1SQQD

Crystal structure analysis of bovine bc1 with methoxy acrylate stilbene (moas)
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
total genus 51
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1sqqD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1sqqD02
2DGEA 2FRCA 2OZ1A 5DF5A 4AX3A 1FHBA 1A56A 1N90A 3L75D 1DW2A 1NIRA 2PACA 3TDKA 1KX2A 451CA 3L72D 1GU2A 2Y0DA 1IZL0 1IO3A 1E29A 2ZOOA 4H0KA 1P84D 3DP5A 4WQDA 1CCHA 1H32B 5KKZB 1LC2A 1A8CA 1M6ZA 3CX5D 1GIWA 2ZZS1 1CYCA 3PXWA 1YCCA 1AKKA 3PLNA 1KYOW 1N15A 1CSUA 4EICA 5CIGB 3L70D 1W5CT 1KYOD 3ZOYA 2XTSB 5CIEB 1H32A 2FYNB 1MZ4A 2N18C 4MU8A 3H1LD 2IBZD 2C1DB 1NMIA 1AYGA 3ZOXA 3PTZA 1CTYA 1BGYD 1I8OA 4FAVA 1QKSA 1U75B 2YCCA 3FWLA 2FWLA 3CYTI 3RLMA 5GTHV 2JQRA 1H1OA 3A0BV 1IRWA 2JWAA 4QAOA 1YEBA 3MK7B 1ZRTD 1K3GA 2AI5A 3L4OA 3SWSA 3L4MA 5AURA 4WQEA 3SLEA 3NBSA 1OCDA 3RN0A 3M97X 1I6DA 2A06D 1LFMA 2KNCB 4FA4A 1DW3A 2Y0EA 2YQBA 2LIRA 4EIFA 3SXTA 4AANA 4O1WA 5E79V 1YFCA 2Q3EA 3OCDA 3WU2V 2BPBB 5H2FV 4Q5PA 4Y5RA 2Y0CA 1KIBA 1CRGA 1J3SA 1NTZD 2V07A 2ZONG 1IRVA 2MHMA 3TF5A 4AAOA 2HV4A 2L4DA 3ZOOA 4JCGA 4UB8V 2L91A 3OCDB 3PH2B 3PRJA 1BCCD 1GKSA 1I8PA 4A7PA 1KX7A 2OZ1B 1JDLA 4J20A 3ZBMA 1YICA 3O20A 1QYZA 1CRCA 3CXHW 2C1DA 3H1ID 2C1UA 1RAPA 4FA1A 1N9CA 5TJHA 5KLVD 3VYMA 2CE1A 4WQBA 3HQ7A 1CRHA 1FOCA 2O3JA 3KZIV 1DVHA 1DIIC 1FI3A 1COTA 3C2CA 1I54A 2PCCB 3X39A 2N3BA 1AOFA 1U74B 2JTIB 4XYDB 1KV9A 4PWAA 3PXTA 4L1QA 1CCRA 1CIHA 1RZ5A 4FANA 2D0WA 4O1QA 4YE1A 1IQCA 2CA3B 4AAMA 4LJIA 3ZCFA 1CC5A 3PHLA 2N18B 2N9IA 5DFSA 1F1FA 5KAIV 1SQPD 5B5EV 1FCDC 1F1CA 4H0JA 3OA8A 2CE0A 1AOQA 2RMZA 5EXQA 5CIHB 1E2RA 3WFEC 155CA 1CO6A 3ORVA 1GQ1A 1PP9D 1S5LV 3CX5W 1NTMD 2C9XB 4UB6V 3BCCD 4XXLA 5KLIB 3OA8B 1CXCA 4WQ7A 4L3GA 1CYIA 1ZZHA 3HQ6A 1CSVA 3H1JD 1CSWA 1HJ5A 2BH4X 5KAFV 1L0LD 1I55A 2I8FA 1HZUA 3WFBC 3KHUA 3VRDA 5CIDB 1CRJA 2MTAC 1CHJA 2C1VA 3NWVA 1CIEA 1SQQD 5GTIV 5B66V 2BGVX 2ZXYA 3SVWA 2GC7D 1BE3D 3WFCC 5B6QA 1DVVA 2ZBOA 1DIQC 1R0QA 1QL4A 2CXBA 3RN1A 2BCNB 1FI9A 3TGUD 1B7VA 5DJQB 1CEDA 3A9FA 2GC4D 4GEDB 3GG2A 4RSZA 4EDFA 3PXSA 1C52A 1YEAA 1LMSA 1MG2D 4PD4D 1KB9D 2QJKB 1C6SA 5CYTR 3ITKA 1H31B 2GIWA 4FB1A 3O1YA 1CNOA 3VNWA 4AALA 1C6RA 3WFDC 3CWBD 1FI7A 2YK3A 2EXVA 2ORLA 3L74D 5DJQC 2AIUA 3SJLA 2FYUD 4FA9A 1LS9A 1HJ4A 4L3HA 2LITA 3CXHD 5TISV 1DT1A 2YIUB 2GB8B 1C2NA 1ETPA 2B12B 3DMIA 2B10B 2VHDA 1CXAA 1SQBD 3ZOWA 5C9MA 1BL9A 3RMZA 1M60A 1CHHA 2K9JB 2B11B 1CORA 4FA5A 3L73D 3H1HD 1S6VB 3HQ8A 351CA 1RAQA 4U3FD 3TYIA 1M70A 4RJTA 1H33B 1QN2A 2N3YA 1YTCA 1H9YA 3CU4A 2B0ZB 1NNOA 2B4ZA 2C2CA 1E8EA 2KS1A 2QJPB 2QG4A 1VYDA 3WUIA 3CP5A 1N50A 1OAEA 5CIBB 1WVEC 3A0HV 1RZ6A 1GDVA 1K3HA 1CIGA 4EIEA 1I6EA 3VMAA 4WQAA 2CA4B 1MG3D 2QJYB 2N9YB 1DW1A 1YIQA 2BCCD 1DW0A 1HROA 4DY9A 5C0ZA 3NBTA 4WQCA 1HZVA 3HQ9A 1H31A 1PPJD 2C8SA 1CRYA 3JBTB 3O5CA 1SQXD 1LC1A 4V2KA 1CYJA 1C75A 1CIFA 1A2SA 3DR0A 4PJ0V 1KB0A 1L9BC 2PCBB 1L0ND 1L9JC 3WC8A 1C6OA 1SQVD 1GJQA 1C2RA 1NMLA 3ZIYA 4WQ8A 1HJ3A 2AXTV 3MK7C 1QL3A 1EB7A 3O0RC 2RN0A 3GW6A 4IL6V 1YNRA 2BLFB 1CTJA 4WQ9A 4KMGA 5CICB 4D6TD 1CTZA 1CRIA 2BH5X 4PW9B 2N9JA 3H1KD 1H33A 2D0SA 1CHIA 1EZVD 4P4QB 1FJ0A 3L71D 1H9XA 1HRCA 2DVHA 4NFGB 4GYDA 1NU1D 1CSXA 1HH7A 1W2LA 1NTKD 2V08A 5CIFB 1I5TA 1C7MA 1WEJF 1HCMA 4EIDA 5IY51 4N0KA 4K3IA
chains in the Genus database with same CATH superfamily
4AX3A 2AEMA 5AW3B 3HE4B 5KLIC 1EDKA 1NIRA 3M91A 5CBOA 1Y47A 1GU2A 1SQQG 2Y0DA 1KQFB 1P84D 3DP5A 1SQQE 4WQDA 1CCHA 5KJ7A 2R3CA 1ZR2A 1LTJC 1A8CA 1M6ZA 1GIWA 2ZZS1 1YCCA 1KB9E 5APXA 2BCCE 1CSUA 3RL0B 5CIGB 4GIFA 3H1KJ 1KORA 3L74G 1KV4A 1KYOD 3P32A 2XTSB 4DOJA 2FYNB 2N18C 4MU8A 1NKNA 1NOHA 3AE2C 1NYHA 2MKVA 1X79B 2KK7A 3TNUA 2QM7A 2W27A 3VOPA 1BGYD 1L4AC 1NTZE 1U75B 2W8ZA 3AE3C 2FWLA 1KFNA 1SQVK 4YTPC 4JF7A 3RLMA 1H1OA 3A0BV 2CPSA 4H0LC 1L2PA 3H1HE 2JEEA 1ZRTD 4WY4B 1YTZT 4ASWA 1X22A 3CMEP 4OH8B 1FOSF 2AI5A 5B66E 3L4MA 2NPSD 2M0BA 2NPSC 1VPCA 3TK1A 4U3FJ 3IAOA 4KT0J 1LWUB 3NMDA 2XZRA 2R5DA 2KUBA 3Q5SA 5AW1B 4FA4A 1LTBC 1FDIA 4O1WA 1EXJA 2M8RA 3KXDA 2BPBB 4Q5PA 1KFMA 1AVOA 1BSNA 4Y5RA 2PAJA 2Y0CA 1DH3A 3CCUP 1KIBA 4I6MC 2HFED 4UB8H 1VQKP 3TF5A 4AUWA 2A45G 3PH2B 3PRJA 3RK2C 1BCCD 1GKSA 1RH5B 2YO3A 3NFQA 4LLHA 1QYZA 1CRCA 3CXHW 1LJ2A 5M1BA 4FA1A 1JY3N 2IZ0A 2ZYDA 4ASVA 2CE1A 3M0DC 1U57A 1QVGO 1FOCA 1USDA 3E1IA 1QVFO 3CX5E 3CXHH 3D70A 1Q7YQ 3SWKA 1EXIA 3C2CA 2B9BA 1KD1Q 1VQ9P 1VDFA 1N7SA 1PPJG 1FBMA 1CCRA 3B4SA 1RZ5A 4H13C 1DX7A 1L0LG 1E5WA 4O1QA 1QL1A 5DJTB 1OW7A 2E5TA 1S3JA 3T97B 1SS1A 1LTJA 1CC5A 3PHLA 3H6PA 3W68A 5DFSA 3GF3A 5AVUB 3LIEA 3TNUB 1BCCJ 1F1FA 3TGUJ 1L0NE 1X0TA 3L75G 1F1CA 1FZCB 4DJGA 1SLQA 3H1JJ 2K37A 3CLQA 3CC7P 1ZLLA 2LXBA 5AVYB 1J1EB 1LNQA 2Q3IA 1M1JC 4UB6V 4PD4I 2R5BA 4OVNF 3L4FA 3OA8B 2ITAA 3MD0A 1KYOH 2C0WA 1CSWA 3W67A 3GLMA 3V2QA 1GD2E 3L70G 1FZBA 1HZUA 1NVOA 1LP1B 3KHUA 1G1JA 1L0NJ 1PFIA 1PIXA 5AVWB 1ZXGA 1VQ5P 3KZIE 5K5GB 3CI9A 3I5CA 5GTIV 5B66V 3SVWA 2ZXXA 2NPSA 2ZBOA 3H1IG 5AVZB 1YTZI 1VQPP 1JMBA 1URQD 4H0LD 1B7VA 4K35A 2E76D 1BDDA 3EFGA 1KYOE 3A9FA 2XNXA 1LGHB 4N6JA 1YEAA 4PD4D 3MGNA 1KB9D 2ZFCA 4WVZA 1C6SA 5CYTR 3H1LG 1Q2NA 1K73Q 4L76A 4AALA 2B87A 3OA7A 4I7ZB 4JBZA 4HKZH 2Z5HA 3WFDC 2YKQA 5APVA 1HGVA 3A0HE 2QA4P 1FI7A 2EXVA 2ORLA 1IFDA 1T6AA 4EI2A 3CCMP 2A06G 1BGYG 4IOIH 5TISV 1SQBE 1C2NA 2WMMA 2B10B 1H0TB 3ZOWA 2VRSA 2JKVA 1NAYA 2N9BA 3B5ND 2IZ1A 3L72G 1LT1A 1SQPE 3H1HD 2FYNC 5KJ7D 2J59M 3TYIA 1M70A 1NU1J 3KYQA 3BASA 1BDCA 1FZEA 1U7JA 4XA4A 1WT6A 2V7QH 4RKUJ 2LKMA 5AW9B 1VQOP 4D6TE 2B4ZA 2KS1A 2QJPB 4PV1B 3CP5A 2E76C 3AECC 4RESB 1LTAC 5KAFE 4D6TJ 2AEJA 3QWOC 2ZXEB 2CA4B 1MG3D 2QJYB 2IYOA 1X9VA 1BE3E 2BCCD 1HROA 1W5CE 5C0ZA 4UB8E 1S4XA 3GHGC 3AEAC 1OFCX 4IL6X 1TU3F 5L8RJ 2JDIH 3CCRP 2ZYAA 2YKPA 1SQXD 3PP5A 1Q86Q 4UB6E 1M1JA 3DR0A 4L73A 1PZQA 1C2RA 1L0LE 1NMLA 1ZV8A 3ZIYA 1G2CA 2N1TC 4M3LA 4YXDC 2L5GB 1FZFA 3VP8A 1EB7A 3R2PA 2RN0A 3GW6A 3EWKA 3CX5I 4WQ9A 3FWNA 1JCCA 4RO0A 1CTZA 1CRIA 1OW6A 5AVSB 3L75J 4Y99C 2O01J 3H1JE 3H1JG 1DEBA 1KYOI 1WRGA 3WUVA 1YJNP 2YO2A 2KSEA 2OYOA 2QIWA 3L71D 1HUCA 4HH2A 3N4XA 4KHXA 1OMIA 3L73E 1NTKD 4HB1A 3L71J 1HCMA 4EIDA 3RL0g 1P84I 5KAFH 3AE4C 2UWJE 4K3IA 2FRCA 2OZ1A 2G3AA 3AEEC 1FHBA 2C9LY 3L75D 1FJKA 5AW5B 2PACA 2GA1A 1SP4A 451CA 4EIJA 3L72D 1KB9H 2ZOOA 3IR9A 1H8AA 2Q5UA 3PH0A 1H32B 1LC2A 2KI7B 2LR2A 1CYCA 3PXWA 3M9QA 1KYOW 1K04A 5KLVK 1N15A 4EICA 2DW3A 3A0HH 4C7NA 1IFJA 3H1IJ 3H1HG 1R8EA 2KZIA 2NRGA 5APYA 2C1DB 1AYGA 2WSFH 1IK9A 2Q6QA 1NTKK 4WY4A 1NHLA 1QKSA 2WSCJ 2YCCA 4WWIA 1E79H 1Y9BA 2IFMA 1VQMP 1NTZK 2H88C 1H88A 5TISE 3CYTI 1QL2A 1AVYA 4QMAA 2JQRA 1SQPG 3AEDC 3L72E 3I55P 1PV3A 1JY2P 1K3GA 2FXMA 2QEXP 1SQXE 3L4OA 3SWSA 1SQBG 2IYPA 3V4WA 1OW8A 5GTIE 4WQEA 3SLEA 3NBSA 3HUSC 2YIUC 1DW3A 3G71P 3SXTA 3QH9A 1YFCA 3H1LE 5H2FV 3U59A 2A45I 2WT7A 1CRGA 3K5BA 1NTZD 2V07A 2B89A 4L74A 2MHMA 4H0LB 2L91A 1HF9A 1URQC 4DZOA 1I8PA 4A7PA 1GDTA 1JDLA 4J20A 3KDPB 3ZBMA 3BRVB 1HTLC 2P10A 1N9CA 2W83C 5KLVD 2OTJP 2W6JH 3HQ7A 2IBZG 1CRHA 1FDMA 3KZIV 1GL2A 3O6QB 3TGUE 1DVHA 1PP9G 3IN6A 4ZMDA 2WSCH 1W2EA 1EC5A 3L70E 1AOFA 4PD4E 4FANA 1IQCA 2RKLA 4LJIA 2R44A 2YMKA 2OQQA 3RK3C 1LWUA 2N18B 3CCJP 2AXTH 4KJMA 2Z4EA 1SQPD 3AE8C 5B5EV 1FCDC 1SFCC 4NPFX 2M3EA 1FAVA 2HLOA 1T2KC 1FOSE 1SFCD 3TSIA 5CIHB 2XU6A 2PP6A 3ORVA 1BSHA 3V5BA 3CX5W 3TYYA 4AQRD 3BCCD 1KB9I 4XXLA 2KOGA 2GM4A 2KSJA 1FJPA 4WY4C 2BCCJ 1CSVA 3H1JD 4ZKUA 3KZIH 5KAFV 1PPJE 4W7YA 1L0LD 3CC2P 2QM8A 1EQ7A 2JO1A 3G6EP 1K05A 1KQLA 5CIDB 1RE3C 2KP8A 1JM0A 3Q1MA 1NTMK 1KTMA 2WSSH 5B66H 2C1VA 1VF5C 1SQQD 1P84E 5BU5A 4U3FE 1N7SB 4H44C 2ZXYA 1BE3D 1DIQC 3L74J 4I2LC 1VF5B 2D2CC 3L71E 1QL4A 2CXBA 3RN1A 3RK2D 2OARA 3H1HJ 1HVVA 2K88A 5DJQB 1KILD 1CEDA 4EDFA 1HWTC 3AE1C 1LMSA 2K9YA 2QJKB 2E42A 3S1KA 1S5LE 1AQ5A 3O1YA 1FE6A 4O9BA 3L35A 1GZLA 3MP7B 3RBZA 2QJPC 3RK3D 3CWBD 1M1JB 2OYIA 1HJ4A 4L3HA 1R5SA 2LITA 2FY8A 2I1JA 1SQBJ 3RGUA 4PJ0H 3HTKA 1GU4A 3MUDC 4W7ZA 1SQBD 1LTJB 3EQ2A 3RMZA 1YITP 1CHHA 3USSA 2ZJSE 3HQ8A 3CWBJ 1RAQA 4U3FD 3RBXA 4RJTA 4YXWH 2E74D 1H9YA 2GUVA 2YMYA 1KC8Q 1NNOA 1RHZB 1E8EA 1MV8A 3LIDA 3II6A 3PJSK 1MFTA 1EDLA 3WUIA 4BRYB 4JYBA 2KYVA 1N50A 1OAEA 5CIBB 3SWFA 3A0HV 3B5NA 3U1CA 2PFXA 2N1TA 1I6EA 4WQAA 2YXRB 4N3YB 2GUSA 5APSA 1LTTC 1EZVI 4JQ0D 4R4MA 3CCSP 2JJLA 1LP1A 3NBTA 5CBNA 4WQCA 1N2DC 1NU1E 2CK3H 1PPJD 2C8SA 3B5NB 2KLUA 3HUSB 3JBTB 3P8CE 5EFWB 1GW4A 1CSBA 2Z5IA 1YQ4C 4PJ0E 3JCUE 5CCHA 4PJ0V 1L9BC 2HG5D 2PCBB 3D6ZA 1KMIZ 1C6OA 1HH0A 4NPDA 1RQVA 1L0LJ 3MK7C 1QL3A 4LGDE 4JYCA 4PV1C 1J1DC 3WU2E 3KPEA 4IL6V 2HR3A 1YNRA 2BLFB 1CTJA 3AEGC 4KMGA 5GTHE 2FFDC 1NTME 1BCCG 1OX3A 4IFFA 3CCQP 2BH5X 2PRRA 3CC4P 1N73A 4GKGA 2E75C 1AFOA 1H33A 1YJWP 1CHIA 2M3BA 1EZVD 1CI6B 2E43A 2A45H 3FXDA 2JR8A 5KJ7C 1H9XA 1HRCA 1NTKE 4NFGB 3HD7D 1FDOA 2KIKA 2E75B 5CIFB 1C7MA 3NTNA 3SFDC 5IY51 1KN7A 4N0KA 1CZQA 1KILA 3A5TA 3FX0A 1ZR4A 2DGEA 2N1TB 1A56A 3CCEP 3L70J 2K9JA 2OYHA 2WQYC 3TDKA 1KX2A 2K1AA 1IO3A 3CWBE 4W80A 1E29A 4H0KA 2BEQD 3RK3B 5APUA 5CHXA 3V2NA 4H13B 3M0AA 3CX5D 2O01N 2WT7B 4HYTB 1OVVA 1IJDB 1SFCA 3AEBC 4C7RA 2ZVOB 5GTIH 3VTPC 5CIEB 1DIPA 1H32A 3MIWA 2WPSA 3D71A 2H8PD 3BCCG 3H1LD 2IBZD 1JCDA 2BASA 3ZOXA 3BVHA 1ZMEC 1CTYA 2P2UA 2C0XA 1USEA 4WB4A 1N7SD 4FAVA 1FS0E 1UIXA 2KB7P 2FYUG 3H1LJ 3FWLA 4CPGA 1BCCE 3A0BH 2CPBA 3VMXA 1RF1B 2JWAA 1YHQP 3Q5RA 4QAOA 1YEBA 1KILC 3MK7B 4PD4H 3RL0D 4ZKPA 1BGYJ 5AURA 3AE6C 1MFZA 1OCDA 3RN0A 5AVTB 1URQA 3M97X 2A06D 1LFMA 2KNCB 2Y0EA 4AANA 5E79V 1YI2P 2Q3EA 3WU2V 1NU1G 1HBWA 2Q9IA 2FFDA 5DJUB 3HE5A 3AE5C 2I8DA 1YYCA 1NKZB 3MTUE 5CCHC 3AE7C 2C9NY 1SQXG 4AAOA 2L4DA 3H32A 4WY4D 4JCGA 3OCDB 3ABVC 2FFDB 3AEFC 3GF7A 3H1KE 1K9MQ 2QRXA 1YICA 3O20A 2YKOA 3VMYA 2HPCB 3H1ID 2OYHB 2C1UA 1RAPA 1GK4A 1RE4A 1LTGC 5TJHA 5KAIH 3VMZA 3VYMA 3OJAB 5CCHD 4WQBA 2WTYA 3CD6P 1NGMB 5E79E 1L0NK 2J58A 2AXCA 1COTA 2PCCB 4GOEA 3C8VA 4Y99B 3UIAA 2WSEH 3B5NC 1FZAA 1KV9A 4PWAA 5CJ0A 3PXTA 2ZYGA 3JCUH 1CIHA 3HD7B 4MN4C 2CA3B 1YJ9P 1DD4A 5H2FE 1NTKJ 2IX7C 1S9KE 1LT9B 2KNCA 1VQ4P 4H0JA 3OA8A 2FKWB 2WSFJ 2CE0A 2K3RA 1AOQA 4AYCA 2RMZA 5EXQA 2D2CB 1NTMJ 2OYIB 1CO6A 3R4YA 1PP9D 1S5LV 2POHA 1S9KD 2KS1B 3L71G 2C9XB 1CXCA 4EOTA 2BEZF 1ZZHA 3HQ6A 1XTGB 2ZT9C 1UIIA 2BH4X 4OWFA 1HJ0A 5AW7B 5AW0B 4EYYQ 5CJ4A 4TT3H 3Q3DA 4C46A 1DEEG 3HE5B 1OIPA 1CIEA 1L4AD 5B5EE 5CCGA 1SQVG 2KXPB 1J2JB 1M7LA 1Z56A 2BGVX 1N73C 1IFPA 3WFCC 1DVVA 1IFMA 1RQUA 4TLFA 2BCNB 1FI9A 3NXSA 3TGUD 1NO4A 2GC4D 4GEDB 2HPCA 4RSZA 4OGQC 1C52A 5KLVE 1SFCB 1MG2D 3MZWB 1H31B 3G4SP 2E75D 1BE3G 1GK6A 1N7SC 3O6QA 3CXHI 1CNOA 3FXEA 1R5LA 1C6RA 3S9OA 3M0DA 2YK3A 3L74D 5DJQC 2H7HA 2AIUA 4PV1D 2M5AA 2FYUD 2P7JA 1LS9A 2JWDA 1KZUB 2GB8B 5H2FH 1S72P 4H44B 1ETPA 2B12B 1JMMA 1FU1A 2AEFA 2B87B 2R3SA 5C9MA 1M60A 2XDJA 4XFJA 4ZNCA 1M1KQ 1Q82Q 2P67A 4FA5A 3L73D 2KZJA 1S6VB 3H25A 1ZRTE 4B86A 1S1CX 2HODB 1FZCA 4UB6H 2IBZE 4GT1A 1IFIA 1SQQK 1W2BO 1H33B 1AQTA 1QN2A 1SVFA 2IPPA 3G9RA 2PGDA 3RK2B 1N7LA 3FGAD 1OXZA 3CU4A 3E1RA 3AE9C 2WPRA 1BGYE 1OZHA 2C2CA 1J1DB 2QG4A 1VYDA 4C7NB 1JOCA 2QSIA 3M9BA 5APTA 1RZ6A 1GDVA 2KLVA 1L0LK 4EIEA 3HRNA 4N78D 3VMAA 1QGKB 1D7MA 2N9YB 1PL5A 4DY9A 1JUNA 1ZN5A 1H31A 2RH0A 5AVVB 3GHGB 4V2KA 2Y9YA 3CCVP 1JEKA 1A2SA 3CL3D 1L0ND 1L9JC 1SQVD 2NPSB 3V2PA 2N1TD 2W90A 2AXTV 4OGQB 3F5HA 3SSUA 2WWWA 3O0RC 3C1LA 1JO5A 1ZOYC 3JC22 2HYNA 2N9JA 3CMAP 3CPWO 5AW4B 1EZVE 3H1KD 2Q1KA 1EZVG 1L4AB 5AVXB 3A0BE 4P4QB 1FJ0A 4BWNA 2H89C 2Y9ZA 3VYIA 1IZNB 1RF0A 5C39A 1NJIQ 1CSXA 1HH7A 1W2LA 2V08A 1ZW0A 3V4QA 3ZDMA 1CW5A 1GTWA 3HTKB 1SQBK 1FZCC 5DF5A 1PGOA 1PGPA 1N90A 1MKMA 1DW2A 5KKZC 1VQNP 1VF5D 1IFNA 1L0NG 2ZT9B 1IZL0 1J1EC 3MHVA 3L36A 1KILB 1KILE 3M9HA 5KKZB 1QEXA 1AKKA 3PLNA 1SQVJ 1A02J 2V4HA 3L70D 1EDJA 4BRYA 1W5CT 2R32A 3ZOYA 5TISH 2QE7H 1S5LX 3L73G 2IDBA 1MZ4A 4L75A 4R4LA 5AW8B 1FZGA 3T97A 2O1JA 1NMIA 2IFNA 3PTZA 3M06A 2M5AB 2FYUE 1G1IA 1I8OA 1HJBA 1U7MA 1VL2A 1GL2B 1BE3J 2WZ7A 1FC2C 3Q2YA 5GTHV 1PGQA 1IRWA 3BCCE 1IC2A 1JY2N 1OWAA 2FXOA 4K3AA 3A2AA 3MUDA 2HODA 1AA0A 1SQXK 4LC1A 5AW2B 1KQGB 2YNYA 1RY3A 5CCGC 3O8ZA 3RL0C 2ZVNB 3CX5H 2FYZA 3CXHE 4Y28J 1I6DA 3A3YB 3L72J 3IFMA 1DD3A 2H43A 5B5EH 2YQBA 2LIRA 4EIFA 3CWBG 2JP3A 3OCDA 3N7NA 3WUUA 3U1AA 3L37A 2IBZI 5CCGD 1CI6A 1J3SA 2P1JA 5KLVG 2E5YA 2WVRA 2XNDH 2ZONG 1IRVA 4OGQD 2XV5A 3CCLP 1H89A 1M56D 2HV4A 3ZOOA 3G3ZA 3EFFK 1JY3P 4UB8V 1MZ9A 2QJKC 3GMAA 4D6TG 1KX7A 2OZ1B 3KQGA 5BU8B 3HE4A 2FXPA 1S2EA 2C1DA 1OVRA 1SQVE 1Q90D 3C9IA 1NTZG 5APWA 2O3JA 1G2CB 3V6IA 1RF1C 2Q7CA 1DIIC 1FI3A 3Q5PA 1RF0C 1I54A 3X39A 2N3BA 3OAKA 2SPZA 1U74B 2JTIB 4XYDB 3L74E 1LT9A 4L1QA 1YBKA 2A06E 2ZT9D 2D0WA 1T3JA 4YE1A 3HUSA 4AAMA 4GDOA 1RE4C 1H0TA 4IFDK 3GHGA 4U7JA 3OW2O 3ZCFA 1N8RQ 2N9IA 2YXQB 2FBWC 4WBAA 5CMZA 5KAIE 3I56P 5KAIV 3VN0A 1ZP0C 1AV1A 3IF4A 1JY2O 1IK7A 1S5LH 1E2RA 3WFEC 1MUUA 2WPQA 4NPEA 155CA 1GQ1A 1JTHB 3D6YA 1NTMD 4DCKA 3H32B 3H1IE 5KLIB 4WQ7A 4L3GA 1CYIA 1L4AA 2G8YA 3P8MC 1T3UA 1GL2D 2QVAA 1HJ5A 1T2KD 1T8ZA 4I1LA 1I55A 3WMM0 2I8FA 1WMKA 3WFBC 1JTHA 2OTKE 3D0WA 3VRDA 1SQQJ 1CRJA 1EDIA 1P84H 5AVRB 2MTAC 4XE5B 1CHJA 2O1KA 1AJYA 3E7KA 3NWVA 2J5UA 3BRTB 4H44D 2GC7D 5B6QA 1N86A 3H1KG 1M90Q 1R0QA 3HD7A 4BXLA 3LW5J 1XTCC 3L73J 3BCCJ 3GG2A 4DT0A 1A02F 3PXSA 1IO4A 3ITKA 2GIWA 4FB1A 3L75E 2FYUJ 1Y8AA 3VNWA 1OVUA 2P58A 3WUTA 2NZ2A 4IL6H 1KQSO 1SQPJ 2B88A 3SJLA 2AXTE 1X8YA 3JSVC 4FA9A 1JB0J 4H13D 3CXHD 1DT1A 2YIUB 3DMIA 3F89A 2WITA 2WSEJ 2VHDA 5APQA 1CXAA 5E79H 4U3FG 1BL9A 5AVQB 1LTIC 5BVZA 4YPCA 2K9JB 2B11B 2E76B 1CORA 2O01H 2OGUA 1QLED 351CA 3A7OA 1M8OB 2N3YA 1YTCA 2OYHC 1QX8A 4N78E 4HJGH 3B8EB 1URQB 1GL2C 2B0ZB 5KLVJ 3SWYA 2LXCB 5KTBA 1SQXJ 2W6AA 4I7ZC 1GW3A 1LTSC 1YQ3C 1WVEC 3S4RA 1GU5A 3V2RA 3P8CD 2D2CD 1K3HA 1K8AQ 1CIGA 1RE3A 1NAFA 3VP9A 1JNMA 1DW1A 1YIQA 1DW0A 2E74C 1NTZJ 1NU1K 4JPZB 1HZVA 3HQ9A 1CRYA 1PP9J 3O5CA 2E74B 1LC1A 1LT9C 1VQ7P 1CYJA 5AW6B 1C75A 1NWQA 1CIFA 1KB0A 5GTHH 1SQPK 3WC8A 3SFEC 1YIJP 1GJQA 3WU2H 4WQ8A 1VQ8P 1N73B 1HJ3A 2ZAEB 4IL6E 3BATA 2W6BA 3HD7C 5CICB 1NTKG 4D6TD 1NH4A 1PP9E 2XKMA 3TGUG 3LW5H 2V7QJ 1HGZA 1LWUC 1M57D 4PW9B 4Z1MH 2MJZA 2QJYC 2D0SA 1JY3O 1VQLP 2WPVB 4GODA 2I1KA 1RF1A 1PGJA 1VQ6P 1NTMG 2FYUK 2DVHA 4GYDA 1NU1D 3B71A 1I5TA 3P7KA 1WEJF 2OTLP 3RK3E 1GMJA 4IFMA 1Q81Q 4GOFA 2BCCG 2OYIC
chains in the Genus database with same CATH topology
2DGEA 2FRCA 2OZ1A 5DF5A 4AX3A 1FHBA 1A56A 1N90A 3L75D 1DW2A 1NIRA 2PACA 3TDKA 1KX2A 451CA 3L72D 1GU2A 2Y0DA 1IZL0 1IO3A 1E29A 2ZOOA 4H0KA 1P84D 3DP5A 4WQDA 1CCHA 1H32B 5KKZB 1LC2A 1A8CA 1M6ZA 3CX5D 1GIWA 2ZZS1 1CYCA 3PXWA 1YCCA 1AKKA 3PLNA 1KYOW 1N15A 1CSUA 4EICA 5CIGB 3L70D 1W5CT 1KYOD 3ZOYA 2XTSB 5CIEB 1H32A 2FYNB 1MZ4A 2N18C 4MU8A 3H1LD 2IBZD 2C1DB 1NMIA 1AYGA 3ZOXA 3PTZA 1CTYA 1BGYD 1I8OA 4FAVA 1QKSA 1U75B 2YCCA 3FWLA 2FWLA 3CYTI 3RLMA 5GTHV 2JQRA 1H1OA 3A0BV 1IRWA 2JWAA 4QAOA 1YEBA 3MK7B 1ZRTD 1K3GA 2AI5A 3L4OA 3SWSA 3L4MA 5AURA 4WQEA 3SLEA 3NBSA 1OCDA 3RN0A 3M97X 1I6DA 2A06D 1LFMA 2KNCB 4FA4A 1DW3A 2Y0EA 2YQBA 2LIRA 4EIFA 3SXTA 4AANA 4O1WA 5E79V 1YFCA 2Q3EA 3OCDA 3WU2V 2BPBB 5H2FV 4Q5PA 4Y5RA 2Y0CA 1KIBA 1CRGA 1J3SA 1NTZD 2V07A 2ZONG 1IRVA 2MHMA 3TF5A 4AAOA 2HV4A 2L4DA 3ZOOA 4JCGA 4UB8V 2L91A 3OCDB 3PH2B 3PRJA 1BCCD 1GKSA 1I8PA 4A7PA 1KX7A 2OZ1B 1JDLA 4J20A 3ZBMA 1YICA 3O20A 1QYZA 1CRCA 3CXHW 2C1DA 3H1ID 2C1UA 1RAPA 4FA1A 1N9CA 5TJHA 5KLVD 3VYMA 2CE1A 4WQBA 3HQ7A 1CRHA 1FOCA 2O3JA 3KZIV 1DVHA 1DIIC 1FI3A 1COTA 3C2CA 1I54A 2PCCB 3X39A 2N3BA 1AOFA 1U74B 2JTIB 4XYDB 1KV9A 4PWAA 3PXTA 4L1QA 1CCRA 1CIHA 1RZ5A 4FANA 2D0WA 4O1QA 4YE1A 1IQCA 2CA3B 4AAMA 4LJIA 3ZCFA 1CC5A 3PHLA 2N18B 2N9IA 5DFSA 1F1FA 5KAIV 1SQPD 5B5EV 1FCDC 1F1CA 4H0JA 3OA8A 2CE0A 1AOQA 2RMZA 5EXQA 5CIHB 1E2RA 3WFEC 155CA 1CO6A 3ORVA 1GQ1A 1PP9D 1S5LV 3CX5W 1NTMD 2C9XB 4UB6V 3BCCD 4XXLA 5KLIB 3OA8B 1CXCA 4WQ7A 4L3GA 1CYIA 1ZZHA 3HQ6A 1CSVA 3H1JD 1CSWA 1HJ5A 2BH4X 5KAFV 1L0LD 1I55A 2I8FA 1HZUA 3WFBC 3KHUA 3VRDA 5CIDB 1CRJA 2MTAC 1CHJA 2C1VA 3NWVA 1CIEA 1SQQD 5GTIV 5B66V 2BGVX 2ZXYA 3SVWA 2GC7D 1BE3D 3WFCC 5B6QA 1DVVA 2ZBOA 1DIQC 1R0QA 1QL4A 2CXBA 3RN1A 2BCNB 1FI9A 3TGUD 1B7VA 5DJQB 1CEDA 3A9FA 2GC4D 4GEDB 3GG2A 4RSZA 4EDFA 3PXSA 1C52A 1YEAA 1LMSA 1MG2D 4PD4D 1KB9D 2QJKB 1C6SA 5CYTR 3ITKA 1H31B 2GIWA 4FB1A 3O1YA 1CNOA 3VNWA 4AALA 1C6RA 3WFDC 3CWBD 1FI7A 2YK3A 2EXVA 2ORLA 3L74D 5DJQC 2AIUA 3SJLA 2FYUD 4FA9A 1LS9A 1HJ4A 4L3HA 2LITA 3CXHD 5TISV 1DT1A 2YIUB 2GB8B 1C2NA 1ETPA 2B12B 3DMIA 2B10B 2VHDA 1CXAA 1SQBD 3ZOWA 5C9MA 1BL9A 3RMZA 1M60A 1CHHA 2K9JB 2B11B 1CORA 4FA5A 3L73D 3H1HD 1S6VB 3HQ8A 351CA 1RAQA 4U3FD 3TYIA 1M70A 4RJTA 1H33B 1QN2A 2N3YA 1YTCA 1H9YA 3CU4A 2B0ZB 1NNOA 2B4ZA 2C2CA 1E8EA 2KS1A 2QJPB 2QG4A 1VYDA 3WUIA 3CP5A 1N50A 1OAEA 5CIBB 1WVEC 3A0HV 1RZ6A 1GDVA 1K3HA 1CIGA 4EIEA 1I6EA 3VMAA 4WQAA 2CA4B 1MG3D 2QJYB 2N9YB 1DW1A 1YIQA 2BCCD 1DW0A 1HROA 4DY9A 5C0ZA 3NBTA 4WQCA 1HZVA 3HQ9A 1H31A 1PPJD 2C8SA 1CRYA 3JBTB 3O5CA 1SQXD 1LC1A 4V2KA 1CYJA 1C75A 1CIFA 1A2SA 3DR0A 4PJ0V 1KB0A 1L9BC 2PCBB 1L0ND 1L9JC 3WC8A 1C6OA 1SQVD 1GJQA 1C2RA 1NMLA 3ZIYA 4WQ8A 1HJ3A 2AXTV 3MK7C 1QL3A 1EB7A 3O0RC 2RN0A 3GW6A 4IL6V 1YNRA 2BLFB 1CTJA 4WQ9A 4KMGA 5CICB 4D6TD 1CTZA 1CRIA 2BH5X 4PW9B 2N9JA 3H1KD 1H33A 2D0SA 1CHIA 1EZVD 4P4QB 1FJ0A 3L71D 1H9XA 1HRCA 2DVHA 4NFGB 4GYDA 1NU1D 1CSXA 1HH7A 1W2LA 1NTKD 2V08A 5CIFB 1I5TA 1C7MA 1WEJF 1HCMA 4EIDA 5IY51 4N0KA 4K3IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DGE A;  2FRC A;  2OZ1 A;  5DF5 A;  4AX3 A;  1FHB A;  1A56 A;  1N90 A;  3L75 D;  1DW2 A;  1NIR A;  2PAC A;  3TDK A;  1KX2 A;  451C A;  3L72 D;  1GU2 A;  2Y0D A;  1IZL 0;  1IO3 A;  1E29 A;  2ZOO A;  4H0K A;  1P84 D;  3DP5 A;  4WQD A;  1CCH A;  1H32 B;  5KKZ B;  1LC2 A;  1A8C A;  1M6Z A;  3CX5 D;  1GIW A;  2ZZS 1;  1CYC A;  3PXW A;  1YCC A;  1AKK A;  3PLN A;  1KYO W;  1N15 A;  1CSU A;  4EIC A;  5CIG B;  3L70 D;  1W5C T;  1KYO D;  3ZOY A;  2XTS B;  5CIE B;  1H32 A;  2FYN B;  1MZ4 A;  2N18 C;  4MU8 A;  3H1L D;  2IBZ D;  2C1D B;  1NMI A;  1AYG A;  3ZOX A;  3PTZ A;  1CTY A;  1BGY D;  1I8O A;  4FAV A;  1QKS A;  1U75 B;  2YCC A;  3FWL A;  2FWL A;  3CYT I;  3RLM A;  5GTH V;  2JQR A;  1H1O A;  3A0B V;  1IRW A;  2JWA A;  4QAO A;  1YEB A;  3MK7 B;  1ZRT D;  1K3G A;  2AI5 A;  3L4O A;  3SWS A;  3L4M A;  5AUR A;  4WQE A;  3SLE A;  3NBS A;  1OCD A;  3RN0 A;  3M97 X;  1I6D A;  2A06 D;  1LFM A;  2KNC B;  4FA4 A;  1DW3 A;  2Y0E A;  2YQB A;  2LIR A;  4EIF A;  3SXT A;  4AAN A;  4O1W A;  5E79 V;  1YFC A;  2Q3E A;  3OCD A;  3WU2 V;  2BPB B;  5H2F V;  4Q5P A;  4Y5R A;  2Y0C A;  1KIB A;  1CRG A;  1J3S A;  1NTZ D;  2V07 A;  2ZON G;  1IRV A;  2MHM A;  3TF5 A;  4AAO A;  2HV4 A;  2L4D A;  3ZOO A;  4JCG A;  4UB8 V;  2L91 A;  3OCD B;  3PH2 B;  3PRJ A;  1BCC D;  1GKS A;  1I8P A;  4A7P A;  1KX7 A;  2OZ1 B;  1JDL A;  4J20 A;  3ZBM A;  1YIC A;  3O20 A;  1QYZ A;  1CRC A;  3CXH W;  2C1D A;  3H1I D;  2C1U A;  1RAP A;  4FA1 A;  1N9C A;  5TJH A;  5KLV D;  3VYM A;  2CE1 A;  4WQB A;  3HQ7 A;  1CRH A;  1FOC A;  2O3J A;  3KZI V;  1DVH A;  1DII C;  1FI3 A;  1COT A;  3C2C A;  1I54 A;  2PCC B;  3X39 A;  2N3B A;  1AOF A;  1U74 B;  2JTI B;  4XYD B;  1KV9 A;  4PWA A;  3PXT A;  4L1Q A;  1CCR A;  1CIH A;  1RZ5 A;  4FAN A;  2D0W A;  4O1Q A;  4YE1 A;  1IQC A;  2CA3 B;  4AAM A;  4LJI A;  3ZCF A;  1CC5 A;  3PHL A;  2N18 B;  2N9I A;  5DFS A;  1F1F A;  5KAI V;  1SQP D;  5B5E V;  1FCD C;  1F1C A;  4H0J A;  3OA8 A;  2CE0 A;  1AOQ A;  2RMZ A;  5EXQ A;  5CIH B;  1E2R A;  3WFE C;  155C A;  1CO6 A;  3ORV A;  1GQ1 A;  1PP9 D;  1S5L V;  3CX5 W;  1NTM D;  2C9X B;  4UB6 V;  3BCC D;  4XXL A;  5KLI B;  3OA8 B;  1CXC A;  4WQ7 A;  4L3G A;  1CYI A;  1ZZH A;  3HQ6 A;  1CSV A;  3H1J D;  1CSW A;  1HJ5 A;  2BH4 X;  5KAF V;  1L0L D;  1I55 A;  2I8F A;  1HZU A;  3WFB C;  3KHU A;  3VRD A;  5CID B;  1CRJ A;  2MTA C;  1CHJ A;  2C1V A;  3NWV A;  1CIE A;  1SQQ D;  5GTI V;  5B66 V;  2BGV X;  2ZXY A;  3SVW A;  2GC7 D;  1BE3 D;  3WFC C;  5B6Q A;  1DVV A;  2ZBO A;  1DIQ C;  1R0Q A;  1QL4 A;  2CXB A;  3RN1 A;  2BCN B;  1FI9 A;  3TGU D;  1B7V A;  5DJQ B;  1CED A;  3A9F A;  2GC4 D;  4GED B;  3GG2 A;  4RSZ A;  4EDF A;  3PXS A;  1C52 A;  1YEA A;  1LMS A;  1MG2 D;  4PD4 D;  1KB9 D;  2QJK B;  1C6S A;  5CYT R;  3ITK A;  1H31 B;  2GIW A;  4FB1 A;  3O1Y A;  1CNO A;  3VNW A;  4AAL A;  1C6R A;  3WFD C;  3CWB D;  1FI7 A;  2YK3 A;  2EXV A;  2ORL A;  3L74 D;  5DJQ C;  2AIU A;  3SJL A;  2FYU D;  4FA9 A;  1LS9 A;  1HJ4 A;  4L3H A;  2LIT A;  3CXH D;  5TIS V;  1DT1 A;  2YIU B;  2GB8 B;  1C2N A;  1ETP A;  2B12 B;  3DMI A;  2B10 B;  2VHD A;  1CXA A;  1SQB D;  3ZOW A;  5C9M A;  1BL9 A;  3RMZ A;  1M60 A;  1CHH A;  2K9J B;  2B11 B;  1COR A;  4FA5 A;  3L73 D;  3H1H D;  1S6V B;  3HQ8 A;  351C A;  1RAQ A;  4U3F D;  3TYI A;  1M70 A;  4RJT A;  1H33 B;  1QN2 A;  2N3Y A;  1YTC A;  1H9Y A;  3CU4 A;  2B0Z B;  1NNO A;  2B4Z A;  2C2C A;  1E8E A;  2KS1 A;  2QJP B;  2QG4 A;  1VYD A;  3WUI A;  3CP5 A;  1N50 A;  1OAE A;  5CIB B;  1WVE C;  3A0H V;  1RZ6 A;  1GDV A;  1K3H A;  1CIG A;  4EIE A;  1I6E A;  3VMA A;  4WQA A;  2CA4 B;  1MG3 D;  2QJY B;  2N9Y B;  1DW1 A;  1YIQ A;  2BCC D;  1DW0 A;  1HRO A;  4DY9 A;  5C0Z A;  3NBT A;  4WQC A;  1HZV A;  3HQ9 A;  1H31 A;  1PPJ D;  2C8S A;  1CRY A;  3JBT B;  3O5C A;  1SQX D;  1LC1 A;  4V2K A;  1CYJ A;  1C75 A;  1CIF A;  1A2S A;  3DR0 A;  4PJ0 V;  1KB0 A;  1L9B C;  2PCB B;  1L0N D;  1L9J C;  3WC8 A;  1C6O A;  1SQV D;  1GJQ A;  1C2R A;  1NML A;  3ZIY A;  4WQ8 A;  1HJ3 A;  2AXT V;  3MK7 C;  1QL3 A;  1EB7 A;  3O0R C;  2RN0 A;  3GW6 A;  4IL6 V;  1YNR A;  2BLF B;  1CTJ A;  4WQ9 A;  4KMG A;  5CIC B;  4D6T D;  1CTZ A;  1CRI A;  2BH5 X;  4PW9 B;  2N9J A;  3H1K D;  1H33 A;  2D0S A;  1CHI A;  1EZV D;  4P4Q B;  1FJ0 A;  3L71 D;  1H9X A;  1HRC A;  2DVH A;  4NFG B;  4GYD A;  1NU1 D;  1CSX A;  1HH7 A;  1W2L A;  1NTK D;  2V08 A;  5CIF B;  1I5T A;  1C7M A;  1WEJ F;  1HCM A;  4EID A;  5IY5 1;  4N0K A;  4K3I A; 
#chains in the Genus database with same CATH topology
 4AX3 A;  2AEM A;  5AW3 B;  3HE4 B;  5KLI C;  1EDK A;  1NIR A;  3M91 A;  5CBO A;  1Y47 A;  1GU2 A;  1SQQ G;  2Y0D A;  1KQF B;  1P84 D;  3DP5 A;  1SQQ E;  4WQD A;  1CCH A;  5KJ7 A;  2R3C A;  1ZR2 A;  1LTJ C;  1A8C A;  1M6Z A;  1GIW A;  2ZZS 1;  1YCC A;  1KB9 E;  5APX A;  2BCC E;  1CSU A;  3RL0 B;  5CIG B;  4GIF A;  3H1K J;  1KOR A;  3L74 G;  1KV4 A;  1KYO D;  3P32 A;  2XTS B;  4DOJ A;  2FYN B;  2N18 C;  4MU8 A;  1NKN A;  1NOH A;  3AE2 C;  1NYH A;  2MKV A;  1X79 B;  2KK7 A;  3TNU A;  2QM7 A;  2W27 A;  3VOP A;  1BGY D;  1L4A C;  1NTZ E;  1U75 B;  2W8Z A;  3AE3 C;  2FWL A;  1KFN A;  1SQV K;  4YTP C;  4JF7 A;  3RLM A;  1H1O A;  3A0B V;  2CPS A;  4H0L C;  1L2P A;  3H1H E;  2JEE A;  1ZRT D;  4WY4 B;  1YTZ T;  4ASW A;  1X22 A;  3CME P;  4OH8 B;  1FOS F;  2AI5 A;  5B66 E;  3L4M A;  2NPS D;  2M0B A;  2NPS C;  1VPC A;  3TK1 A;  4U3F J;  3IAO A;  4KT0 J;  1LWU B;  3NMD A;  2XZR A;  2R5D A;  2KUB A;  3Q5S A;  5AW1 B;  4FA4 A;  1LTB C;  1FDI A;  4O1W A;  1EXJ A;  2M8R A;  3KXD A;  2BPB B;  4Q5P A;  1KFM A;  1AVO A;  1BSN A;  4Y5R A;  2PAJ A;  2Y0C A;  1DH3 A;  3CCU P;  1KIB A;  4I6M C;  2HFE D;  4UB8 H;  1VQK P;  3TF5 A;  4AUW A;  2A45 G;  3PH2 B;  3PRJ A;  3RK2 C;  1BCC D;  1GKS A;  1RH5 B;  2YO3 A;  3NFQ A;  4LLH A;  1QYZ A;  1CRC A;  3CXH W;  1LJ2 A;  5M1B A;  4FA1 A;  1JY3 N;  2IZ0 A;  2ZYD A;  4ASV A;  2CE1 A;  3M0D C;  1U57 A;  1QVG O;  1FOC A;  1USD A;  3E1I A;  1QVF O;  3CX5 E;  3CXH H;  3D70 A;  1Q7Y Q;  3SWK A;  1EXI A;  3C2C A;  2B9B A;  1KD1 Q;  1VQ9 P;  1VDF A;  1N7S A;  1PPJ G;  1FBM A;  1CCR A;  3B4S A;  1RZ5 A;  4H13 C;  1DX7 A;  1L0L G;  1E5W A;  4O1Q A;  1QL1 A;  5DJT B;  1OW7 A;  2E5T A;  1S3J A;  3T97 B;  1SS1 A;  1LTJ A;  1CC5 A;  3PHL A;  3H6P A;  3W68 A;  5DFS A;  3GF3 A;  5AVU B;  3LIE A;  3TNU B;  1BCC J;  1F1F A;  3TGU J;  1L0N E;  1X0T A;  3L75 G;  1F1C A;  1FZC B;  4DJG A;  1SLQ A;  3H1J J;  2K37 A;  3CLQ A;  3CC7 P;  1ZLL A;  2LXB A;  5AVY B;  1J1E B;  1LNQ A;  2Q3I A;  1M1J C;  4UB6 V;  4PD4 I;  2R5B A;  4OVN F;  3L4F A;  3OA8 B;  2ITA A;  3MD0 A;  1KYO H;  2C0W A;  1CSW A;  3W67 A;  3GLM A;  3V2Q A;  1GD2 E;  3L70 G;  1FZB A;  1HZU A;  1NVO A;  1LP1 B;  3KHU A;  1G1J A;  1L0N J;  1PFI A;  1PIX A;  5AVW B;  1ZXG A;  1VQ5 P;  3KZI E;  5K5G B;  3CI9 A;  3I5C A;  5GTI V;  5B66 V;  3SVW A;  2ZXX A;  2NPS A;  2ZBO A;  3H1I G;  5AVZ B;  1YTZ I;  1VQP P;  1JMB A;  1URQ D;  4H0L D;  1B7V A;  4K35 A;  2E76 D;  1BDD A;  3EFG A;  1KYO E;  3A9F A;  2XNX A;  1LGH B;  4N6J A;  1YEA A;  4PD4 D;  3MGN A;  1KB9 D;  2ZFC A;  4WVZ A;  1C6S A;  5CYT R;  3H1L G;  1Q2N A;  1K73 Q;  4L76 A;  4AAL A;  2B87 A;  3OA7 A;  4I7Z B;  4JBZ A;  4HKZ H;  2Z5H A;  3WFD C;  2YKQ A;  5APV A;  1HGV A;  3A0H E;  2QA4 P;  1FI7 A;  2EXV A;  2ORL A;  1IFD A;  1T6A A;  4EI2 A;  3CCM P;  2A06 G;  1BGY G;  4IOI H;  5TIS V;  1SQB E;  1C2N A;  2WMM A;  2B10 B;  1H0T B;  3ZOW A;  2VRS A;  2JKV A;  1NAY A;  2N9B A;  3B5N D;  2IZ1 A;  3L72 G;  1LT1 A;  1SQP E;  3H1H D;  2FYN C;  5KJ7 D;  2J59 M;  3TYI A;  1M70 A;  1NU1 J;  3KYQ A;  3BAS A;  1BDC A;  1FZE A;  1U7J A;  4XA4 A;  1WT6 A;  2V7Q H;  4RKU J;  2LKM A;  5AW9 B;  1VQO P;  4D6T E;  2B4Z A;  2KS1 A;  2QJP B;  4PV1 B;  3CP5 A;  2E76 C;  3AEC C;  4RES B;  1LTA C;  5KAF E;  4D6T J;  2AEJ A;  3QWO C;  2ZXE B;  2CA4 B;  1MG3 D;  2QJY B;  2IYO A;  1X9V A;  1BE3 E;  2BCC D;  1HRO A;  1W5C E;  5C0Z A;  4UB8 E;  1S4X A;  3GHG C;  3AEA C;  1OFC X;  4IL6 X;  1TU3 F;  5L8R J;  2JDI H;  3CCR P;  2ZYA A;  2YKP A;  1SQX D;  3PP5 A;  1Q86 Q;  4UB6 E;  1M1J A;  3DR0 A;  4L73 A;  1PZQ A;  1C2R A;  1L0L E;  1NML A;  1ZV8 A;  3ZIY A;  1G2C A;  2N1T C;  4M3L A;  4YXD C;  2L5G B;  1FZF A;  3VP8 A;  1EB7 A;  3R2P A;  2RN0 A;  3GW6 A;  3EWK A;  3CX5 I;  4WQ9 A;  3FWN A;  1JCC A;  4RO0 A;  1CTZ A;  1CRI A;  1OW6 A;  5AVS B;  3L75 J;  4Y99 C;  2O01 J;  3H1J E;  3H1J G;  1DEB A;  1KYO I;  1WRG A;  3WUV A;  1YJN P;  2YO2 A;  2KSE A;  2OYO A;  2QIW A;  3L71 D;  1HUC A;  4HH2 A;  3N4X A;  4KHX A;  1OMI A;  3L73 E;  1NTK D;  4HB1 A;  3L71 J;  1HCM A;  4EID A;  3RL0 g;  1P84 I;  5KAF H;  3AE4 C;  2UWJ E;  4K3I A;  2FRC A;  2OZ1 A;  2G3A A;  3AEE C;  1FHB A;  2C9L Y;  3L75 D;  1FJK A;  5AW5 B;  2PAC A;  2GA1 A;  1SP4 A;  451C A;  4EIJ A;  3L72 D;  1KB9 H;  2ZOO A;  3IR9 A;  1H8A A;  2Q5U A;  3PH0 A;  1H32 B;  1LC2 A;  2KI7 B;  2LR2 A;  1CYC A;  3PXW A;  3M9Q A;  1KYO W;  1K04 A;  5KLV K;  1N15 A;  4EIC A;  2DW3 A;  3A0H H;  4C7N A;  1IFJ A;  3H1I J;  3H1H G;  1R8E A;  2KZI A;  2NRG A;  5APY A;  2C1D B;  1AYG A;  2WSF H;  1IK9 A;  2Q6Q A;  1NTK K;  4WY4 A;  1NHL A;  1QKS A;  2WSC J;  2YCC A;  4WWI A;  1E79 H;  1Y9B A;  2IFM A;  1VQM P;  1NTZ K;  2H88 C;  1H88 A;  5TIS E;  3CYT I;  1QL2 A;  1AVY A;  4QMA A;  2JQR A;  1SQP G;  3AED C;  3L72 E;  3I55 P;  1PV3 A;  1JY2 P;  1K3G A;  2FXM A;  2QEX P;  1SQX E;  3L4O A;  3SWS A;  1SQB G;  2IYP A;  3V4W A;  1OW8 A;  5GTI E;  4WQE A;  3SLE A;  3NBS A;  3HUS C;  2YIU C;  1DW3 A;  3G71 P;  3SXT A;  3QH9 A;  1YFC A;  3H1L E;  5H2F V;  3U59 A;  2A45 I;  2WT7 A;  1CRG A;  3K5B A;  1NTZ D;  2V07 A;  2B89 A;  4L74 A;  2MHM A;  4H0L B;  2L91 A;  1HF9 A;  1URQ C;  4DZO A;  1I8P A;  4A7P A;  1GDT A;  1JDL A;  4J20 A;  3KDP B;  3ZBM A;  3BRV B;  1HTL C;  2P10 A;  1N9C A;  2W83 C;  5KLV D;  2OTJ P;  2W6J H;  3HQ7 A;  2IBZ G;  1CRH A;  1FDM A;  3KZI V;  1GL2 A;  3O6Q B;  3TGU E;  1DVH A;  1PP9 G;  3IN6 A;  4ZMD A;  2WSC H;  1W2E A;  1EC5 A;  3L70 E;  1AOF A;  4PD4 E;  4FAN A;  1IQC A;  2RKL A;  4LJI A;  2R44 A;  2YMK A;  2OQQ A;  3RK3 C;  1LWU A;  2N18 B;  3CCJ P;  2AXT H;  4KJM A;  2Z4E A;  1SQP D;  3AE8 C;  5B5E V;  1FCD C;  1SFC C;  4NPF X;  2M3E A;  1FAV A;  2HLO A;  1T2K C;  1FOS E;  1SFC D;  3TSI A;  5CIH B;  2XU6 A;  2PP6 A;  3ORV A;  1BSH A;  3V5B A;  3CX5 W;  3TYY A;  4AQR D;  3BCC D;  1KB9 I;  4XXL A;  2KOG A;  2GM4 A;  2KSJ A;  1FJP A;  4WY4 C;  2BCC J;  1CSV A;  3H1J D;  4ZKU A;  3KZI H;  5KAF V;  1PPJ E;  4W7Y A;  1L0L D;  3CC2 P;  2QM8 A;  1EQ7 A;  2JO1 A;  3G6E P;  1K05 A;  1KQL A;  5CID B;  1RE3 C;  2KP8 A;  1JM0 A;  3Q1M A;  1NTM K;  1KTM A;  2WSS H;  5B66 H;  2C1V A;  1VF5 C;  1SQQ D;  1P84 E;  5BU5 A;  4U3F E;  1N7S B;  4H44 C;  2ZXY A;  1BE3 D;  1DIQ C;  3L74 J;  4I2L C;  1VF5 B;  2D2C C;  3L71 E;  1QL4 A;  2CXB A;  3RN1 A;  3RK2 D;  2OAR A;  3H1H J;  1HVV A;  2K88 A;  5DJQ B;  1KIL D;  1CED A;  4EDF A;  1HWT C;  3AE1 C;  1LMS A;  2K9Y A;  2QJK B;  2E42 A;  3S1K A;  1S5L E;  1AQ5 A;  3O1Y A;  1FE6 A;  4O9B A;  3L35 A;  1GZL A;  3MP7 B;  3RBZ A;  2QJP C;  3RK3 D;  3CWB D;  1M1J B;  2OYI A;  1HJ4 A;  4L3H A;  1R5S A;  2LIT A;  2FY8 A;  2I1J A;  1SQB J;  3RGU A;  4PJ0 H;  3HTK A;  1GU4 A;  3MUD C;  4W7Z A;  1SQB D;  1LTJ B;  3EQ2 A;  3RMZ A;  1YIT P;  1CHH A;  3USS A;  2ZJS E;  3HQ8 A;  3CWB J;  1RAQ A;  4U3F D;  3RBX A;  4RJT A;  4YXW H;  2E74 D;  1H9Y A;  2GUV A;  2YMY A;  1KC8 Q;  1NNO A;  1RHZ B;  1E8E A;  1MV8 A;  3LID A;  3II6 A;  3PJS K;  1MFT A;  1EDL A;  3WUI A;  4BRY B;  4JYB A;  2KYV A;  1N50 A;  1OAE A;  5CIB B;  3SWF A;  3A0H V;  3B5N A;  3U1C A;  2PFX A;  2N1T A;  1I6E A;  4WQA A;  2YXR B;  4N3Y B;  2GUS A;  5APS A;  1LTT C;  1EZV I;  4JQ0 D;  4R4M A;  3CCS P;  2JJL A;  1LP1 A;  3NBT A;  5CBN A;  4WQC A;  1N2D C;  1NU1 E;  2CK3 H;  1PPJ D;  2C8S A;  3B5N B;  2KLU A;  3HUS B;  3JBT B;  3P8C E;  5EFW B;  1GW4 A;  1CSB A;  2Z5I A;  1YQ4 C;  4PJ0 E;  3JCU E;  5CCH A;  4PJ0 V;  1L9B C;  2HG5 D;  2PCB B;  3D6Z A;  1KMI Z;  1C6O A;  1HH0 A;  4NPD A;  1RQV A;  1L0L J;  3MK7 C;  1QL3 A;  4LGD E;  4JYC A;  4PV1 C;  1J1D C;  3WU2 E;  3KPE A;  4IL6 V;  2HR3 A;  1YNR A;  2BLF B;  1CTJ A;  3AEG C;  4KMG A;  5GTH E;  2FFD C;  1NTM E;  1BCC G;  1OX3 A;  4IFF A;  3CCQ P;  2BH5 X;  2PRR A;  3CC4 P;  1N73 A;  4GKG A;  2E75 C;  1AFO A;  1H33 A;  1YJW P;  1CHI A;  2M3B A;  1EZV D;  1CI6 B;  2E43 A;  2A45 H;  3FXD A;  2JR8 A;  5KJ7 C;  1H9X A;  1HRC A;  1NTK E;  4NFG B;  3HD7 D;  1FDO A;  2KIK A;  2E75 B;  5CIF B;  1C7M A;  3NTN A;  3SFD C;  5IY5 1;  1KN7 A;  4N0K A;  1CZQ A;  1KIL A;  3A5T A;  3FX0 A;  1ZR4 A;  2DGE A;  2N1T B;  1A56 A;  3CCE P;  3L70 J;  2K9J A;  2OYH A;  2WQY C;  3TDK A;  1KX2 A;  2K1A A;  1IO3 A;  3CWB E;  4W80 A;  1E29 A;  4H0K A;  2BEQ D;  3RK3 B;  5APU A;  5CHX A;  3V2N A;  4H13 B;  3M0A A;  3CX5 D;  2O01 N;  2WT7 B;  4HYT B;  1OVV A;  1IJD B;  1SFC A;  3AEB C;  4C7R A;  2ZVO B;  5GTI H;  3VTP C;  5CIE B;  1DIP A;  1H32 A;  3MIW A;  2WPS A;  3D71 A;  2H8P D;  3BCC G;  3H1L D;  2IBZ D;  1JCD A;  2BAS A;  3ZOX A;  3BVH A;  1ZME C;  1CTY A;  2P2U A;  2C0X A;  1USE A;  4WB4 A;  1N7S D;  4FAV A;  1FS0 E;  1UIX A;  2KB7 P;  2FYU G;  3H1L J;  3FWL A;  4CPG A;  1BCC E;  3A0B H;  2CPB A;  3VMX A;  1RF1 B;  2JWA A;  1YHQ P;  3Q5R A;  4QAO A;  1YEB A;  1KIL C;  3MK7 B;  4PD4 H;  3RL0 D;  4ZKP A;  1BGY J;  5AUR A;  3AE6 C;  1MFZ A;  1OCD A;  3RN0 A;  5AVT B;  1URQ A;  3M97 X;  2A06 D;  1LFM A;  2KNC B;  2Y0E A;  4AAN A;  5E79 V;  1YI2 P;  2Q3E A;  3WU2 V;  1NU1 G;  1HBW A;  2Q9I A;  2FFD A;  5DJU B;  3HE5 A;  3AE5 C;  2I8D A;  1YYC A;  1NKZ B;  3MTU E;  5CCH C;  3AE7 C;  2C9N Y;  1SQX G;  4AAO A;  2L4D A;  3H32 A;  4WY4 D;  4JCG A;  3OCD B;  3ABV C;  2FFD B;  3AEF C;  3GF7 A;  3H1K E;  1K9M Q;  2QRX A;  1YIC A;  3O20 A;  2YKO A;  3VMY A;  2HPC B;  3H1I D;  2OYH B;  2C1U A;  1RAP A;  1GK4 A;  1RE4 A;  1LTG C;  5TJH A;  5KAI H;  3VMZ A;  3VYM A;  3OJA B;  5CCH D;  4WQB A;  2WTY A;  3CD6 P;  1NGM B;  5E79 E;  1L0N K;  2J58 A;  2AXC A;  1COT A;  2PCC B;  4GOE A;  3C8V A;  4Y99 B;  3UIA A;  2WSE H;  3B5N C;  1FZA A;  1KV9 A;  4PWA A;  5CJ0 A;  3PXT A;  2ZYG A;  3JCU H;  1CIH A;  3HD7 B;  4MN4 C;  2CA3 B;  1YJ9 P;  1DD4 A;  5H2F E;  1NTK J;  2IX7 C;  1S9K E;  1LT9 B;  2KNC A;  1VQ4 P;  4H0J A;  3OA8 A;  2FKW B;  2WSF J;  2CE0 A;  2K3R A;  1AOQ A;  4AYC A;  2RMZ A;  5EXQ A;  2D2C B;  1NTM J;  2OYI B;  1CO6 A;  3R4Y A;  1PP9 D;  1S5L V;  2POH A;  1S9K D;  2KS1 B;  3L71 G;  2C9X B;  1CXC A;  4EOT A;  2BEZ F;  1ZZH A;  3HQ6 A;  1XTG B;  2ZT9 C;  1UII A;  2BH4 X;  4OWF A;  1HJ0 A;  5AW7 B;  5AW0 B;  4EYY Q;  5CJ4 A;  4TT3 H;  3Q3D A;  4C46 A;  1DEE G;  3HE5 B;  1OIP A;  1CIE A;  1L4A D;  5B5E E;  5CCG A;  1SQV G;  2KXP B;  1J2J B;  1M7L A;  1Z56 A;  2BGV X;  1N73 C;  1IFP A;  3WFC C;  1DVV A;  1IFM A;  1RQU A;  4TLF A;  2BCN B;  1FI9 A;  3NXS A;  3TGU D;  1NO4 A;  2GC4 D;  4GED B;  2HPC A;  4RSZ A;  4OGQ C;  1C52 A;  5KLV E;  1SFC B;  1MG2 D;  3MZW B;  1H31 B;  3G4S P;  2E75 D;  1BE3 G;  1GK6 A;  1N7S C;  3O6Q A;  3CXH I;  1CNO A;  3FXE A;  1R5L A;  1C6R A;  3S9O A;  3M0D A;  2YK3 A;  3L74 D;  5DJQ C;  2H7H A;  2AIU A;  4PV1 D;  2M5A A;  2FYU D;  2P7J A;  1LS9 A;  2JWD A;  1KZU B;  2GB8 B;  5H2F H;  1S72 P;  4H44 B;  1ETP A;  2B12 B;  1JMM A;  1FU1 A;  2AEF A;  2B87 B;  2R3S A;  5C9M A;  1M60 A;  2XDJ A;  4XFJ A;  4ZNC A;  1M1K Q;  1Q82 Q;  2P67 A;  4FA5 A;  3L73 D;  2KZJ A;  1S6V B;  3H25 A;  1ZRT E;  4B86 A;  1S1C X;  2HOD B;  1FZC A;  4UB6 H;  2IBZ E;  4GT1 A;  1IFI A;  1SQQ K;  1W2B O;  1H33 B;  1AQT A;  1QN2 A;  1SVF A;  2IPP A;  3G9R A;  2PGD A;  3RK2 B;  1N7L A;  3FGA D;  1OXZ A;  3CU4 A;  3E1R A;  3AE9 C;  2WPR A;  1BGY E;  1OZH A;  2C2C A;  1J1D B;  2QG4 A;  1VYD A;  4C7N B;  1JOC A;  2QSI A;  3M9B A;  5APT A;  1RZ6 A;  1GDV A;  2KLV A;  1L0L K;  4EIE A;  3HRN A;  4N78 D;  3VMA A;  1QGK B;  1D7M A;  2N9Y B;  1PL5 A;  4DY9 A;  1JUN A;  1ZN5 A;  1H31 A;  2RH0 A;  5AVV B;  3GHG B;  4V2K A;  2Y9Y A;  3CCV P;  1JEK A;  1A2S A;  3CL3 D;  1L0N D;  1L9J C;  1SQV D;  2NPS B;  3V2P A;  2N1T D;  2W90 A;  2AXT V;  4OGQ B;  3F5H A;  3SSU A;  2WWW A;  3O0R C;  3C1L A;  1JO5 A;  1ZOY C;  3JC2 2;  2HYN A;  2N9J A;  3CMA P;  3CPW O;  5AW4 B;  1EZV E;  3H1K D;  2Q1K A;  1EZV G;  1L4A B;  5AVX B;  3A0B E;  4P4Q B;  1FJ0 A;  4BWN A;  2H89 C;  2Y9Z A;  3VYI A;  1IZN B;  1RF0 A;  5C39 A;  1NJI Q;  1CSX A;  1HH7 A;  1W2L A;  2V08 A;  1ZW0 A;  3V4Q A;  3ZDM A;  1CW5 A;  1GTW A;  3HTK B;  1SQB K;  1FZC C;  5DF5 A;  1PGO A;  1PGP A;  1N90 A;  1MKM A;  1DW2 A;  5KKZ C;  1VQN P;  1VF5 D;  1IFN A;  1L0N G;  2ZT9 B;  1IZL 0;  1J1E C;  3MHV A;  3L36 A;  1KIL B;  1KIL E;  3M9H A;  5KKZ B;  1QEX A;  1AKK A;  3PLN A;  1SQV J;  1A02 J;  2V4H A;  3L70 D;  1EDJ A;  4BRY A;  1W5C T;  2R32 A;  3ZOY A;  5TIS H;  2QE7 H;  1S5L X;  3L73 G;  2IDB A;  1MZ4 A;  4L75 A;  4R4L A;  5AW8 B;  1FZG A;  3T97 A;  2O1J A;  1NMI A;  2IFN A;  3PTZ A;  3M06 A;  2M5A B;  2FYU E;  1G1I A;  1I8O A;  1HJB A;  1U7M A;  1VL2 A;  1GL2 B;  1BE3 J;  2WZ7 A;  1FC2 C;  3Q2Y A;  5GTH V;  1PGQ A;  1IRW A;  3BCC E;  1IC2 A;  1JY2 N;  1OWA A;  2FXO A;  4K3A A;  3A2A A;  3MUD A;  2HOD A;  1AA0 A;  1SQX K;  4LC1 A;  5AW2 B;  1KQG B;  2YNY A;  1RY3 A;  5CCG C;  3O8Z A;  3RL0 C;  2ZVN B;  3CX5 H;  2FYZ A;  3CXH E;  4Y28 J;  1I6D A;  3A3Y B;  3L72 J;  3IFM A;  1DD3 A;  2H43 A;  5B5E H;  2YQB A;  2LIR A;  4EIF A;  3CWB G;  2JP3 A;  3OCD A;  3N7N A;  3WUU A;  3U1A A;  3L37 A;  2IBZ I;  5CCG D;  1CI6 A;  1J3S A;  2P1J A;  5KLV G;  2E5Y A;  2WVR A;  2XND H;  2ZON G;  1IRV A;  4OGQ D;  2XV5 A;  3CCL P;  1H89 A;  1M56 D;  2HV4 A;  3ZOO A;  3G3Z A;  3EFF K;  1JY3 P;  4UB8 V;  1MZ9 A;  2QJK C;  3GMA A;  4D6T G;  1KX7 A;  2OZ1 B;  3KQG A;  5BU8 B;  3HE4 A;  2FXP A;  1S2E A;  2C1D A;  1OVR A;  1SQV E;  1Q90 D;  3C9I A;  1NTZ G;  5APW A;  2O3J A;  1G2C B;  3V6I A;  1RF1 C;  2Q7C A;  1DII C;  1FI3 A;  3Q5P A;  1RF0 C;  1I54 A;  3X39 A;  2N3B A;  3OAK A;  2SPZ A;  1U74 B;  2JTI B;  4XYD B;  3L74 E;  1LT9 A;  4L1Q A;  1YBK A;  2A06 E;  2ZT9 D;  2D0W A;  1T3J A;  4YE1 A;  3HUS A;  4AAM A;  4GDO A;  1RE4 C;  1H0T A;  4IFD K;  3GHG A;  4U7J A;  3OW2 O;  3ZCF A;  1N8R Q;  2N9I A;  2YXQ B;  2FBW C;  4WBA A;  5CMZ A;  5KAI E;  3I56 P;  5KAI V;  3VN0 A;  1ZP0 C;  1AV1 A;  3IF4 A;  1JY2 O;  1IK7 A;  1S5L H;  1E2R A;  3WFE C;  1MUU A;  2WPQ A;  4NPE A;  155C A;  1GQ1 A;  1JTH B;  3D6Y A;  1NTM D;  4DCK A;  3H32 B;  3H1I E;  5KLI B;  4WQ7 A;  4L3G A;  1CYI A;  1L4A A;  2G8Y A;  3P8M C;  1T3U A;  1GL2 D;  2QVA A;  1HJ5 A;  1T2K D;  1T8Z A;  4I1L A;  1I55 A;  3WMM 0;  2I8F A;  1WMK A;  3WFB C;  1JTH A;  2OTK E;  3D0W A;  3VRD A;  1SQQ J;  1CRJ A;  1EDI A;  1P84 H;  5AVR B;  2MTA C;  4XE5 B;  1CHJ A;  2O1K A;  1AJY A;  3E7K A;  3NWV A;  2J5U A;  3BRT B;  4H44 D;  2GC7 D;  5B6Q A;  1N86 A;  3H1K G;  1M90 Q;  1R0Q A;  3HD7 A;  4BXL A;  3LW5 J;  1XTC C;  3L73 J;  3BCC J;  3GG2 A;  4DT0 A;  1A02 F;  3PXS A;  1IO4 A;  3ITK A;  2GIW A;  4FB1 A;  3L75 E;  2FYU J;  1Y8A A;  3VNW A;  1OVU A;  2P58 A;  3WUT A;  2NZ2 A;  4IL6 H;  1KQS O;  1SQP J;  2B88 A;  3SJL A;  2AXT E;  1X8Y A;  3JSV C;  4FA9 A;  1JB0 J;  4H13 D;  3CXH D;  1DT1 A;  2YIU B;  3DMI A;  3F89 A;  2WIT A;  2WSE J;  2VHD A;  5APQ A;  1CXA A;  5E79 H;  4U3F G;  1BL9 A;  5AVQ B;  1LTI C;  5BVZ A;  4YPC A;  2K9J B;  2B11 B;  2E76 B;  1COR A;  2O01 H;  2OGU A;  1QLE D;  351C A;  3A7O A;  1M8O B;  2N3Y A;  1YTC A;  2OYH C;  1QX8 A;  4N78 E;  4HJG H;  3B8E B;  1URQ B;  1GL2 C;  2B0Z B;  5KLV J;  3SWY A;  2LXC B;  5KTB A;  1SQX J;  2W6A A;  4I7Z C;  1GW3 A;  1LTS C;  1YQ3 C;  1WVE C;  3S4R A;  1GU5 A;  3V2R A;  3P8C D;  2D2C D;  1K3H A;  1K8A Q;  1CIG A;  1RE3 A;  1NAF A;  3VP9 A;  1JNM A;  1DW1 A;  1YIQ A;  1DW0 A;  2E74 C;  1NTZ J;  1NU1 K;  4JPZ B;  1HZV A;  3HQ9 A;  1CRY A;  1PP9 J;  3O5C A;  2E74 B;  1LC1 A;  1LT9 C;  1VQ7 P;  1CYJ A;  5AW6 B;  1C75 A;  1NWQ A;  1CIF A;  1KB0 A;  5GTH H;  1SQP K;  3WC8 A;  3SFE C;  1YIJ P;  1GJQ A;  3WU2 H;  4WQ8 A;  1VQ8 P;  1N73 B;  1HJ3 A;  2ZAE B;  4IL6 E;  3BAT A;  2W6B A;  3HD7 C;  5CIC B;  1NTK G;  4D6T D;  1NH4 A;  1PP9 E;  2XKM A;  3TGU G;  3LW5 H;  2V7Q J;  1HGZ A;  1LWU C;  1M57 D;  4PW9 B;  4Z1M H;  2MJZ A;  2QJY C;  2D0S A;  1JY3 O;  1VQL P;  2WPV B;  4GOD A;  2I1K A;  1RF1 A;  1PGJ A;  1VQ6 P;  1NTM G;  2FYU K;  2DVH A;  4GYD A;  1NU1 D;  3B71 A;  1I5T A;  3P7K A;  1WEJ F;  2OTL P;  3RK3 E;  1GMJ A;  4IFM A;  1Q81 Q;  4GOF A;  2BCC G;  2OYI C; 
#chains in the Genus database with same CATH homology
 2DGE A;  2FRC A;  2OZ1 A;  5DF5 A;  4AX3 A;  1FHB A;  1A56 A;  1N90 A;  3L75 D;  1DW2 A;  1NIR A;  2PAC A;  3TDK A;  1KX2 A;  451C A;  3L72 D;  1GU2 A;  2Y0D A;  1IZL 0;  1IO3 A;  1E29 A;  2ZOO A;  4H0K A;  1P84 D;  3DP5 A;  4WQD A;  1CCH A;  1H32 B;  5KKZ B;  1LC2 A;  1A8C A;  1M6Z A;  3CX5 D;  1GIW A;  2ZZS 1;  1CYC A;  3PXW A;  1YCC A;  1AKK A;  3PLN A;  1KYO W;  1N15 A;  1CSU A;  4EIC A;  5CIG B;  3L70 D;  1W5C T;  1KYO D;  3ZOY A;  2XTS B;  5CIE B;  1H32 A;  2FYN B;  1MZ4 A;  2N18 C;  4MU8 A;  3H1L D;  2IBZ D;  2C1D B;  1NMI A;  1AYG A;  3ZOX A;  3PTZ A;  1CTY A;  1BGY D;  1I8O A;  4FAV A;  1QKS A;  1U75 B;  2YCC A;  3FWL A;  2FWL A;  3CYT I;  3RLM A;  5GTH V;  2JQR A;  1H1O A;  3A0B V;  1IRW A;  2JWA A;  4QAO A;  1YEB A;  3MK7 B;  1ZRT D;  1K3G A;  2AI5 A;  3L4O A;  3SWS A;  3L4M A;  5AUR A;  4WQE A;  3SLE A;  3NBS A;  1OCD A;  3RN0 A;  3M97 X;  1I6D A;  2A06 D;  1LFM A;  2KNC B;  4FA4 A;  1DW3 A;  2Y0E A;  2YQB A;  2LIR A;  4EIF A;  3SXT A;  4AAN A;  4O1W A;  5E79 V;  1YFC A;  2Q3E A;  3OCD A;  3WU2 V;  2BPB B;  5H2F V;  4Q5P A;  4Y5R A;  2Y0C A;  1KIB A;  1CRG A;  1J3S A;  1NTZ D;  2V07 A;  2ZON G;  1IRV A;  2MHM A;  3TF5 A;  4AAO A;  2HV4 A;  2L4D A;  3ZOO A;  4JCG A;  4UB8 V;  2L91 A;  3OCD B;  3PH2 B;  3PRJ A;  1BCC D;  1GKS A;  1I8P A;  4A7P A;  1KX7 A;  2OZ1 B;  1JDL A;  4J20 A;  3ZBM A;  1YIC A;  3O20 A;  1QYZ A;  1CRC A;  3CXH W;  2C1D A;  3H1I D;  2C1U A;  1RAP A;  4FA1 A;  1N9C A;  5TJH A;  5KLV D;  3VYM A;  2CE1 A;  4WQB A;  3HQ7 A;  1CRH A;  1FOC A;  2O3J A;  3KZI V;  1DVH A;  1DII C;  1FI3 A;  1COT A;  3C2C A;  1I54 A;  2PCC B;  3X39 A;  2N3B A;  1AOF A;  1U74 B;  2JTI B;  4XYD B;  1KV9 A;  4PWA A;  3PXT A;  4L1Q A;  1CCR A;  1CIH A;  1RZ5 A;  4FAN A;  2D0W A;  4O1Q A;  4YE1 A;  1IQC A;  2CA3 B;  4AAM A;  4LJI A;  3ZCF A;  1CC5 A;  3PHL A;  2N18 B;  2N9I A;  5DFS A;  1F1F A;  5KAI V;  1SQP D;  5B5E V;  1FCD C;  1F1C A;  4H0J A;  3OA8 A;  2CE0 A;  1AOQ A;  2RMZ A;  5EXQ A;  5CIH B;  1E2R A;  3WFE C;  155C A;  1CO6 A;  3ORV A;  1GQ1 A;  1PP9 D;  1S5L V;  3CX5 W;  1NTM D;  2C9X B;  4UB6 V;  3BCC D;  4XXL A;  5KLI B;  3OA8 B;  1CXC A;  4WQ7 A;  4L3G A;  1CYI A;  1ZZH A;  3HQ6 A;  1CSV A;  3H1J D;  1CSW A;  1HJ5 A;  2BH4 X;  5KAF V;  1L0L D;  1I55 A;  2I8F A;  1HZU A;  3WFB C;  3KHU A;  3VRD A;  5CID B;  1CRJ A;  2MTA C;  1CHJ A;  2C1V A;  3NWV A;  1CIE A;  1SQQ D;  5GTI V;  5B66 V;  2BGV X;  2ZXY A;  3SVW A;  2GC7 D;  1BE3 D;  3WFC C;  5B6Q A;  1DVV A;  2ZBO A;  1DIQ C;  1R0Q A;  1QL4 A;  2CXB A;  3RN1 A;  2BCN B;  1FI9 A;  3TGU D;  1B7V A;  5DJQ B;  1CED A;  3A9F A;  2GC4 D;  4GED B;  3GG2 A;  4RSZ A;  4EDF A;  3PXS A;  1C52 A;  1YEA A;  1LMS A;  1MG2 D;  4PD4 D;  1KB9 D;  2QJK B;  1C6S A;  5CYT R;  3ITK A;  1H31 B;  2GIW A;  4FB1 A;  3O1Y A;  1CNO A;  3VNW A;  4AAL A;  1C6R A;  3WFD C;  3CWB D;  1FI7 A;  2YK3 A;  2EXV A;  2ORL A;  3L74 D;  5DJQ C;  2AIU A;  3SJL A;  2FYU D;  4FA9 A;  1LS9 A;  1HJ4 A;  4L3H A;  2LIT A;  3CXH D;  5TIS V;  1DT1 A;  2YIU B;  2GB8 B;  1C2N A;  1ETP A;  2B12 B;  3DMI A;  2B10 B;  2VHD A;  1CXA A;  1SQB D;  3ZOW A;  5C9M A;  1BL9 A;  3RMZ A;  1M60 A;  1CHH A;  2K9J B;  2B11 B;  1COR A;  4FA5 A;  3L73 D;  3H1H D;  1S6V B;  3HQ8 A;  351C A;  1RAQ A;  4U3F D;  3TYI A;  1M70 A;  4RJT A;  1H33 B;  1QN2 A;  2N3Y A;  1YTC A;  1H9Y A;  3CU4 A;  2B0Z B;  1NNO A;  2B4Z A;  2C2C A;  1E8E A;  2KS1 A;  2QJP B;  2QG4 A;  1VYD A;  3WUI A;  3CP5 A;  1N50 A;  1OAE A;  5CIB B;  1WVE C;  3A0H V;  1RZ6 A;  1GDV A;  1K3H A;  1CIG A;  4EIE A;  1I6E A;  3VMA A;  4WQA A;  2CA4 B;  1MG3 D;  2QJY B;  2N9Y B;  1DW1 A;  1YIQ A;  2BCC D;  1DW0 A;  1HRO A;  4DY9 A;  5C0Z A;  3NBT A;  4WQC A;  1HZV A;  3HQ9 A;  1H31 A;  1PPJ D;  2C8S A;  1CRY A;  3JBT B;  3O5C A;  1SQX D;  1LC1 A;  4V2K A;  1CYJ A;  1C75 A;  1CIF A;  1A2S A;  3DR0 A;  4PJ0 V;  1KB0 A;  1L9B C;  2PCB B;  1L0N D;  1L9J C;  3WC8 A;  1C6O A;  1SQV D;  1GJQ A;  1C2R A;  1NML A;  3ZIY A;  4WQ8 A;  1HJ3 A;  2AXT V;  3MK7 C;  1QL3 A;  1EB7 A;  3O0R C;  2RN0 A;  3GW6 A;  4IL6 V;  1YNR A;  2BLF B;  1CTJ A;  4WQ9 A;  4KMG A;  5CIC B;  4D6T D;  1CTZ A;  1CRI A;  2BH5 X;  4PW9 B;  2N9J A;  3H1K D;  1H33 A;  2D0S A;  1CHI A;  1EZV D;  4P4Q B;  1FJ0 A;  3L71 D;  1H9X A;  1HRC A;  2DVH A;  4NFG B;  4GYD A;  1NU1 D;  1CSX A;  1HH7 A;  1W2L A;  1NTK D;  2V08 A;  5CIF B;  1I5T A;  1C7M A;  1WEJ F;  1HCM A;  4EID A;  5IY5 1;  4N0K A;  4K3I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...