5TA 4N0KA 4K3IA 1PP9D 1QYZA 5DJQC 2GC4D 3VNWA 2AXTV 1L9JC 3VRDA 2ZBOA 2CXBA 1CRJA 5KLIB 2Y0DA 3TF5A 3O5CA 2ZXYA 4NFGB 1H9YA 3H1HD 4PWAA 1AOQA 1EB7A 4KMGA 5TISV 1L0ND 2ORLA 3SJLA 1GQ1A 2BLFB 3X39A 1CXCA 2QJKB 2FRCA 1NMLA 1A56A 2BCNB 1H32A 1C2NA 1FHBA 2B10B 2BPBB 1CSXA 3WU2V 5EXQA 2AIUA 2QJPB 1HZVA 3SVWA 1FI7A 1I6EA 1N90A 1CRGA 1AKKA 1PPJD 4RSZA 4FA4A 1CTJA 1KYOW 3ZBMA 5CIHB 3BCCD 2ZOOA 3TGUD 1S6VB 1BGYD 5CYTR 1BE3D 1R0QA 4AALA 5IY51 4O1WA 1CTZA 4L3GA 4V2KA 2YCCA 1NNOA 1KX7A 3ZCFA 4XXLA 3ZIYA 1HJ5A 2KNCB 4O1QA 1K3GA 5KAFV 3VMAA 4GYDA 1H32B 4L3HA 1DW2A 3L4MA 3ZOWA 5CIDB 1FI3A 3WFCC 4D6TD 1N9CA 2B4ZA 2D0WA 1BL9A 4WQ8A 3H1LD 4PD4D 1HCMA 2N3YA 1MG2D 4FA5A 3DMIA 1C6OA 1FJ0A 3CYTI 2DVHA 4H0KA 5KLVD 2GC7D 1WEJF 1IRVA 1YICA 2CE1A 2K9JB 3A0BV 3A0HV 3JBTB 4P4QB 3HQ9A 4UB6V 3FWLA 1KB0A 3SLEA 5CIFB 1N15A 3TDKA 4FA9A 2FYNB 3HQ6A 3CXHW 4PJ0V 1HRCA 2A06D 4AAMA 2PACA 1CC5A 3GG2A 1S5LV 2C1VA 2JWAA 3GW6A 1CHHA 3ITKA 1KX2A 2N18C 1F1CA 2YIUB 1P84D 3O1YA 1C75A 1YEBA 1CRIA 2N9JA 2KS1A 1CYCA 4GEDB 4QAOA 3RN1A 2RN0A 3HQ8A 1C6RA 4Q5PA 2EXVA 3M97X 3CXHD 1CRHA 1HJ4A 3L73D 1CCHA 1J3SA 1SQPD 2FWLA 4WQ9A 3PHLA 2C1UA 3HQ7A 1YTCA 4FAVA 1AYGA 1IO3A 5GTHV 1SQBD 2C1DA 1C52A 1RZ5A 3O20A 2CE0A 3O0RC 2B12B 1NU1D 3WFEC 3CX5D 1LFMA 1CIFA 2LITA 4IL6V 1E2RA 2YK3A 1GU2A 5CIBB 3H1JD 4FB1A 1YFCA 5DFSA 1CSUA 4JCGA 1CYIA 4YE1A 3RN0A 1H33B 4WQCA 2BH5X 3PXWA 1QL3A 2AI5A 3CX5W 2FYUD 1M6ZA 1CRYA 4WQBA 1LS9A 2N9YB 4RJTA 3ORVA 1NIRA 1OAEA 1I55A 5B5EV 3PRJA 3L4OA 1LC1A 1H1OA 3PLNA 3NBSA 5DF5A 1A2SA 3MK7B 1QN2A 5E79V 1CHJA 1NTKD 3WC8A 1DIIC 1CYJA 1KYOD 1CO6A 1CRCA 2I8FA 3KHUA 3H1ID 4L1QA 1WVEC 1IRWA 2BH4X 4J20A 2QJYB 1L9BC 1RAPA 3C2CA 5KAIV 3ZOYA 1MZ4A 1GJQA 1C7MA 3PTZA 3PH2B 351CA 4U3FD 3NBTA 3DP5A 2JQRA 2BCCD 3RMZA 1VYDA 2GIWA 1QL4A 4AANA 2ZONG 2N18B 1I8OA 4UB8V 4WQEA 1U74B 1H31B 5DJQB 1KIBA 1YEAA 4WQ7A 1I8PA 1SQQD 3TYIA 2C2CA 4LJIA 1GKSA 2N9IA 3WFDC 3OA8B 3RLMA 2C1DB 1CXAA 1EZVD 1W2LA 2CA4B 1C2RA 3SXTA 3OCDA 1IQCA 3MK7C 2L91A 3OCDB 4EIDA 1CIHA 1YIQA 3CU4A 5C0ZA 4Y5RA 2Q3EA 2V07A 1L0LD 3NWVA 1CEDA 1KB9D 3L71D 1DVHA 2O3JA 1HROA 5C9MA 2D0SA 1NTMD 5B6QA 3VYMA 1CSVA 3KZIV 3L75D 4WQAA 2B0ZB 1DW3A 2N3BA 1SQVD 1RZ6A 2MTAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTZ D;  4EDF A;  5KKZ B;  2HV4 A;  2JTI B;  2CA3 B;  1H33 A;  3A9F A;  1C6S A;  1HH7 A;  4XYD B;  2OZ1 A;  3PXT A;  2PCC B;  4PW9 B;  5TJH A;  4EIC A;  2B11 B;  2QG4 A;  2ZZS 1;  4A7P A;  4MU8 A;  1BCC D;  1NMI A;  1YNR A;  2VHD A;  1GDV A;  1DIQ C;  5CIE B;  3PXS A;  1K3H A;  2IBZ D;  1FOC A;  5B66 V;  1CCR A;  4FA1 A;  3WUI A;  1ETP A;  2GB8 B;  1AOF A;  2OZ1 B;  1H9X A;  3L70 D;  1U75 B;  2Y0E A;  3CWB D;  2XTS B;  5CIG B;  2DGE A;  1IZL 0;  1M60 A;  1A8C A;  3SWS A;  451C A;  5GTI V;  2RMZ A;  2C8S A;  1CSW A;  2Y0C A;  1YCC A;  5H2F V;  1OCD A;  1I6D A;  2MHM A;  1DW0 A;  4DY9 A;  4AAO A;  1QKS A;  1JDL A;  4FAN A;  155C A;  3H1K D;  3L72 D;  1COT A;  4H0J A;  1LC2 A;  1H31 A;  1COR A;  3L74 D;  1N50 A;  1SQX D;  4EIE A;  1MG3 D;  1ZRT D;  1E8E A;  1W5C T;  1LMS A;  5CIC B;  1CIE A;  5AUR A;  1CNO A;  1I54 A;  3OA8 A;  1F1F A;  1B7V A;  3ZOO A;  3CP5 A;  1HZU A;  1DW1 A;  4AX3 A;  1DVV A;  1CHI A;  1KV9 A;  1CIG A;  2LIR A;  2L4D A;  1ZZH A;  3ZOX A;  4WQD A;  1E29 A;  1HJ3 A;  2PCB B;  1GIW A;  2C9X B;  3WFB C;  2V08 A;  1DT1 A;  1CTY A;  3DR0 A;  1RAQ A;  2BGV X;  1M70 A;  1FI9 A;  2YQB A;  1FCD C;  4EIF A;  1I5T A;  4N0K A;  4K3I A;  1PP9 D;  1QYZ A;  5DJQ C;  2GC4 D;  3VNW A;  2AXT V;  1L9J C;  3VRD A;  2ZBO A;  2CXB A;  1CRJ A;  5KLI B;  2Y0D A;  3TF5 A;  3O5C A;  2ZXY A;  4NFG B;  1H9Y A;  3H1H D;  4PWA A;  1AOQ A;  1EB7 A;  4KMG A;  5TIS V;  1L0N D;  2ORL A;  3SJL A;  1GQ1 A;  2BLF B;  3X39 A;  1CXC A;  2QJK B;  2FRC A;  1NML A;  1A56 A;  2BCN B;  1H32 A;  1C2N A;  1FHB A;  2B10 B;  2BPB B;  1CSX A;  3WU2 V;  5EXQ A;  2AIU A;  2QJP B;  1HZV A;  3SVW A;  1FI7 A;  1I6E A;  1N90 A;  1CRG A;  1AKK A;  1PPJ D;  4RSZ A;  4FA4 A;  1CTJ A;  1KYO W;  3ZBM A;  5CIH B;  3BCC D;  2ZOO A;  3TGU D;  1S6V B;  1BGY D;  5CYT R;  1BE3 D;  1R0Q A;  4AAL A;  5IY5 1;  4O1W A;  1CTZ A;  4L3G A;  4V2K A;  2YCC A;  1NNO A;  1KX7 A;  3ZCF A;  4XXL A;  3ZIY A;  1HJ5 A;  2KNC B;  4O1Q A;  1K3G A;  5KAF V;  3VMA A;  4GYD A;  1H32 B;  4L3H A;  1DW2 A;  3L4M A;  3ZOW A;  5CID B;  1FI3 A;  3WFC C;  4D6T D;  1N9C A;  2B4Z A;  2D0W A;  1BL9 A;  4WQ8 A;  3H1L D;  4PD4 D;  1HCM A;  2N3Y A;  1MG2 D;  4FA5 A;  3DMI A;  1C6O A;  1FJ0 A;  3CYT I;  2DVH A;  4H0K A;  5KLV D;  2GC7 D;  1WEJ F;  1IRV A;  1YIC A;  2CE1 A;  2K9J B;  3A0B V;  3A0H V;  3JBT B;  4P4Q B;  3HQ9 A;  4UB6 V;  3FWL A;  1KB0 A;  3SLE A;  5CIF B;  1N15 A;  3TDK A;  4FA9 A;  2FYN B;  3HQ6 A;  3CXH W;  4PJ0 V;  1HRC A;  2A06 D;  4AAM A;  2PAC A;  1CC5 A;  3GG2 A;  1S5L V;  2C1V A;  2JWA A;  3GW6 A;  1CHH A;  3ITK A;  1KX2 A;  2N18 C;  1F1C A;  2YIU B;  1P84 D;  3O1Y A;  1C75 A;  1YEB A;  1CRI A;  2N9J A;  2KS1 A;  1CYC A;  4GED B;  4QAO A;  3RN1 A;  2RN0 A;  3HQ8 A;  1C6R A;  4Q5P A;  2EXV A;  3M97 X;  3CXH D;  1CRH A;  1HJ4 A;  3L73 D;  1CCH A;  1J3S A;  1SQP D;  2FWL A;  4WQ9 A;  3PHL A;  2C1U A;  3HQ7 A;  1YTC A;  4FAV A;  1AYG A;  1IO3 A;  5GTH V;  1SQB D;  2C1D A;  1C52 A;  1RZ5 A;  3O20 A;  2CE0 A;  3O0R C;  2B12 B;  1NU1 D;  3WFE C;  3CX5 D;  1LFM A;  1CIF A;  2LIT A;  4IL6 V;  1E2R A;  2YK3 A;  1GU2 A;  5CIB B;  3H1J D;  4FB1 A;  1YFC A;  5DFS A;  1CSU A;  4JCG A;  1CYI A;  4YE1 A;  3RN0 A;  1H33 B;  4WQC A;  2BH5 X;  3PXW A;  1QL3 A;  2AI5 A;  3CX5 W;  2FYU D;  1M6Z A;  1CRY A;  4WQB A;  1LS9 A;  2N9Y B;  4RJT A;  3ORV A;  1NIR A;  1OAE A;  1I55 A;  5B5E V;  3PRJ A;  3L4O A;  1LC1 A;  1H1O A;  3PLN A;  3NBS A;  5DF5 A;  1A2S A;  3MK7 B;  1QN2 A;  5E79 V;  1CHJ A;  1NTK D;  3WC8 A;  1DII C;  1CYJ A;  1KYO D;  1CO6 A;  1CRC A;  2I8F A;  3KHU A;  3H1I D;  4L1Q A;  1WVE C;  1IRW A;  2BH4 X;  4J20 A;  2QJY B;  1L9B C;  1RAP A;  3C2C A;  5KAI V;  3ZOY A;  1MZ4 A;  1GJQ A;  1C7M A;  3PTZ A;  3PH2 B;  351C A;  4U3F D;  3NBT A;  3DP5 A;  2JQR A;  2BCC D;  3RMZ A;  1VYD A;  2GIW A;  1QL4 A;  4AAN A;  2ZON G;  2N18 B;  1I8O A;  4UB8 V;  4WQE A;  1U74 B;  1H31 B;  5DJQ B;  1KIB A;  1YEA A;  4WQ7 A;  1I8P A;  1SQQ D;  3TYI A;  2C2C A;  4LJI A;  1GKS A;  2N9I A;  3WFD C;  3OA8 B;  3RLM A;  2C1D B;  1CXA A;  1EZV D;  1W2L A;  2CA4 B;  1C2R A;  3SXT A;  3OCD A;  1IQC A;  3MK7 C;  2L91 A;  3OCD B;  4EID A;  1CIH A;  1YIQ A;  3CU4 A;  5C0Z A;  4Y5R A;  2Q3E A;  2V07 A;  1L0L D;  3NWV A;  1CED A;  1KB9 D;  3L71 D;  1DVH A;  2O3J A;  1HRO A;  5C9M A;  2D0S A;  1NTM D;  5B6Q A;  3VYM A;  1CSV A;  3KZI V;  3L75 D;  4WQA A;  2B0Z B;  1DW3 A;  2N3B A;  1SQV D;  1RZ6 A;  2MTA C; 
#chains in the Genus database with same CATH topology
 1NTZ D;  2OYI C;  1NTM E;  1OVV A;  1KV4 A;  4I7Z B;  1N7S C;  2YXQ B;  3ZDM A;  1H33 A;  3CL3 D;  3UIA A;  4KT0 J;  2E76 D;  4XYD B;  1NHL A;  3BRV B;  2OZ1 A;  4PD4 E;  4PW9 B;  2GA1 A;  2FFD A;  2AXT H;  1N73 C;  4EIC A;  4L76 A;  2QG4 A;  1NMI A;  2QJK C;  1FZF A;  5CIE B;  2IBZ D;  3HUS B;  1ETP A;  4H44 C;  3B8E B;  2OQQ A;  3L70 D;  3H1H J;  2BAS A;  3L4F A;  2DGE A;  5AVX B;  1M60 A;  451C A;  2M8R A;  5CCG C;  1IFN A;  4GOE A;  2Y0C A;  1N86 A;  1YHQ P;  1DW0 A;  1IFI A;  4AAO A;  2H7H A;  4FAN A;  4N78 D;  2OYH B;  4ASV A;  5BVZ A;  5H2F E;  1X79 B;  3L71 G;  1MG3 D;  2V4H A;  1E8E A;  3E1I A;  1UIX A;  3AEF C;  4R4L A;  1DX7 A;  3JSV C;  5CIC B;  1SQQ G;  5AUR A;  3OA8 A;  4YXD C;  2WPR A;  2LKM A;  1QEX A;  2GM4 A;  2W6A A;  1CHI A;  3BVH A;  3CCR P;  3CD6 P;  3ZOX A;  2O1K A;  3GLM A;  1HJ3 A;  2PCB B;  1VQ4 P;  2P2U A;  3L75 G;  3G4S P;  2V08 A;  3WU2 E;  2JEE A;  2Z4E A;  3DR0 A;  1RAQ A;  2NRG A;  5APQ A;  1PFI A;  1LTT C;  1OW7 A;  1I5T A;  1J1E C;  4ZMD A;  1M90 Q;  1K04 A;  1GW3 A;  4IL6 E;  4RKU J;  3L71 J;  1E5W A;  1NGM B;  1KIL B;  2Y0D A;  3O5C A;  3CI9 A;  4NFG B;  1FZA A;  3L70 G;  1KYO I;  3H1H D;  2K1A A;  1PV3 A;  4PV1 B;  2P58 A;  3MZW B;  4HH2 A;  3P32 A;  3KDP B;  3SJL A;  1VF5 B;  2O01 H;  4JBZ A;  1LTI C;  3X39 A;  1S72 P;  1CXC A;  3Q5P A;  3PJS K;  2QJK B;  4RO0 A;  5B5E H;  1GU5 A;  3H1J G;  2C0W A;  2WT7 B;  1VDF A;  1SQX G;  1CSX A;  3WU2 V;  2I1K A;  3GMA A;  3CXH H;  3RK3 D;  2KK7 A;  5DJU B;  4H44 B;  3CXH E;  1FZB A;  1RE4 C;  1ZRT E;  4JYB A;  5KKZ C;  1KYO W;  5DJT B;  3BCC D;  2ZOO A;  1PZQ A;  3TGU D;  2OYH A;  4OVN F;  1LTB C;  3HE4 B;  4AAL A;  1BE3 E;  5CCG D;  1ZME C;  4V2K A;  1NOH A;  3JCU E;  3CCV P;  4W7Z A;  4NPE A;  1NNO A;  2E42 A;  1EDK A;  1G2C B;  4RES B;  3ZCF A;  4JYC A;  2RH0 A;  2KZI A;  1JMB A;  5KAF E;  3KZI E;  1HJ5 A;  1P84 E;  2ZYG A;  2JO1 A;  2BCC E;  2R3S A;  1K3G A;  4L3H A;  3D6Z A;  3ZOW A;  5CID B;  1L2P A;  1EDL A;  1JM0 A;  4BWN A;  1N9C A;  4IL6 X;  3RL0 g;  4WVZ A;  3NXS A;  2FKW B;  1SQP G;  1URQ A;  3H1L D;  4FA5 A;  1IFD A;  3SSU A;  1FJ0 A;  1OZH A;  2K9J A;  5KLV D;  2FY8 A;  1WEJ F;  1S1C X;  3AE5 C;  4O9B A;  1SFC C;  4C7N A;  1GD2 E;  2YO3 A;  1IK9 A;  4W80 A;  1T3U A;  1KB0 A;  3FWL A;  4UB8 E;  3SLE A;  3II6 A;  3USS A;  2N1T D;  3AEE C;  1BGY J;  2B9B A;  5E79 H;  1MZ9 A;  1GU4 A;  2R32 A;  4B86 A;  4PJ0 V;  1RE4 A;  1KQL A;  3KQG A;  1GL2 C;  1VF5 C;  2L5G B;  2PAC A;  1CC5 A;  3GW6 A;  1KX2 A;  1GMJ A;  1P84 D;  5CCH A;  1AVO A;  5AW4 B;  1SQP J;  3M9B A;  2KS1 A;  2FYU E;  3RN1 A;  2RN0 A;  3HQ8 A;  3B5N C;  1CRH A;  1BDD A;  3HRN A;  4PD4 H;  1J3S A;  2ZJS E;  1S9K D;  2AXT E;  3PHL A;  1GZL A;  2V7Q H;  4FAV A;  1AYG A;  1IO3 A;  2C1D A;  2YO2 A;  2CE0 A;  3O0R C;  3L72 E;  3PP5 A;  1KIL C;  2P7J A;  2E75 D;  1NU1 D;  2E43 A;  4CPG A;  2QM7 A;  3MGN A;  4IL6 V;  2P10 A;  1E2R A;  2YK3 A;  2M5A A;  1JCD A;  5AVZ B;  1GU2 A;  2WSF J;  3KPE A;  2JJL A;  3H1J D;  3P7K A;  5M1B A;  4FB1 A;  1YFC A;  1CSU A;  5BU5 A;  3M06 A;  4YE1 A;  2CPS A;  3CWB E;  1FDM A;  1SQP K;  1ZW0 A;  2BH5 X;  1N7S A;  2AI5 A;  3CX5 W;  1DD4 A;  3CMA P;  3FX0 A;  1H1O A;  3PLN A;  3F5H A;  2ZXX A;  1FZG A;  1W2E A;  1FE6 A;  2OAR A;  1OW6 A;  1CHJ A;  3V2N A;  1KYO D;  1WVE C;  1IRW A;  1FDI A;  4U3F J;  4IFD K;  2XDJ A;  2WSF H;  3B5N A;  3O6Q A;  1L9B C;  2W90 A;  3OA7 A;  1FZC C;  5APY A;  1DD3 A;  5CBN A;  351C A;  2IBZ G;  3D6Y A;  5B66 E;  2Q5U A;  4D6T J;  2JQR A;  1T8Z A;  3H1K E;  2KIK A;  1NAF A;  4WB4 A;  1N7S B;  1HVV A;  1S4X A;  4PJ0 E;  1L4A D;  1H31 B;  3NMD A;  5DJQ B;  1GL2 B;  5AVY B;  2BCC G;  3TYI A;  4LJI A;  1GKS A;  1VQK P;  2XNX A;  3H32 B;  3VP8 A;  2ZYD A;  3RLM A;  2C1D B;  2CA4 B;  3SXT A;  2FYU K;  1U57 A;  1FZC A;  2FFD B;  2N1T B;  3OCD B;  1WRG A;  2Q3E A;  3S4R A;  4UB6 H;  2QIW A;  4XA4 A;  1J1E B;  1GW4 A;  5AVQ B;  4Z1M H;  1NTZ G;  5APT A;  3Q5R A;  4DZO A;  1CED A;  2WSC J;  4DT0 A;  1OMI A;  1FDO A;  2D0S A;  1CSV A;  3KZI V;  3L75 D;  1FJK A;  4BRY B;  1UII A;  2R5B A;  1RQV A;  5KKZ B;  2JTI B;  2CA3 B;  3AEC C;  2W27 A;  4NPD A;  3R4Y A;  1HH7 A;  2PCC B;  1L0N G;  5H2F H;  5TJH A;  2HOD B;  2B11 B;  5KJ7 C;  2ZZS 1;  3AE9 C;  4PV1 D;  2XKM A;  2VHD A;  1VQ7 P;  1DIQ C;  3A5T A;  2NPS D;  5AW0 B;  5AW8 B;  1FOC A;  2IZ0 A;  3A0B E;  1VF5 D;  2PGD A;  3L37 A;  1FZC B;  4DOJ A;  3GHG A;  2GB8 B;  5AW6 B;  3HUS A;  2PP6 A;  1BCC G;  1H9X A;  1YJN P;  1IZL 0;  3VP9 A;  2Q3I A;  4IOI H;  3SWS A;  2IX7 C;  2J5U A;  4H13 C;  1YCC A;  5H2F V;  3WUU A;  3RL0 B;  1Q81 Q;  1QL2 A;  1I6D A;  2KB7 P;  4JPZ B;  3RK3 B;  2FBW C;  4EOT A;  1LT1 A;  1QKS A;  1VQ8 P;  3H1K D;  4UB8 H;  1LC2 A;  1H31 A;  1RF1 B;  1ZRT D;  1AQT A;  1Q7Y Q;  2WPV B;  5E79 E;  1LT9 C;  4I6M C;  2IYO A;  2Q1K A;  1CIE A;  2SPZ A;  1B7V A;  3ZOO A;  5KTB A;  3CP5 A;  3T97 A;  1Y8A A;  1DW1 A;  2WSE J;  4ASW A;  3PH0 A;  1KV9 A;  2LIR A;  1SQB J;  1ZZH A;  2PFX A;  4ZKU A;  2FFD C;  3A2A A;  1DT1 A;  3L74 G;  2BGV X;  1M70 A;  3L35 A;  3CCU P;  2YKO A;  1FI9 A;  3CPW O;  3MIW A;  4N0K A;  4K3I A;  5DJQ C;  3VNW A;  4OGQ D;  3VRD A;  2ZBO A;  2CXB A;  1CRJ A;  2B89 A;  3M9H A;  3TSI A;  3TF5 A;  1PL5 A;  5L8R J;  3VYI A;  4H13 D;  3RBX A;  3BRT B;  1HF9 A;  4PWA A;  2IPP A;  1EZV E;  3FXE A;  3CCS P;  1EB7 A;  2D2C D;  3P8C D;  3CC2 P;  3S1K A;  4KMG A;  2R3C A;  1KYO E;  2MJZ A;  2POH A;  4C7N B;  1S5L E;  1SQV J;  4DCK A;  3QH9 A;  3KZI H;  1SQV E;  1JY3 N;  2H89 C;  2D2C B;  2FRC A;  2BCN B;  1FHB A;  2BPB B;  1VQM P;  1EXJ A;  1IC2 A;  1LTJ A;  1OVU A;  2QJP B;  1FI7 A;  3Q5S A;  1CRG A;  4FA4 A;  4Y28 J;  1CTJ A;  3L70 J;  5CYT R;  4O1W A;  3D0W A;  2YCC A;  3AE4 C;  1KX7 A;  2E5T A;  5K5G B;  2QA4 P;  3NFQ A;  2AXC A;  1FS0 E;  2O01 J;  1NU1 E;  3ZIY A;  1LGH B;  4O1Q A;  5KAF V;  4AUW A;  4GYD A;  1H32 B;  2FXO A;  3L4M A;  1FI3 A;  4YTP C;  2HPC B;  3S9O A;  2D0W A;  1LT9 B;  3QWO C;  4PJ0 H;  1VQO P;  4WQ8 A;  3KYQ A;  3V5B A;  3CCJ P;  4WY4 A;  3CME P;  4PD4 D;  1RE3 C;  1URQ B;  1WMK A;  4XE5 B;  1A02 F;  2ZYA A;  3CYT I;  1HWT C;  1BCC J;  3SWY A;  2DVH A;  4H0K A;  1SQQ J;  2K9J B;  3A0B V;  3JBT B;  1NTZ E;  2MKV A;  1AJY A;  1ZN5 A;  1Q2N A;  1JY3 O;  2WIT A;  2N9B A;  3HQ6 A;  3EFG A;  4UB6 E;  1SQB K;  1FBM A;  2A06 D;  3ITK A;  3GG2 A;  1N7L A;  1NJI Q;  4PD4 I;  1FC2 C;  1C75 A;  1CRI A;  1N73 B;  1LP1 A;  1N2D C;  2XU6 A;  3AEB C;  1C6R A;  3G71 P;  3CXH D;  4I1L A;  2A45 G;  1CCH A;  1AA0 A;  2C1U A;  1NU1 J;  2JKV A;  2FYN C;  2ZFC A;  1YTC A;  1M1J B;  1QGK B;  5GTH V;  1GK6 A;  1LWU C;  3L74 E;  3O20 A;  3HD7 C;  1L4A B;  5APW A;  3L73 E;  3CX5 D;  3GHG C;  1LFM A;  1CIF A;  2LIT A;  1ZOY C;  4KJM A;  4OGQ B;  5AW1 B;  5AVV B;  1GL2 A;  3IR9 A;  4LC1 A;  1R5L A;  2HR3 A;  2UWJ E;  1RF0 C;  1SQB G;  3G6E P;  1QX8 A;  4C7R A;  4H44 D;  3H32 A;  3CCL P;  5DFS A;  3ABV C;  1PP9 G;  4JCG A;  1G2C A;  3H1L G;  4WQC A;  3CCE P;  3FXD A;  1Q86 Q;  4WQB A;  3WU2 H;  4OWF A;  1LT9 A;  4RJT A;  1VQP P;  3RK2 B;  1OAE A;  5B5E V;  1IK7 A;  3PRJ A;  5GTI H;  1USD A;  2QEX P;  3BAT A;  1BCC E;  5DF5 A;  1A2S A;  2M3B A;  1NU1 K;  1VQL P;  3HD7 A;  3A7O A;  2O1J A;  3WC8 A;  1R5S A;  2KSJ A;  2YMY A;  3CC7 P;  4L1Q A;  3M0D A;  4J20 A;  1JB0 J;  2E75 B;  2QJY B;  2H88 C;  2NPS B;  1YJW P;  1H0T B;  2N1T A;  1RAP A;  3C2C A;  1SLQ A;  3B5N B;  3HUS C;  1LTG C;  5GTH H;  3NBT A;  2O01 N;  3L72 G;  3RMZ A;  1VYD A;  3AE3 C;  4LGD E;  4AAN A;  3IFM A;  4N78 E;  2N18 B;  1I8O A;  4UB8 V;  1N73 A;  4K3A A;  2WPS A;  1ZP0 C;  3AEA C;  3EQ2 A;  3B71 A;  1SQX K;  2QSI A;  1GK4 A;  3SWF A;  2KOG A;  1SVF A;  3G9R A;  1DIP A;  1EZV D;  1W2L A;  5TIS H;  1YTZ T;  1DH3 A;  3JCU H;  2FXP A;  1KYO H;  1YI2 P;  1ZV8 A;  5TIS E;  3MK7 C;  4I7Z C;  2HFE D;  2IBZ E;  1KQG B;  3CWB J;  4EID A;  2HYN A;  3C8V A;  1U7J A;  3CU4 A;  1KN7 A;  4JF7 A;  3HE4 A;  3W68 A;  2YXR B;  1NYH A;  1L0L D;  1HH0 A;  1PPJ G;  1Q82 Q;  2IFM A;  3OAK A;  4N3Y B;  3L71 D;  3AEG C;  1LWU B;  1HRO A;  2ZAE B;  3LW5 H;  1NTM D;  3H1K G;  1N8R Q;  1SQV D;  2MTA C;  4EDF A;  3CXH I;  2HV4 A;  5AVU B;  1EQ7 A;  1IO4 A;  2BCC J;  2WSS H;  1E79 H;  1K9M Q;  3WUT A;  2R44 A;  3V4W A;  2V7Q J;  3PXT A;  1KTM A;  4A7P A;  1RHZ B;  1JCC A;  1BCC D;  1YNR A;  1RF1 C;  1NAY A;  4TT3 H;  3KXD A;  3MP7 B;  2LXC B;  3WUI A;  2OZ1 B;  2Z5H A;  2QJY C;  5AW9 B;  1U75 B;  4ZKP A;  2XTS B;  5CIG B;  1S5L X;  3W67 A;  1A8C A;  5GTI V;  2C8S A;  1CSW A;  3O6Q B;  1KB9 I;  3V4Q A;  2JP3 A;  4KHX A;  1K05 A;  2XV5 A;  2OYI B;  1COT A;  4YXW H;  3K5B A;  1COR A;  3L74 D;  1SQX D;  1PPJ E;  2QM8 A;  1M57 D;  3GF3 A;  1D7M A;  2KNC A;  3V2P A;  1LMS A;  1RY3 A;  1I54 A;  1OXZ A;  2OTK E;  1F1F A;  3AE7 C;  3CC4 P;  2Y9Z A;  1JY2 O;  4DJG A;  3T97 B;  1BGY G;  2L4D A;  2KP8 A;  1JTH B;  2KZJ A;  1L0N E;  1E29 A;  3AED C;  3VMY A;  1GIW A;  3WFB C;  1RQU A;  1OIP A;  4HKZ H;  2XND H;  3H1I E;  2YQB A;  1FCD C;  4EIF A;  1LWU A;  2A06 E;  1M1K Q;  2QE7 H;  1QYZ A;  4WBA A;  3EWK A;  3H1I G;  1USE A;  1URQ D;  4K35 A;  3A3Y B;  1L9J C;  2W83 C;  3RK3 C;  2A06 G;  1W5C E;  3B4S A;  3RL0 D;  1JOC A;  1PP9 E;  1KQF B;  4U7J A;  3NTN A;  2JR8 A;  3I56 P;  2KSE A;  2ZVN B;  2JDI H;  1T2K C;  1MFT A;  2BEZ F;  1EC5 A;  2ORL A;  4IFF A;  2HOD A;  2LR2 A;  3CCM P;  2BLF B;  1HJB A;  3L72 J;  2KLV A;  5APX A;  4H0L B;  1LTA C;  1NML A;  3U59 A;  1A56 A;  2YMK A;  3L75 E;  1H32 A;  4H0L C;  1C2N A;  5EFW B;  2GUS A;  2PRR A;  5EXQ A;  2AIU A;  1TU3 F;  3SVW A;  1WT6 A;  1I6E A;  2E74 C;  3V6I A;  1AKK A;  1N7S D;  4RSZ A;  2C0X A;  2Q7C A;  3D70 A;  3H1J J;  5KJ7 A;  3RBZ A;  1NTM J;  1JNM A;  1BGY D;  2FXM A;  1R0Q A;  5IY5 1;  3H1K J;  1SFC B;  5AVR B;  5KLI C;  1XTG B;  1AVY A;  2YNY A;  3WUV A;  2IYP A;  5GTH E;  2KLU A;  5CCG A;  4Y99 B;  2H43 A;  2G3A A;  3V2Q A;  1JY2 N;  4L73 A;  2PAJ A;  1IFM A;  2ZVO B;  3H1L J;  3MHV A;  1GDT A;  3FWN A;  2OYO A;  3WFC C;  3OW2 O;  1SQP E;  1OWA A;  1BL9 A;  1BE3 G;  5APU A;  1QVG O;  4D6T G;  1LP1 B;  1HCM A;  1MG2 D;  2N3Y A;  2OYH C;  2GC7 D;  3H1J E;  1BDC A;  1IRV A;  2QJP C;  2W6J H;  2LXB A;  4P4Q B;  3HQ9 A;  1NVO A;  2DW3 A;  4UB6 V;  1FOS F;  3V2R A;  2ZXE B;  1SQX J;  1OVR A;  1M1J C;  1NKZ B;  5CIF B;  1N15 A;  3TDK A;  1KB9 E;  2FYN B;  3U1A A;  2WMM A;  2C9L Y;  1SFC A;  5AVW B;  1SS1 A;  1KB9 H;  2JWD A;  1VQN P;  1S5L V;  2JWA A;  3A0B H;  2N18 C;  2OGU A;  2B87 B;  3I5C A;  2WSC H;  3Q1M A;  4HYT B;  1BE3 J;  4QAO A;  4GIF A;  3M97 X;  1DEE G;  3MUD A;  1VQ9 P;  1HJ4 A;  3L73 D;  1KIL E;  2E74 D;  2FWL A;  4WQ9 A;  3RK2 C;  1OFC X;  5GTI E;  3AE6 C;  1SQB D;  1MUU A;  1AQ5 A;  1RZ5 A;  3WFE C;  3H1I J;  4YPC A;  3D71 A;  2FYZ A;  1CSB A;  3TNU B;  3M91 A;  2WQY C;  1NTZ J;  2KXP B;  4GOD A;  1EDI A;  1RF1 A;  1VPC A;  2C9N Y;  1EZV I;  1SP4 A;  2Q6Q A;  1FZE A;  2IBZ I;  4MN4 C;  1T3J A;  1H33 B;  1PGP A;  3PXW A;  1QL3 A;  1KFN A;  2FYU D;  2J59 M;  1M6Z A;  2B87 A;  1LS9 A;  2N9Y B;  5AW5 B;  1LTS C;  3L4O A;  1MV8 A;  1NTM G;  1PGQ A;  3NBS A;  2WVR A;  5CJ0 A;  2N1T C;  1QN2 A;  1YIT P;  2AEF A;  2H8P D;  1NTK D;  1KOR A;  1JMM A;  3KHU A;  1CRC A;  2K3R A;  3H1I D;  1QVF O;  2BH4 X;  2ZT9 D;  5KJ7 D;  3MUD C;  1P84 I;  3H1H G;  5KAI V;  3ZOY A;  1MZ4 A;  2NPS A;  1IZN B;  3PTZ A;  3TGU E;  3PH2 B;  1ZR4 A;  1OW8 A;  5B5E E;  1MKM A;  2OTJ P;  2KYV A;  3H1L E;  2GIW A;  4LLH A;  5CJ4 A;  4L74 A;  3RK3 E;  1L0L K;  1SQB E;  4WQE A;  1LTJ C;  2J58 A;  3O8Z A;  2C2C A;  1VL2 A;  2IZ1 A;  3E7K A;  1Y9B A;  2KI7 B;  2K9Y A;  4HJG H;  3H1H E;  1IQC A;  5C39 A;  2I1J A;  5KAF H;  3HE5 B;  2WWW A;  2W6B A;  1JEK A;  3JC2 2;  1NKN A;  1YIQ A;  3RGU A;  1M8O B;  4L75 A;  4Y5R A;  1AV1 A;  2I8D A;  3L74 J;  1CZQ A;  5KLV J;  1L4A A;  2YKQ A;  1L4A C;  1KB9 D;  1DVH A;  2O3J A;  3BCC G;  5C9M A;  3VN0 A;  1Y47 A;  5B6Q A;  3VYM A;  3EFF K;  4XFJ A;  3P8C E;  1DW3 A;  1RZ6 A;  1NTK J;  3VTP C;  1L0L G;  1PGO A;  2E74 B;  1CI6 B;  3BCC J;  3A9F A;  1C6S A;  2HPC A;  3IAO A;  4OH8 B;  4WY4 D;  1T2K D;  1NTK K;  1J1D C;  4WY4 B;  4MU8 A;  1GDV A;  1RF0 A;  4I2L C;  1M56 D;  2NZ2 A;  3PXS A;  1K3H A;  1Q90 D;  5B66 V;  1CCR A;  3TK1 A;  4FA1 A;  2BEQ D;  3Q3D A;  1U7M A;  1YQ4 C;  1AOF A;  4EIJ A;  1G1J A;  3H6P A;  3TGU J;  1QL1 A;  2Y0E A;  3CWB D;  2XZR A;  1HBW A;  1OX3 A;  4N6J A;  1EXI A;  1JY3 P;  3Q2Y A;  2RMZ A;  2E5Y A;  4EI2 A;  1OCD A;  1K8A Q;  1LJ2 A;  2MHM A;  4DY9 A;  1BGY E;  3IF4 A;  1JDL A;  1KQS O;  155C A;  3AE8 C;  5AW3 B;  3G3Z A;  3L72 D;  1NTM K;  4H0J A;  1EZV G;  3VMZ A;  4EYY Q;  4EIE A;  1N50 A;  3L73 J;  1W5C T;  1KZU B;  3B5N D;  2OTL P;  1CNO A;  2ZT9 B;  2R5D A;  1HZU A;  4AX3 A;  1DVV A;  1CIG A;  1M1J A;  1BSN A;  2A45 H;  4WQD A;  1YTZ I;  4AYC A;  2C9X B;  1M7L A;  3A0H E;  1CTY A;  3A0H H;  2IFN A;  3L36 A;  1HJ0 A;  1Z56 A;  1PP9 D;  3MD0 A;  2GC4 D;  5CBO A;  1FJP A;  2AXT V;  1KIL A;  1FAV A;  5KLI B;  1X9V A;  3RL0 C;  1H88 A;  2ZXY A;  1YJ9 P;  3TYY A;  5KLV E;  1H9Y A;  1KFM A;  1AOQ A;  3BAS A;  5TIS V;  1L0N D;  1NO4 A;  5KAI H;  5CMZ A;  4JQ0 D;  1GQ1 A;  1NTK E;  2E75 C;  1FOS E;  1KMI Z;  4GDO A;  4NPF X;  4M3L A;  1JY2 P;  2B10 B;  3CX5 E;  1EDJ A;  1H0T A;  1L0N J;  1HZV A;  1KD1 Q;  4U3F G;  4W7Y A;  1N90 A;  1PPJ D;  1SQX E;  2FYU G;  1HTL C;  2P67 A;  5CIH B;  3ZBM A;  1SQQ K;  3I55 P;  3R2P A;  1H8A A;  1XTC C;  1S6V B;  4QMA A;  1BE3 D;  1CTZ A;  2M3E A;  4L3G A;  2AEJ A;  3HTK B;  4BXL A;  3IN6 A;  4C46 A;  2QRX A;  2OYI A;  1NTK G;  1PP9 J;  2P1J A;  4XXL A;  1URQ C;  2KNC B;  1SQQ E;  1NU1 G;  1X22 A;  1IJD B;  1ZXG A;  3VMA A;  1VQ5 P;  1ZLL A;  1DW2 A;  4D6T D;  5KLV G;  1A02 J;  2B4Z A;  1PIX A;  2GUV A;  5AW7 B;  1KIL D;  4GT1 A;  1HUC A;  2CPB A;  5CCH C;  1JTH A;  3DMI A;  3GF7 A;  1C6O A;  4H0L D;  3C1L A;  3H25 A;  2HLO A;  4OGQ C;  2ZT9 C;  3GHG B;  1YIC A;  5AW2 B;  2CE1 A;  1X8Y A;  1MFZ A;  3A0H V;  2Q9I A;  3VMX A;  3N4X A;  1T6A A;  3LW5 J;  2WSE H;  2VRS A;  1KC8 Q;  1H89 A;  2B88 A;  1P84 H;  4FA9 A;  3L71 E;  3U1C A;  2WT7 A;  3HTK A;  3CXH W;  4AQR D;  1HRC A;  1HGZ A;  3AE1 C;  4AAM A;  1L0L E;  1S2E A;  2YKP A;  2W8Z A;  3CLQ A;  2C1V A;  1CHH A;  2NPS C;  1RH5 B;  1R8E A;  1F1C A;  4PV1 C;  2YIU B;  1VQ6 P;  3O1Y A;  3L73 G;  1SQV K;  1YEB A;  2KS1 B;  1CW5 A;  2N9J A;  2AEM A;  1J2J B;  1J1D B;  1SQV G;  4WY4 C;  1CYC A;  4GED B;  5KLV K;  1YQ3 C;  4Q5P A;  2EXV A;  4WWI A;  1JUN A;  3M0D C;  1SQP D;  5APS A;  1IFJ A;  1YBK A;  3HQ7 A;  4IL6 H;  3N7N A;  1G1I A;  5BU8 B;  1NTZ K;  1C52 A;  2E76 B;  1IFP A;  1QLE D;  3TGU G;  1S9K E;  2B12 B;  5CCH D;  1PGJ A;  2HG5 D;  3SFD C;  3MTU E;  3TNU A;  4Y99 C;  5CIB B;  1CYI A;  4HB1 A;  3RN0 A;  3SFE C;  3HD7 B;  1L0N K;  3OJA B;  3L70 E;  4ZNC A;  3HD7 D;  2Z5I A;  1CRY A;  2M0B A;  1NWQ A;  4R4M A;  2WZ7 A;  3ORV A;  1NIR A;  1I55 A;  3CWB G;  1LC1 A;  3MK7 B;  1GL2 D;  1NH4 A;  3WMM 0;  4H13 B;  5E79 V;  1GTW A;  1DII C;  2Y9Y A;  1DEB A;  1HGV A;  2WTY A;  1CYJ A;  2KUB A;  1CO6 A;  4IFM A;  2I8F A;  2YIU C;  3LID A;  1CI6 A;  1LTJ B;  2K37 A;  1S5L H;  1GJQ A;  1C7M A;  3HE5 A;  3RK2 D;  4U3F D;  3DP5 A;  3CCQ P;  2BCC D;  2D2C C;  3P8M C;  1YIJ P;  1QL4 A;  5CHX A;  5AVS B;  2ZON G;  1FU1 A;  4D6T E;  3C9I A;  1U74 B;  1S3J A;  1ZR2 A;  1KIB A;  1YEA A;  4WQ7 A;  1I8P A;  1SQQ D;  2M5A B;  3E1R A;  3AE2 C;  1X0T A;  1L0L J;  2N9I A;  3BCC E;  2A45 I;  3WFD C;  3OA8 B;  3VOP A;  1CXA A;  1C2R A;  1AFO A;  1W2B O;  3OCD A;  5KAI E;  3F89 A;  1BSH A;  2L91 A;  1RE3 A;  1YYC A;  2K88 A;  2ITA A;  5B66 H;  1CIH A;  5APV A;  1LNQ A;  5C0Z A;  5AVT B;  2IDB A;  3CX5 I;  3M9Q A;  2FYU J;  1SFC D;  3FGA D;  2V07 A;  1JO5 A;  3CX5 H;  3L75 J;  1K73 Q;  4U3F E;  4GOF A;  3LIE A;  3NWV A;  4GKG A;  3SWK A;  2E76 C;  4BRY A;  2CK3 H;  2QVA A;  4WQA A;  3M0A A;  2B0Z B;  2N3B A;  2G8Y A;  2RKL A;  2WPQ A;  4TLF A; 
#chains in the Genus database with same CATH homology
 1NTZ D;  4EDF A;  5KKZ B;  2HV4 A;  2JTI B;  2CA3 B;  1H33 A;  3A9F A;  1C6S A;  1HH7 A;  4XYD B;  2OZ1 A;  3PXT A;  2PCC B;  4PW9 B;  5TJH A;  4EIC A;  2B11 B;  2QG4 A;  2ZZS 1;  4A7P A;  4MU8 A;  1BCC D;  1NMI A;  1YNR A;  2VHD A;  1GDV A;  1DIQ C;  5CIE B;  3PXS A;  1K3H A;  2IBZ D;  1FOC A;  5B66 V;  1CCR A;  4FA1 A;  3WUI A;  1ETP A;  2GB8 B;  1AOF A;  2OZ1 B;  1H9X A;  3L70 D;  1U75 B;  2Y0E A;  3CWB D;  2XTS B;  5CIG B;  2DGE A;  1IZL 0;  1M60 A;  1A8C A;  3SWS A;  451C A;  5GTI V;  2RMZ A;  2C8S A;  1CSW A;  2Y0C A;  1YCC A;  5H2F V;  1OCD A;  1I6D A;  2MHM A;  1DW0 A;  4DY9 A;  4AAO A;  1QKS A;  1JDL A;  4FAN A;  155C A;  3H1K D;  3L72 D;  1COT A;  4H0J A;  1LC2 A;  1H31 A;  1COR A;  3L74 D;  1N50 A;  1SQX D;  4EIE A;  1MG3 D;  1ZRT D;  1E8E A;  1W5C T;  1LMS A;  5CIC B;  1CIE A;  5AUR A;  1CNO A;  1I54 A;  3OA8 A;  1F1F A;  1B7V A;  3ZOO A;  3CP5 A;  1HZU A;  1DW1 A;  4AX3 A;  1DVV A;  1CHI A;  1KV9 A;  1CIG A;  2LIR A;  2L4D A;  1ZZH A;  3ZOX A;  4WQD A;  1E29 A;  1HJ3 A;  2PCB B;  1GIW A;  2C9X B;  3WFB C;  2V08 A;  1DT1 A;  1CTY A;  3DR0 A;  1RAQ A;  2BGV X;  1M70 A;  1FI9 A;  2YQB A;  1FCD C;  4EIF A;  1I5T A;  4N0K A;  4K3I A;  1PP9 D;  1QYZ A;  5DJQ C;  2GC4 D;  3VNW A;  2AXT V;  1L9J C;  3VRD A;  2ZBO A;  2CXB A;  1CRJ A;  5KLI B;  2Y0D A;  3TF5 A;  3O5C A;  2ZXY A;  4NFG B;  1H9Y A;  3H1H D;  4PWA A;  1AOQ A;  1EB7 A;  4KMG A;  5TIS V;  1L0N D;  2ORL A;  3SJL A;  1GQ1 A;  2BLF B;  3X39 A;  1CXC A;  2QJK B;  2FRC A;  1NML A;  1A56 A;  2BCN B;  1H32 A;  1C2N A;  1FHB A;  2B10 B;  2BPB B;  1CSX A;  3WU2 V;  5EXQ A;  2AIU A;  2QJP B;  1HZV A;  3SVW A;  1FI7 A;  1I6E A;  1N90 A;  1CRG A;  1AKK A;  1PPJ D;  4RSZ A;  4FA4 A;  1CTJ A;  1KYO W;  3ZBM A;  5CIH B;  3BCC D;  2ZOO A;  3TGU D;  1S6V B;  1BGY D;  5CYT R;  1BE3 D;  1R0Q A;  4AAL A;  5IY5 1;  4O1W A;  1CTZ A;  4L3G A;  4V2K A;  2YCC A;  1NNO A;  1KX7 A;  3ZCF A;  4XXL A;  3ZIY A;  1HJ5 A;  2KNC B;  4O1Q A;  1K3G A;  5KAF V;  3VMA A;  4GYD A;  1H32 B;  4L3H A;  1DW2 A;  3L4M A;  3ZOW A;  5CID B;  1FI3 A;  3WFC C;  4D6T D;  1N9C A;  2B4Z A;  2D0W A;  1BL9 A;  4WQ8 A;  3H1L D;  4PD4 D;  1HCM A;  2N3Y A;  1MG2 D;  4FA5 A;  3DMI A;  1C6O A;  1FJ0 A;  3CYT I;  2DVH A;  4H0K A;  5KLV D;  2GC7 D;  1WEJ F;  1IRV A;  1YIC A;  2CE1 A;  2K9J B;  3A0B V;  3A0H V;  3JBT B;  4P4Q B;  3HQ9 A;  4UB6 V;  3FWL A;  1KB0 A;  3SLE A;  5CIF B;  1N15 A;  3TDK A;  4FA9 A;  2FYN B;  3HQ6 A;  3CXH W;  4PJ0 V;  1HRC A;  2A06 D;  4AAM A;  2PAC A;  1CC5 A;  3GG2 A;  1S5L V;  2C1V A;  2JWA A;  3GW6 A;  1CHH A;  3ITK A;  1KX2 A;  2N18 C;  1F1C A;  2YIU B;  1P84 D;  3O1Y A;  1C75 A;  1YEB A;  1CRI A;  2N9J A;  2KS1 A;  1CYC A;  4GED B;  4QAO A;  3RN1 A;  2RN0 A;  3HQ8 A;  1C6R A;  4Q5P A;  2EXV A;  3M97 X;  3CXH D;  1CRH A;  1HJ4 A;  3L73 D;  1CCH A;  1J3S A;  1SQP D;  2FWL A;  4WQ9 A;  3PHL A;  2C1U A;  3HQ7 A;  1YTC A;  4FAV A;  1AYG A;  1IO3 A;  5GTH V;  1SQB D;  2C1D A;  1C52 A;  1RZ5 A;  3O20 A;  2CE0 A;  3O0R C;  2B12 B;  1NU1 D;  3WFE C;  3CX5 D;  1LFM A;  1CIF A;  2LIT A;  4IL6 V;  1E2R A;  2YK3 A;  1GU2 A;  5CIB B;  3H1J D;  4FB1 A;  1YFC A;  5DFS A;  1CSU A;  4JCG A;  1CYI A;  4YE1 A;  3RN0 A;  1H33 B;  4WQC A;  2BH5 X;  3PXW A;  1QL3 A;  2AI5 A;  3CX5 W;  2FYU D;  1M6Z A;  1CRY A;  4WQB A;  1LS9 A;  2N9Y B;  4RJT A;  3ORV A;  1NIR A;  1OAE A;  1I55 A;  5B5E V;  3PRJ A;  3L4O A;  1LC1 A;  1H1O A;  3PLN A;  3NBS A;  5DF5 A;  1A2S A;  3MK7 B;  1QN2 A;  5E79 V;  1CHJ A;  1NTK D;  3WC8 A;  1DII C;  1CYJ A;  1KYO D;  1CO6 A;  1CRC A;  2I8F A;  3KHU A;  3H1I D;  4L1Q A;  1WVE C;  1IRW A;  2BH4 X;  4J20 A;  2QJY B;  1L9B C;  1RAP A;  3C2C A;  5KAI V;  3ZOY A;  1MZ4 A;  1GJQ A;  1C7M A;  3PTZ A;  3PH2 B;  351C A;  4U3F D;  3NBT A;  3DP5 A;  2JQR A;  2BCC D;  3RMZ A;  1VYD A;  2GIW A;  1QL4 A;  4AAN A;  2ZON G;  2N18 B;  1I8O A;  4UB8 V;  4WQE A;  1U74 B;  1H31 B;  5DJQ B;  1KIB A;  1YEA A;  4WQ7 A;  1I8P A;  1SQQ D;  3TYI A;  2C2C A;  4LJI A;  1GKS A;  2N9I A;  3WFD C;  3OA8 B;  3RLM A;  2C1D B;  1CXA A;  1EZV D;  1W2L A;  2CA4 B;  1C2R A;  3SXT A;  3OCD A;  1IQC A;  3MK7 C;  2L91 A;  3OCD B;  4EID A;  1CIH A;  1YIQ A;  3CU4 A;  5C0Z A;  4Y5R A;  2Q3E A;  2V07 A;  1L0L D;  3NWV A;  1CED A;  1KB9 D;  3L71 D;  1DVH A;  2O3J A;  1HRO A;  5C9M A;  2D0S A;  1NTM D;  5B6Q A;  3VYM A;  1CSV A;  3KZI V;  3L75 D;  4WQA A;  2B0Z B;  1DW3 A;  2N3B A;  1SQV D;  1RZ6 A;  2MTA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...