1SQQD

Crystal structure analysis of bovine bc1 with methoxy acrylate stilbene (moas)
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
241
structure length
241
Chain Sequence
b'SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 51
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1sqqD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1sqqD02
2ZONG 5CIDB 2Y0CA 2KNCB 5CIBB 3GW6A 1CIEA 5CYTR 5CIFB 2FWLA 1CRCA 4WQ7A 5KLIB 1KX7A 1NIRA 4WQCA 1N50A 2Y0DA 4EDFA 3L70D 2ORLA 4FA4A 4AX3A 1CIHA 1CHIA 5E79V 4EIEA 1L9JC 1PP9D 3CU4A 1C7MA 3ZOWA 1N90A 1FJ0A 1QL3A 1KYOD 1CTZA 1E8EA 1I6DA 351CA 5DF5A 3OA8B 1H33A 4NFGB 2MHMA 4XYDB 1QL4A 2QG4A 1CIGA 1CTYA 4N0KA 1HJ5A 1ZZHA 1QYZA 155CA 1CIFA 5B5EV 2D0SA 2QJPB 5H2FV 3CX5D 3O5CA 1CCHA 3MK7B 1F1FA 1CXAA 3PTZA 5CIGB 3VMAA 2C9XB 2B0ZB 3WFBC 1SQQD 3L71D 1IQCA 1DW2A 1J3SA 1GIWA 3H1ID 1MG2D 4PW9B 3ZOXA 1FHBA 2OZ1A 4FA1A 1U74B 1FI7A 1OAEA 1AKKA 1C75A 3A0HV 1HCMA 1ETPA 2PCCB 1IO3A 1CYIA 1CHJA 2RN0A 4RSZA 2BCCD 1DIIC 2L4DA 2AI5A 3CXHD 1SQVD 1VYDA 3L72D 2JTIB 5B6QA 2YQBA 1EZVD 1HZUA 3PHLA 1W2LA 3VRDA 1DT1A 3BCCD 4K3IA 2JQRA 3H1HD 3L73D 1DIQC 1DW0A 3H1JD 2Q3EA 3C2CA 3PH2B 1LS9A 5DFSA 1CSVA 2C1VA 451CA 1FCDC 3PXWA 1AOQA 1CRHA 1KB9D 1N15A 2V07A 2YIUB 1CYJA 2N9IA 1GDVA 1MG3D 5KKZB 1FOCA 1K3GA 4PD4D 2C2CA 1COTA 3HQ6A 2FYNB 2D0WA 1BL9A 1B7VA 1RAQA 4FB1A 4RJTA 1YEAA 3L4OA 2N9JA 3OA8A 1CCRA 5DJQC 1LMSA 2B11B 2B10B 1I8OA 4L1QA 1HJ3A 3TF5A 1C2NA 3SJLA 2VHDA 1R0QA 2EXVA 3RN0A 4JCGA 2GIWA 1CSXA 1N9CA 3KHUA 1E29A 3WU2V 1AOFA 1S5LV 1A8CA 3HQ9A 1KV9A 1H1OA 1CC5A 1H32B 1WVEC 5GTIV 1YICA 1YCCA 2C1DB 3A0BV 4P4QB 2K9JB 3FWLA 4Y5RA 2BH5X 5CIHB 3WUIA 1RAPA 2DGEA 3OCDA 1L0LD 5CICB 2N18C 1YNRA 2ZXYA 3O0RC 1IZL0 4PWAA 1RZ6A 3PXSA 4KMGA 1PPJD 4EICA 5KAFV 2C1UA 4AALA 2YK3A 2N9YB 2A06D 1H31A 2BPBB 5C0ZA 2AIUA 3ZIYA 5TJHA 1CORA 1C6RA 1NMLA 3RLMA 1NNOA 2N3BA 1I55A 4AANA 3O20A 3ZOYA 3OCDB 3L4MA 3VYMA 3HQ8A 3KZIV 1BCCD 1A2SA 3WC8A 1LC2A 4XXLA 3TGUD 1YFCA 3H1LD 3X39A 4WQ8A 3L75D 2B12B 1AYGA 1H31B 1L0ND 1FI3A 2GC7D 4FA5A 3RN1A 2MTAC 1GJQA 1YTCA 2BCNB 1QN2A 4D6TD 3NBTA 2BGVX 4DY9A 1K3HA 2ZOOA 2CE0A 4WQAA 4H0JA 1M60A 1CSWA 3TYIA 1CO6A 3WFDC 3ZCFA 1KYOW 2QJKB 4A7PA 1HZVA 4PJ0V 4EIDA 1M70A 1P84D 4GYDA 4WQ9A 3CP5A 3M97X 4WQEA 2JWAA 1RZ5A 1BGYD 4WQDA 5CIEB 1GKSA 2ZBOA 3CX5W 1YIQA 1H32A 2AXTV 1H9YA 3HQ7A 3WFEC 2C1DA 1I54A 2RMZA 2LIRA 1EB7A 1E2RA 2KS1A 4FANA 2CA4B 1HH7A 4MU8A 3TDKA 1NTMD 3NWVA 1KIBA 1ZRTD 4O1WA 2PCBB 5C9MA 1W5CT 1CRGA 3A9FA 1NTKD 1C6SA 2BH4X 3RMZA 5DJQB 1I8PA 1H9XA 4O1QA 4FA9A 4U3FD 1CXCA 1YEBA 4WQBA 3ITKA 4H0KA 2LITA 2GC4D 1CNOA 1LFMA 5GTHV 1LC1A 3PXTA 2QJYB 4L3HA 3PRJA 1NMIA 1U75B 3CXHW 2BLFB 2DVHA 2XTSB 3SXTA 3L74D 3O1YA 3GG2A 3CYTI 5EXQA 2GB8B 5KAIV 4YE1A 3ZOOA 3DR0A 3MK7C 1NU1D 1DVVA 4V2KA 2FRCA 1QKSA 2CXBA 1GQ1A 1DVHA 1A56A 1HROA 1OCDA 3VNWA 3WFCC 3ZBMA 4QAOA 1C2RA 2V08A 3SVWA 1SQPD 5TISV 3ORVA 1CHHA 1GU2A 5KLVD 2FYUD 1CTJA 1HJ4A 1MZ4A 1KX2A 2N18B 1L9BC 2CE1A 1CRIA 4AAMA 1I6EA 1HRCA 2O3JA 3JBTB 2Y0EA 2B4ZA 1JDLA 1H33B 4Q5PA 4EIFA 2YCCA 4J20A 2ZZS1 2I8FA 3DMIA 1DW1A 1SQXD 1IRWA 1CRYA 1CYCA 4LJIA 1CRJA 2N3YA 5B66V 3SLEA 1CEDA 4GEDB 3NBSA 1IRVA 2CA3B 4UB8V 1WEJF 4FAVA 1C52A 1SQBD 3SWSA 3PLNA 2C8SA 2OZ1B 1S6VB 1NTZD 1DW3A 1M6ZA 3DP5A 1C6OA 2HV4A 1CSUA 1FI9A 2L91A 4UB6V 5IY51 1I5TA 1BE3D 2IBZD 4AAOA 1KB0A 3CWBD 3H1KD 2PACA 5AURA 4IL6V 4L3GA 1F1CA
chains in the Genus database with same CATH superfamily
2RH0A 4XA4A 2ZONG 1FZFA 1PIXA 4OGQC 2I1JA 2YKOA 1T2KD 4N78E 1A02J 1M8OB 1NGMB 4WQCA 2IX7C 2Y0DA 2Q1KA 2O01H 1KZUB 1CW5A 3BASA 4FA4A 3V2QA 5E79V 3L71J 1PV3A 1N7LA 1C7MA 3ZOWA 2K37A 1FJ0A 3KDPB 2GM4A 1QVFO 5DF5A 2MHMA 5CCHA 3HD7C 1FJPA 1JCCA 1L0NE 1CIGA 1HJ5A 1Z56A 1QYZA 4GT1A 2D0SA 4D6TE 1J1EC 4N3YB 3K5BA 3M9BA 2QJPB 3A5TA 5H2FV 3CX5D 3Q5SA 2BCCJ 3HE5B 1NVOA 1CCHA 1F1FA 1RE3A 3L72J 3VMAA 2NPSD 2C9XB 3WFBC 3HD7B 1DW2A 1J3SA 1GIWA 2GUSA 1SQQK 3H1ID 2CPSA 2RKLA 2OYIC 3G71P 1FI7A 1GW3A 3WU2E 1S5LX 2UWJE 3D70A 3CCEP 1FZBA 1NO4A 2NZ2A 5AVSB 1R5LA 2PCCB 3FWNA 2R3CA 1VYDA 1KILD 2XDJA 3AE7C 3N7NA 1NTME 1ZRTE 1AV1A 1L4AC 1W2LA 3VRDA 3GF7A 4K3IA 3CCSP 3L73D 1RF0A 1RQUA 2KNCA 2YKQA 1OZHA 3H1JD 3VMXA 3E7KA 1T6AA 1LS9A 2YXQB 2Q3IA 1FCDC 3PXWA 1AOQA 2YIUB 1CYJA 2N9IA 1L0NG 1URQA 1K3GA 4H13C 2YO3A 1IFIA 3HRNA 1COTA 4D6TG 2D0WA 1LTAC 1BL9A 1B7VA 4RJTA 1SQPE 2FXPA 1CCRA 5GTIH 1KYOI 4ZKPA 1JUNA 3A0BH 5KLVE 3UIAA 2B10B 1I8OA 3TF5A 1LNQA 1C2NA 5H2FH 4QMAA 2KUBA 5CCGD 2VHDA 2EXVA 3GF3A 1N9CA 3KHUA 1E29A 4PV1C 1DH3A 1H8AA 1S5LV 2M0BA 5KAFH 1H1OA 4Z1MH 3QWOC 5C39A 1NTMG 2ZVNB 1H32B 2A45H 1VQ5P 1IK7A 1X0TA 4PV1B 4Y5RA 1JY2O 4BRYB 2OYHC 1ZP0C 1RAPA 2DGEA 1IFDA 3KZIH 3BCCE 1Y47A 3LW5J 2N1TA 1L0LK 1NTZE 3S9OA 3E1RA 4AALA 1EZVI 4ZNCA 3JSVC 4HJGH 4JF7A 1H31A 1J1DC 2JR8A 2OYHB 3ZIYA 1FZCA 2E75D 5TJHA 1RF1B 1QL1A 2YO2A 1OMIA 3VYMA 3L4MA 1SQPG 3GMAA 5E79E 2IYOA 3AEFC 3RBZA 1NAYA 5KLVG 1JY2N 1KB9I 1DIPA 1VDFA 4YXDC 1JY3O 2E74C 1BGYJ 1AYGA 1H31B 1L0ND 4PD4I 2HPCB 4K35A 1M1JB 2BCNB 1HTLC 4D6TD 1LTSC 4OGQD 1ZLLA 2BGVX 1IFNA 3RK2B 1VQKP 1K8AQ 2CE0A 1M60A 3TYIA 3H6PA 3WFDC 1VL2A 2VRSA 2ZT9C 2WVRA 1NTZK 3MZWB 1M70A 4GYDA 3M97X 4WQEA 1RZ5A 2WSFH 1GKSA 1NTZG 3EWKA 2RMZA 1LWUA 3L71E 2KS1A 1HH7A 1NTMD 1ZRTD 4O1WA 3G9RA 3B4SA 1C6SA 3WUUA 4WY4B 1IZNB 2WPVB 2WSEH 1USEA 3W68A 5APUA 1CXCA 1YEBA 4WQBA 2W6JH 3V6IA 2LITA 3F89A 4W7ZA 5AVTB 3AEBC 2HYNA 2BCCE 3NXSA 2WSSH 2ZYDA 3CXHW 4EI2A 3VMYA 1T2KC 3CXHE 3L72E 2KS1B 3CYTI 2WSCH 2GB8B 4YE1A 3ZOOA 3DR0A 4IOIH 4KJMA 3G4SP 3A3YB 1M7LA 2QIWA 1A56A 2IZ0A 4H44C 4QAOA 4DJGA 2V08A 1SQPD 2B89A 1L0NJ 1OVVA 1S72P 5KLVD 1MZ4A 3HUSB 3F5HA 2CE1A 5KJ7C 5AW6B 1I6EA 1KQSO 1SQBJ 2AXCA 1HRCA 1KORA 4Y28J 4TLFA 2B4ZA 4Q5PA 3G3ZA 1MFTA 2ZAEB 1S5LE 2ZZS1 3L71G 3DMIA 4H13D 1DW1A 5APWA 1CYCA 3CWBJ 5B66V 3P8CE 3SLEA 3V2NA 1SFCA 2XNDH 3L37A 4AQRD 1NKZB 4FAVA 1VQNP 3JCUE 1N86A 3HTKA 1LTJA 4GOFA 1NTMJ 1GL2A 1YBKA 1NTZD 2QA4P 2NPSB 1DW3A 1YIJP 2BCCG 1YI2P 3L72G 2FYNC 4UB6V 3L70J 3AE4C 3V2RA 1KILC 2M3EA 2O01J 1KB0A 1SFCB 5AVVB 2OARA 4JQ0D 5AURA 3H32B 1R8EA 2BASA 5CIBB 2J59M 3GW6A 1CIEA 5CYTR 2E42A 2FWLA 1CRCA 1NIRA 2A06E 3MUDC 3OJAB 2R32A 2YKPA 3CL3D 1SQPJ 1N73B 2Q7CA 4AX3A 5KLVJ 1CHIA 3RK3C 1KFNA 1AA0A 3MHVA 1KYOH 1BCCE 1Q82Q 1QL3A 1VQ6P 1I6DA 1BDCA 3OA8B 1H33A 2P1JA 4ASWA 3I5CA 4XYDB 1FAVA 4N0KA 2C0WA 3WUVA 3TYYA 3IN6A 1CIFA 5B5EV 3SWKA 1HGVA 1PGPA 3B5NA 2ZYGA 3CC2P 1VQOP 1CXAA 1IC2A 1FZAA 2E74D 3L71D 1IQCA 3BCCJ 1NAFA 4HH2A 1U74B 5BU5A 3RK3E 1KQGB 4W7YA 1BGYE 1OAEA 1DEEG 1PGOA 1MUUA 1C75A 2V7QH 2XV5A 1FJKA 2HODB 2ZT9D 1ETPA 1P84I 1CHJA 2RN0A 2BCCD 2FY8A 2A06G 1DIIC 2L4DA 2AI5A 3CXHD 1N7SD 1T3UA 3M9HA 2FFDC 3L72D 5B6QA 3AEEC 3AEGC 1LP1A 5APVA 2YXRB 2H8PD 1DT1A 1LGHB 5AW0B 2JQRA 2IDBA 2WMMA 2MJZA 2E75C 5DFSA 1BCCG 1RE4C 2FFDB 1MV8A 1KB9H 3M0DC 3V2PA 5AW4B 3CCLP 1RHZB 1GDVA 5KKZB 1FOCA 1IFPA 2E75B 4PD4H 1EXJA 1U7JA 1KC8Q 1NU1E 3KYQA 1VQ9P 5CBOA 5AVXB 1RAQA 3CLQA 3L4OA 1Y8AA 2Z5HA 3RL0B 1IFMA 5DJQC 2B11B 3PH0A 5B5EH 3P8CD 5B66E 1IFJA 3SJLA 2Y9ZA 1BGYG 1RH5B 4H44D 3HE5A 4OGQB 4R4LA 2QJYC 1W2BO 3RN0A 1YTZI 3CMAP 2OTKE 3HD7A 1AOFA 5EFWB 2JJLA 1A8CA 4PJ0E 5KJ7D 2D2CD 1UIIA 4ZMDA 1Q2NA 5GTIV 3SFDC 1YICA 4UB6E 1YTZT 2KXPB 4O9BA 2C1DB 3A0BV 4I7ZC 3SSUA 1H0TB 5CIHB 3WUIA 1OW6A 1HUCA 1SQBE 1JCDA 1YNRA 1X79B 3Q3DA 4PWAA 1RZ6A 1LJ2A 4KMGA 1WRGA 4EICA 5KAFV 1IO4A 1FS0E 2C1UA 2YK3A 1J1EB 2N9YB 2A06D 5CCHC 1BE3E 1NU1G 2IBZE 5C0ZA 2AIUA 3CWBE 3MTUE 3V5BA 2WTYA 2P67A 2KK7A 1HWTC 1NHLA 2WPQA 3O20A 1HGZA 1L4AA 3HQ8A 3KZIV 1OVUA 2R44A 2OYIB 1KV4A 1RE3C 2P10A 1BCCD 3IFMA 1YFCA 4WQ8A 2B12B 1JEKA 3L70E 3TK1A 1FI3A 2GC7D 4FA5A 4I1LA 3RN1A 3ZDMA 2MTAC 1GJQA 2WSFJ 1L0NK 2AXTH 4GODA 1D7MA 2ZOOA 2Z5IA 1L4AB 1NH4A 2KB7P 1SQBK 4EIDA 3AE1C 1JMMA 1CZQA 1FC2C 2JWAA 4U3FJ 3RK3D 1JTHB 1BGYD 1SQBG 2Q5UA 2WSEJ 2ZYAA 1H88A 2ZBOA 4H0LD 5GTHH 1H32A 5AW8B 1USDA 4H13B 1I54A 5AW9B 1EB7A 2MKVA 4BRYA 2I8DA 2K1AA 1URQC 4MU8A 5KAIH 2HG5D 2LXCB 2WSCJ 1GTWA 1T3JA 2IBZG 1NTMK 1CRGA 3CWBG 4I6MC 1OXZA 2KP8A 3R2PA 3M06A 3QH9A 2P2UA 2GC4D 1CSBA 1CNOA 4TT3H 2WWWA 3WUTA 2OYHA 2IYPA 1RF1A 1EDJA 3L70G 3U59A 3PJSK 4IL6X 3MK7C 3C9IA 1NU1D 1GQ1A 1DVHA 1BCCJ 3B5ND 3T97B 1LT1A 1HROA 3WFCC 4HB1A 4N78D 2JDIH 1KQLA 3ORVA 1SQPK 3AEDC 1GU2A 3AE3C 2HPCA 2B87B 2BEQD 1M1JA 1HJ4A 1GD2E 2W27A 2E76D 5KLVK 1U7MA 3EQ2A 4C46A 5AVZB 1GK6A 2CPBA 3JBTB 3CCVP 4JPZB 1JB0J 5DJUB 1J1DB 3B71A 4EIFA 1S4XA 3Q5PA 4KT0J 1JO5A 1IRWA 1PFIA 4L76A 5GTIE 1X22A 2E43A 3A0BE 1FZCC 3CCMP 3H1KJ 3M0AA 5AVYB 5H2FE 2M8RA 4UB8V 1Y9BA 3BRVB 3AE5C 1SS1A 1SQBD 3SWSA 3AE2C 3PLNA 1W5CE 2OZ1B 1P84H 2E74B 2AEMA 5APTA 1S2EA 2HV4A 4GOEA 2AEJA 2L91A 5KAFE 1T8ZA 1GDTA 5IY51 4WY4A 1N7SC 3AEAC 3FXDA 1BE3D 2HLOA 3IAOA 1EDLA 3BCCG 2IBZD 3CWBD 1MFZA 4IL6V 1F1CA 2ZT9B 1PP9J 1VPCA 1K04A 1KN7A 2C9NY 3KZIE 3Q1MA 1LTBC 4EYYQ 1NU1J 5APYA 2K9YA 5CIFB 1U57A 1NYHA 4WQ7A 1RY3A 3I55P 5L8RJ 1N50A 2QE7H 3L70D 2Y9YA 3AECC 1ZMEC 1FZEA 1ZN5A 1HJ0A 4EIEA 1SQQJ 3HUSA 5CCHD 3CU4A 1LWUC 3MP7B 2ZVOB 1CTZA 1VF5C 4NFGB 1AQTA 1XTCC 2C9LY 2WPRA 3CC4P 2O1KA 1QL4A 3GHGC 5AVUB 2QG4A 1CTYA 1ZZHA 155CA 3CX5H 5BVZA 5DJTB 2V7QJ 3O5CA 5CJ4A 5AVWB 3P7KA 3PTZA 1SQVJ 5CIGB 1PZQA 2B0ZB 2D2CC 4UB8H 2POHA 1P84E 3GHGB 4H44B 1MG2D 1JMBA 3H1HJ 2H43A 1GU5A 4XFJA 1FHBA 2ITAA 4FA1A 2A45G 3D0WA 3O6QB 2NPSA 2KZIA 1EDKA 1DX7A 1JOCA 2YMYA 3PP5A 1BE3J 1HCMA 1IO3A 2JP3A 1FDMA 2R5BA 4RSZA 2LR2A 3LIEA 1AJYA 2JTIB 4IL6H 2YQBA 1KTMA 3D71A 1YQ4C 3H32A 3PHLA 1HJBA 2QM7A 3V4QA 1BSNA 1QX8A 3BCCD 2N9BA 5APXA 1OIPA 1DIQC 5AVQB 1DW0A 4Y99C 1KILA 4U3FE 1VQPP 2FKWB 2Q3EA 4I2LC 3PH2B 1CSVA 1URQD 451CA 1NWQA 3CMEP 1IK9A 2J58A 1N73A 2V07A 5CJ0A 3Q2YA 1MG3D 2GA1A 4WB4A 4YPCA 4Y99B 1G1JA 2FYNB 3WMM0 1GL2C 5AW1B 1KILB 2G3AA 1YEAA 2N9JA 3OA8A 4L73A 1FOSF 4GDOA 1MZ9A 1LMSA 1VQ4P 4EOTA 2FYUE 2KIKA 4L1QA 4K3AA 4WWIA 1R0QA 2GIWA 4LC1A 2Z4EA 1CSXA 1ZOYC 4H0LC 3WU2V 5CCGA 1KV9A 1CC5A 1WVEC 1YCCA 3RK3B 4P4QB 2N1TD 2K9JB 3FWLA 2HODA 4H0LB 3IF4A 2OQQA 4U3FG 1K73Q 1YHQP 3OCDA 5CICB 3AE6C 2N18C 1ZW0A 4NPFX 1A02F 3PXSA 3TGUJ 1S9KE 3L75J 4YXWH 2WT7B 3RL0g 2FFDA 1NJIQ 3H1KE 3B5NC 1G1IA 4AANA 3ZOYA 3NFQA 3OCDB 1J2JB 3O8ZA 1RQVA 1NOHA 3KPEA 1LT9C 1A2SA 2FYUG 2NRGA 3S1KA 2W6BA 2CK3H 3SFEC 3X39A 2E76C 2QJKC 3M0DA 1VQMP 1MKMA 3A2AA 2YNYA 3LIDA 1M1KQ 1Q86Q 1QN2A 3NBTA 1LT9B 1EDIA 4DY9A 2W6AA 4WQAA 4H0JA 1FDIA 1PP9E 1CSWA 3VP9A 1CO6A 3ZCFA 4IFDK 1KYOW 2QJKB 4A7PA 1HZVA 1KYOE 1K05A 3CCQP 1P84D 2IPPA 1NTKJ 4RESB 4XE5B 3CP5A 3WU2H 2FXMA 3BVHA 3II6A 5CIEB 3OA7A 1HVVA 3I56P 2Q9IA 2AXTV 2O1JA 1H9YA 3HQ7A 1VQ8P 2C1DA 1E5WA 1VF5D 3HE4B 1EQ7A 3L74J 3KQGA 1H0TA 1SQQE 3GLMA 5AW5B 1KIBA 5C9MA 1X8YA 3L36A 1IJDB 1PGQA 2R5DA 3CX5I 3H1KG 1SVFA 5DJQB 4O1QA 3M91A 4U3FD 3ITKA 4H0KA 1G2CA 3VMZA 3VYIA 5GTHV 1LFMA 1LC1A 1YJWP 1LTGC 2QJYB 3BATA 3PRJA 1NMIA 2DVHA 2XTSB 4GKGA 3SXTA 1SQVE 1W2EA 2QJPC 5EXQA 1EZVE 5KAIV 1DD3A 3H1HE 2OYIA 4V2KA 2FRCA 1QKSA 2CXBA 1NU1K 2L5GB 1SP4A 1OCDA 2FBWC 1PP9G 4I7ZB 2OGUA 3SVWA 5TISV 1SQXJ 1G2CB 1CHHA 2WPSA 3CC7P 1GK4A 1AFOA 2FYUD 1KB9E 1CTJA 3H25A 1KX2A 1L9BC 4NPEA 2B88A 1OWAA 2XU6A 4PD4E 3Q5RA 1JDLA 3U1AA 4CPGA 4OWFA 2C0XA 2YCCA 2IFNA 2K3RA 2V4HA 4J20A 1SQQG 1SFCD 2IFMA 3TNUA 2H7HA 1JTHA 5AW3B 1CRYA 4LJIA 1XTGB 1Q81Q 1CRJA 2N3YA 2E5YA 1GL2D 2JO1A 5B5EE 1CEDA 1S1CX 1SQVK 5APQA 1C52A 2FYZA 2C8SA 1CI6A 2YIUC 1S6VB 5AW7B 1YJNP 1KD1Q 1M6ZA 2B9BA 3IR9A 1PL5A 1JY2P 4KHXA 1SQVG 1S9KD 1RF0C 1CSUA 1EZVG 3TNUB 3RBXA 1I5TA 2GUVA 3H1HG 3D6YA 1FU1A 4AAOA 4RKUJ 5KLIC 4BWNA 3L35A 3OW2O 3H1KD 3VN0A 2KI7B 4EIJA 5E79H 1L0LE 4ZKUA 3P8MC 1CI6B 4HKZH 1BE3G 5CIDB 1AVOA 2Y0CA 2KNCB 4L75A 5AW2B 1PPJE 2OTLP 1VQ7P 5KLIB 1KX7A 2ZJSE 1EXIA 3T97A 1YYCA 3M9QA 4EDFA 4R4MA 1FDOA 1QLED 4AUWA 2ORLA 1X9VA 5TISH 4M3LA 3MGNA 1CIHA 1URQB 3ABVC 1UIXA 2FYUJ 4DCKA 3MD0A 2B87A 1AQ5A 1JY3P 1L9JC 1PP9D 1DD4A 1N90A 3H1IJ 5CMZA 4JYBA 3E1IA 1GU4A 1KYOD 1E8EA 351CA 1ZR4A 4N6JA 3TGUE 4JYCA 2E5TA 2JEEA 3H1LE 1BDDA 3L75E 1Q90D 4ASVA 1VQLP 3USSA 2AXTE 1BSHA 2PAJA 3MK7B 2KSEA 4IFFA 2W83C 1RF1C 2KSJA 1SQQD 3FGAD 2ZXXA 3A7OA 5BU8B 1FBMA 3L73J 4PW9B 3ZOXA 2PFXA 2OZ1A 4DOJA 2N1TC 3S4RA 3H1JJ 1L0LG 1FOSE 1AKKA 4RO0A 3A0HV 1OX3A 2PP6A 1CYIA 5GTHE 1PPJG 2LKMA 2FXOA 3CXHH 3NMDA 1M1JC 3KXDA 2QRXA 2KOGA 2N1TB 1SQVD 1YQ3C 1EZVD 3RK2C 1SLQA 1HZUA 2IBZI 3SWFA 5KAIE 1NTKE 3H1HD 3RL0D 1QL2A 1OFCX 1N7SA 4BXLA 2HFED 1L2PA 3C2CA 3FX0A 1FZCB 4JBZA 2C1VA 5TISE 3VTPC 3TGUG 1CRHA 1E79H 1KB9D 3B8EB 1S3JA 1N15A 3H1LG 3L74E 3L75G 2JKVA 4C7NA 4OH8B 3EFFK 4PD4D 2C2CA 3V4WA 2P7JA 3HQ6A 2WQYC 1S5LH 1N7SB 4FB1A 1H89A 2G8YA 5CBNA 4WY4C 4OVNF 3U1CA 1JY3N 4HYTB 3CPWO 4C7RA 2IZ1A 1HJ3A 3HD7D 2ZXEB 4C7NB 2W90A 3JCUH 4JCGA 1KMIZ 2P58A 1NTKK 3GHGA 3HQ9A 2I1KA 2H88C 3O6QA 3C1LA 1SQXE 2JWDA 3A0HH 1NTKG 5KJ7A 1QVGO 1LWUB 2BH5X 1HBWA 2OTJP 3CD6P 2QEXP 1VF5B 1L0LD 1N2DC 1KQFB 3HUSC 2ZXYA 3O0RC 1M57D 1IZL0 3CCUP 1PPJD 1M90Q 3L74G 4WBAA 4W80A 1NKNA 1L4AD 3CCRP 4DT0A 2BPBB 4MN4C 3JC22 5AVRB 4D6TJ 2XKMA 1CORA 2D2CB 2KLVA 1C6RA 3TSIA 4B86A 1NMLA 3RLMA 5K5GB 1NNOA 2N3BA 1I55A 3P32A 3LW5H 1JNMA 2SPZA 3EFGA 3WC8A 1WT6A 1LC2A 1LTIC 3MIWA 4XXLA 1OW8A 3TGUD 3H1LD 1PGJA 2NPSC 3L75D 2XNXA 1SQXK 1YTCA 3CI9A 1K3HA 2OYOA 1ZXGA 1ZV8A 1FZGA 3G6EP 1SQXG 1SFCC 3N4XA 3L4FA 1EC5A 4PJ0V 4AYCA 2KYVA 2Q6QA 3FXEA 4WQ9A 1LTJC 3VOPA 3MUDA 1KFMA 4DZOA 1K9MQ 4WQDA 1N8RQ 2QVAA 4PV1D 4L74A 4YTPC 1WMKA 3A0HE 3CX5W 3CX5E 1YIQA 3WFEC 1HF9A 1YITP 3W67A 1N73C 2LIRA 2K9JA 2WZ7A 3HTKB 1LTJB 1E2RA 4FANA 1GL2B 2CA4B 2KZJA 3TDKA 3NWVA 1L0LJ 3H1IE 4GIFA 2PCBB 1W5CT 4UB8E 5APSA 2R3SA 3A9FA 1NTKD 4IFMA 2A45I 3OAKA 2BH4X 3RMZA 4LGDE 1I8PA 1H9XA 4FA9A 2QM8A 2WITA 1ZR2A 1GZLA 2DW3A 4WVZA 3PXTA 4L3HA 2WT7A 2BEZF 1QEXA 1U75B 2BLFB 1KILE 3L74D 3O1YA 3GG2A 4IL6E 1DVVA 3AE9C 3L73E 5CHXA 1LTTC 3CCJP 3VNWA 3ZBMA 3H1JE 5CCGC 3NTNA 3CXHI 3H1LJ 1C2RA 4U7JA 2J5UA 2M3BA 3RK2D 1OW7A 2QSIA 5B66H 1HH0A 2YMKA 2N18B 2FYUK 2K88A 1LT9A 1CRIA 4AAMA 1M56D 2O01N 2O3JA 2PGDA 2Y0EA 3BRTB 1NTZJ 1H33B 1JM0A 2KLUA 3VP8A 2M5AA 5KTBA 3AE8C 4PJ0H 2I8FA 2HR3A 4UB6H 1RE4A 1AVYA 1SQXD 3H1IG 3B5NB 1YJ9P 1DEBA 3R4YA 1GW4A 1OVRA 1FE6A 4GEDB 3NBSA 3HE4A 1IRVA 2CA3B 2ZFCA 3SWYA 1WEJF 1QGKB 1R5SA 2W8ZA 4WY4D 2E76B 5KKZC 1TU3F 2H89C 2M5AB 3DP5A 3D6ZA 1C6OA 2PRRA 5M1BA 3C8VA 2LXBA 1FI9A 2AEFA 3L73G 1Q7YQ 1GMJA 3RGUA 4LLHA 3RL0C 4NPDA 2PACA 3H1JG 4L3GA 2XZRA 1LP1B
chains in the Genus database with same CATH topology
2ZONG 5CIDB 2Y0CA 2KNCB 5CIBB 3GW6A 1CIEA 5CYTR 5CIFB 2FWLA 1CRCA 4WQ7A 5KLIB 1KX7A 1NIRA 4WQCA 1N50A 2Y0DA 4EDFA 3L70D 2ORLA 4FA4A 4AX3A 1CIHA 1CHIA 5E79V 4EIEA 1L9JC 1PP9D 3CU4A 1C7MA 3ZOWA 1N90A 1FJ0A 1QL3A 1KYOD 1CTZA 1E8EA 1I6DA 351CA 5DF5A 3OA8B 1H33A 4NFGB 2MHMA 4XYDB 1QL4A 2QG4A 1CIGA 1CTYA 4N0KA 1HJ5A 1ZZHA 1QYZA 155CA 1CIFA 5B5EV 2D0SA 2QJPB 5H2FV 3CX5D 3O5CA 1CCHA 3MK7B 1F1FA 1CXAA 3PTZA 5CIGB 3VMAA 2C9XB 2B0ZB 3WFBC 1SQQD 3L71D 1IQCA 1DW2A 1J3SA 1GIWA 3H1ID 1MG2D 4PW9B 3ZOXA 1FHBA 2OZ1A 4FA1A 1U74B 1FI7A 1OAEA 1AKKA 1C75A 3A0HV 1HCMA 1ETPA 2PCCB 1IO3A 1CYIA 1CHJA 2RN0A 4RSZA 2BCCD 1DIIC 2L4DA 2AI5A 3CXHD 1SQVD 1VYDA 3L72D 2JTIB 5B6QA 2YQBA 1EZVD 1HZUA 3PHLA 1W2LA 3VRDA 1DT1A 3BCCD 4K3IA 2JQRA 3H1HD 3L73D 1DIQC 1DW0A 3H1JD 2Q3EA 3C2CA 3PH2B 1LS9A 5DFSA 1CSVA 2C1VA 451CA 1FCDC 3PXWA 1AOQA 1CRHA 1KB9D 1N15A 2V07A 2YIUB 1CYJA 2N9IA 1GDVA 1MG3D 5KKZB 1FOCA 1K3GA 4PD4D 2C2CA 1COTA 3HQ6A 2FYNB 2D0WA 1BL9A 1B7VA 1RAQA 4FB1A 4RJTA 1YEAA 3L4OA 2N9JA 3OA8A 1CCRA 5DJQC 1LMSA 2B11B 2B10B 1I8OA 4L1QA 1HJ3A 3TF5A 1C2NA 3SJLA 2VHDA 1R0QA 2EXVA 3RN0A 4JCGA 2GIWA 1CSXA 1N9CA 3KHUA 1E29A 3WU2V 1AOFA 1S5LV 1A8CA 3HQ9A 1KV9A 1H1OA 1CC5A 1H32B 1WVEC 5GTIV 1YICA 1YCCA 2C1DB 3A0BV 4P4QB 2K9JB 3FWLA 4Y5RA 2BH5X 5CIHB 3WUIA 1RAPA 2DGEA 3OCDA 1L0LD 5CICB 2N18C 1YNRA 2ZXYA 3O0RC 1IZL0 4PWAA 1RZ6A 3PXSA 4KMGA 1PPJD 4EICA 5KAFV 2C1UA 4AALA 2YK3A 2N9YB 2A06D 1H31A 2BPBB 5C0ZA 2AIUA 3ZIYA 5TJHA 1CORA 1C6RA 1NMLA 3RLMA 1NNOA 2N3BA 1I55A 4AANA 3O20A 3ZOYA 3OCDB 3L4MA 3VYMA 3HQ8A 3KZIV 1BCCD 1A2SA 3WC8A 1LC2A 4XXLA 3TGUD 1YFCA 3H1LD 3X39A 4WQ8A 3L75D 2B12B 1AYGA 1H31B 1L0ND 1FI3A 2GC7D 4FA5A 3RN1A 2MTAC 1GJQA 1YTCA 2BCNB 1QN2A 4D6TD 3NBTA 2BGVX 4DY9A 1K3HA 2ZOOA 2CE0A 4WQAA 4H0JA 1M60A 1CSWA 3TYIA 1CO6A 3WFDC 3ZCFA 1KYOW 2QJKB 4A7PA 1HZVA 4PJ0V 4EIDA 1M70A 1P84D 4GYDA 4WQ9A 3CP5A 3M97X 4WQEA 2JWAA 1RZ5A 1BGYD 4WQDA 5CIEB 1GKSA 2ZBOA 3CX5W 1YIQA 1H32A 2AXTV 1H9YA 3HQ7A 3WFEC 2C1DA 1I54A 2RMZA 2LIRA 1EB7A 1E2RA 2KS1A 4FANA 2CA4B 1HH7A 4MU8A 3TDKA 1NTMD 3NWVA 1KIBA 1ZRTD 4O1WA 2PCBB 5C9MA 1W5CT 1CRGA 3A9FA 1NTKD 1C6SA 2BH4X 3RMZA 5DJQB 1I8PA 1H9XA 4O1QA 4FA9A 4U3FD 1CXCA 1YEBA 4WQBA 3ITKA 4H0KA 2LITA 2GC4D 1CNOA 1LFMA 5GTHV 1LC1A 3PXTA 2QJYB 4L3HA 3PRJA 1NMIA 1U75B 3CXHW 2BLFB 2DVHA 2XTSB 3SXTA 3L74D 3O1YA 3GG2A 3CYTI 5EXQA 2GB8B 5KAIV 4YE1A 3ZOOA 3DR0A 3MK7C 1NU1D 1DVVA 4V2KA 2FRCA 1QKSA 2CXBA 1GQ1A 1DVHA 1A56A 1HROA 1OCDA 3VNWA 3WFCC 3ZBMA 4QAOA 1C2RA 2V08A 3SVWA 1SQPD 5TISV 3ORVA 1CHHA 1GU2A 5KLVD 2FYUD 1CTJA 1HJ4A 1MZ4A 1KX2A 2N18B 1L9BC 2CE1A 1CRIA 4AAMA 1I6EA 1HRCA 2O3JA 3JBTB 2Y0EA 2B4ZA 1JDLA 1H33B 4Q5PA 4EIFA 2YCCA 4J20A 2ZZS1 2I8FA 3DMIA 1DW1A 1SQXD 1IRWA 1CRYA 1CYCA 4LJIA 1CRJA 2N3YA 5B66V 3SLEA 1CEDA 4GEDB 3NBSA 1IRVA 2CA3B 4UB8V 1WEJF 4FAVA 1C52A 1SQBD 3SWSA 3PLNA 2C8SA 2OZ1B 1S6VB 1NTZD 1DW3A 1M6ZA 3DP5A 1C6OA 2HV4A 1CSUA 1FI9A 2L91A 4UB6V 5IY51 1I5TA 1BE3D 2IBZD 4AAOA 1KB0A 3CWBD 3H1KD 2PACA 5AURA 4IL6V 4L3GA 1F1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZON G;  5CID B;  2Y0C A;  2KNC B;  5CIB B;  3GW6 A;  1CIE A;  5CYT R;  5CIF B;  2FWL A;  1CRC A;  4WQ7 A;  5KLI B;  1KX7 A;  1NIR A;  4WQC A;  1N50 A;  2Y0D A;  4EDF A;  3L70 D;  2ORL A;  4FA4 A;  4AX3 A;  1CIH A;  1CHI A;  5E79 V;  4EIE A;  1L9J C;  1PP9 D;  3CU4 A;  1C7M A;  3ZOW A;  1N90 A;  1FJ0 A;  1QL3 A;  1KYO D;  1CTZ A;  1E8E A;  1I6D A;  351C A;  5DF5 A;  3OA8 B;  1H33 A;  4NFG B;  2MHM A;  4XYD B;  1QL4 A;  2QG4 A;  1CIG A;  1CTY A;  4N0K A;  1HJ5 A;  1ZZH A;  1QYZ A;  155C A;  1CIF A;  5B5E V;  2D0S A;  2QJP B;  5H2F V;  3CX5 D;  3O5C A;  1CCH A;  3MK7 B;  1F1F A;  1CXA A;  3PTZ A;  5CIG B;  3VMA A;  2C9X B;  2B0Z B;  3WFB C;  1SQQ D;  3L71 D;  1IQC A;  1DW2 A;  1J3S A;  1GIW A;  3H1I D;  1MG2 D;  4PW9 B;  3ZOX A;  1FHB A;  2OZ1 A;  4FA1 A;  1U74 B;  1FI7 A;  1OAE A;  1AKK A;  1C75 A;  3A0H V;  1HCM A;  1ETP A;  2PCC B;  1IO3 A;  1CYI A;  1CHJ A;  2RN0 A;  4RSZ A;  2BCC D;  1DII C;  2L4D A;  2AI5 A;  3CXH D;  1SQV D;  1VYD A;  3L72 D;  2JTI B;  5B6Q A;  2YQB A;  1EZV D;  1HZU A;  3PHL A;  1W2L A;  3VRD A;  1DT1 A;  3BCC D;  4K3I A;  2JQR A;  3H1H D;  3L73 D;  1DIQ C;  1DW0 A;  3H1J D;  2Q3E A;  3C2C A;  3PH2 B;  1LS9 A;  5DFS A;  1CSV A;  2C1V A;  451C A;  1FCD C;  3PXW A;  1AOQ A;  1CRH A;  1KB9 D;  1N15 A;  2V07 A;  2YIU B;  1CYJ A;  2N9I A;  1GDV A;  1MG3 D;  5KKZ B;  1FOC A;  1K3G A;  4PD4 D;  2C2C A;  1COT A;  3HQ6 A;  2FYN B;  2D0W A;  1BL9 A;  1B7V A;  1RAQ A;  4FB1 A;  4RJT A;  1YEA A;  3L4O A;  2N9J A;  3OA8 A;  1CCR A;  5DJQ C;  1LMS A;  2B11 B;  2B10 B;  1I8O A;  4L1Q A;  1HJ3 A;  3TF5 A;  1C2N A;  3SJL A;  2VHD A;  1R0Q A;  2EXV A;  3RN0 A;  4JCG A;  2GIW A;  1CSX A;  1N9C A;  3KHU A;  1E29 A;  3WU2 V;  1AOF A;  1S5L V;  1A8C A;  3HQ9 A;  1KV9 A;  1H1O A;  1CC5 A;  1H32 B;  1WVE C;  5GTI V;  1YIC A;  1YCC A;  2C1D B;  3A0B V;  4P4Q B;  2K9J B;  3FWL A;  4Y5R A;  2BH5 X;  5CIH B;  3WUI A;  1RAP A;  2DGE A;  3OCD A;  1L0L D;  5CIC B;  2N18 C;  1YNR A;  2ZXY A;  3O0R C;  1IZL 0;  4PWA A;  1RZ6 A;  3PXS A;  4KMG A;  1PPJ D;  4EIC A;  5KAF V;  2C1U A;  4AAL A;  2YK3 A;  2N9Y B;  2A06 D;  1H31 A;  2BPB B;  5C0Z A;  2AIU A;  3ZIY A;  5TJH A;  1COR A;  1C6R A;  1NML A;  3RLM A;  1NNO A;  2N3B A;  1I55 A;  4AAN A;  3O20 A;  3ZOY A;  3OCD B;  3L4M A;  3VYM A;  3HQ8 A;  3KZI V;  1BCC D;  1A2S A;  3WC8 A;  1LC2 A;  4XXL A;  3TGU D;  1YFC A;  3H1L D;  3X39 A;  4WQ8 A;  3L75 D;  2B12 B;  1AYG A;  1H31 B;  1L0N D;  1FI3 A;  2GC7 D;  4FA5 A;  3RN1 A;  2MTA C;  1GJQ A;  1YTC A;  2BCN B;  1QN2 A;  4D6T D;  3NBT A;  2BGV X;  4DY9 A;  1K3H A;  2ZOO A;  2CE0 A;  4WQA A;  4H0J A;  1M60 A;  1CSW A;  3TYI A;  1CO6 A;  3WFD C;  3ZCF A;  1KYO W;  2QJK B;  4A7P A;  1HZV A;  4PJ0 V;  4EID A;  1M70 A;  1P84 D;  4GYD A;  4WQ9 A;  3CP5 A;  3M97 X;  4WQE A;  2JWA A;  1RZ5 A;  1BGY D;  4WQD A;  5CIE B;  1GKS A;  2ZBO A;  3CX5 W;  1YIQ A;  1H32 A;  2AXT V;  1H9Y A;  3HQ7 A;  3WFE C;  2C1D A;  1I54 A;  2RMZ A;  2LIR A;  1EB7 A;  1E2R A;  2KS1 A;  4FAN A;  2CA4 B;  1HH7 A;  4MU8 A;  3TDK A;  1NTM D;  3NWV A;  1KIB A;  1ZRT D;  4O1W A;  2PCB B;  5C9M A;  1W5C T;  1CRG A;  3A9F A;  1NTK D;  1C6S A;  2BH4 X;  3RMZ A;  5DJQ B;  1I8P A;  1H9X A;  4O1Q A;  4FA9 A;  4U3F D;  1CXC A;  1YEB A;  4WQB A;  3ITK A;  4H0K A;  2LIT A;  2GC4 D;  1CNO A;  1LFM A;  5GTH V;  1LC1 A;  3PXT A;  2QJY B;  4L3H A;  3PRJ A;  1NMI A;  1U75 B;  3CXH W;  2BLF B;  2DVH A;  2XTS B;  3SXT A;  3L74 D;  3O1Y A;  3GG2 A;  3CYT I;  5EXQ A;  2GB8 B;  5KAI V;  4YE1 A;  3ZOO A;  3DR0 A;  3MK7 C;  1NU1 D;  1DVV A;  4V2K A;  2FRC A;  1QKS A;  2CXB A;  1GQ1 A;  1DVH A;  1A56 A;  1HRO A;  1OCD A;  3VNW A;  3WFC C;  3ZBM A;  4QAO A;  1C2R A;  2V08 A;  3SVW A;  1SQP D;  5TIS V;  3ORV A;  1CHH A;  1GU2 A;  5KLV D;  2FYU D;  1CTJ A;  1HJ4 A;  1MZ4 A;  1KX2 A;  2N18 B;  1L9B C;  2CE1 A;  1CRI A;  4AAM A;  1I6E A;  1HRC A;  2O3J A;  3JBT B;  2Y0E A;  2B4Z A;  1JDL A;  1H33 B;  4Q5P A;  4EIF A;  2YCC A;  4J20 A;  2ZZS 1;  2I8F A;  3DMI A;  1DW1 A;  1SQX D;  1IRW A;  1CRY A;  1CYC A;  4LJI A;  1CRJ A;  2N3Y A;  5B66 V;  3SLE A;  1CED A;  4GED B;  3NBS A;  1IRV A;  2CA3 B;  4UB8 V;  1WEJ F;  4FAV A;  1C52 A;  1SQB D;  3SWS A;  3PLN A;  2C8S A;  2OZ1 B;  1S6V B;  1NTZ D;  1DW3 A;  1M6Z A;  3DP5 A;  1C6O A;  2HV4 A;  1CSU A;  1FI9 A;  2L91 A;  4UB6 V;  5IY5 1;  1I5T A;  1BE3 D;  2IBZ D;  4AAO A;  1KB0 A;  3CWB D;  3H1K D;  2PAC A;  5AUR A;  4IL6 V;  4L3G A;  1F1C A; 
#chains in the Genus database with same CATH topology
 2RH0 A;  4XA4 A;  2ZON G;  1FZF A;  1PIX A;  4OGQ C;  2I1J A;  2YKO A;  1T2K D;  4N78 E;  1A02 J;  1M8O B;  1NGM B;  4WQC A;  2IX7 C;  2Y0D A;  2Q1K A;  2O01 H;  1KZU B;  1CW5 A;  3BAS A;  4FA4 A;  3V2Q A;  5E79 V;  3L71 J;  1PV3 A;  1N7L A;  1C7M A;  3ZOW A;  2K37 A;  1FJ0 A;  3KDP B;  2GM4 A;  1QVF O;  5DF5 A;  2MHM A;  5CCH A;  3HD7 C;  1FJP A;  1JCC A;  1L0N E;  1CIG A;  1HJ5 A;  1Z56 A;  1QYZ A;  4GT1 A;  2D0S A;  4D6T E;  1J1E C;  4N3Y B;  3K5B A;  3M9B A;  2QJP B;  3A5T A;  5H2F V;  3CX5 D;  3Q5S A;  2BCC J;  3HE5 B;  1NVO A;  1CCH A;  1F1F A;  1RE3 A;  3L72 J;  3VMA A;  2NPS D;  2C9X B;  3WFB C;  3HD7 B;  1DW2 A;  1J3S A;  1GIW A;  2GUS A;  1SQQ K;  3H1I D;  2CPS A;  2RKL A;  2OYI C;  3G71 P;  1FI7 A;  1GW3 A;  3WU2 E;  1S5L X;  2UWJ E;  3D70 A;  3CCE P;  1FZB A;  1NO4 A;  2NZ2 A;  5AVS B;  1R5L A;  2PCC B;  3FWN A;  2R3C A;  1VYD A;  1KIL D;  2XDJ A;  3AE7 C;  3N7N A;  1NTM E;  1ZRT E;  1AV1 A;  1L4A C;  1W2L A;  3VRD A;  3GF7 A;  4K3I A;  3CCS P;  3L73 D;  1RF0 A;  1RQU A;  2KNC A;  2YKQ A;  1OZH A;  3H1J D;  3VMX A;  3E7K A;  1T6A A;  1LS9 A;  2YXQ B;  2Q3I A;  1FCD C;  3PXW A;  1AOQ A;  2YIU B;  1CYJ A;  2N9I A;  1L0N G;  1URQ A;  1K3G A;  4H13 C;  2YO3 A;  1IFI A;  3HRN A;  1COT A;  4D6T G;  2D0W A;  1LTA C;  1BL9 A;  1B7V A;  4RJT A;  1SQP E;  2FXP A;  1CCR A;  5GTI H;  1KYO I;  4ZKP A;  1JUN A;  3A0B H;  5KLV E;  3UIA A;  2B10 B;  1I8O A;  3TF5 A;  1LNQ A;  1C2N A;  5H2F H;  4QMA A;  2KUB A;  5CCG D;  2VHD A;  2EXV A;  3GF3 A;  1N9C A;  3KHU A;  1E29 A;  4PV1 C;  1DH3 A;  1H8A A;  1S5L V;  2M0B A;  5KAF H;  1H1O A;  4Z1M H;  3QWO C;  5C39 A;  1NTM G;  2ZVN B;  1H32 B;  2A45 H;  1VQ5 P;  1IK7 A;  1X0T A;  4PV1 B;  4Y5R A;  1JY2 O;  4BRY B;  2OYH C;  1ZP0 C;  1RAP A;  2DGE A;  1IFD A;  3KZI H;  3BCC E;  1Y47 A;  3LW5 J;  2N1T A;  1L0L K;  1NTZ E;  3S9O A;  3E1R A;  4AAL A;  1EZV I;  4ZNC A;  3JSV C;  4HJG H;  4JF7 A;  1H31 A;  1J1D C;  2JR8 A;  2OYH B;  3ZIY A;  1FZC A;  2E75 D;  5TJH A;  1RF1 B;  1QL1 A;  2YO2 A;  1OMI A;  3VYM A;  3L4M A;  1SQP G;  3GMA A;  5E79 E;  2IYO A;  3AEF C;  3RBZ A;  1NAY A;  5KLV G;  1JY2 N;  1KB9 I;  1DIP A;  1VDF A;  4YXD C;  1JY3 O;  2E74 C;  1BGY J;  1AYG A;  1H31 B;  1L0N D;  4PD4 I;  2HPC B;  4K35 A;  1M1J B;  2BCN B;  1HTL C;  4D6T D;  1LTS C;  4OGQ D;  1ZLL A;  2BGV X;  1IFN A;  3RK2 B;  1VQK P;  1K8A Q;  2CE0 A;  1M60 A;  3TYI A;  3H6P A;  3WFD C;  1VL2 A;  2VRS A;  2ZT9 C;  2WVR A;  1NTZ K;  3MZW B;  1M70 A;  4GYD A;  3M97 X;  4WQE A;  1RZ5 A;  2WSF H;  1GKS A;  1NTZ G;  3EWK A;  2RMZ A;  1LWU A;  3L71 E;  2KS1 A;  1HH7 A;  1NTM D;  1ZRT D;  4O1W A;  3G9R A;  3B4S A;  1C6S A;  3WUU A;  4WY4 B;  1IZN B;  2WPV B;  2WSE H;  1USE A;  3W68 A;  5APU A;  1CXC A;  1YEB A;  4WQB A;  2W6J H;  3V6I A;  2LIT A;  3F89 A;  4W7Z A;  5AVT B;  3AEB C;  2HYN A;  2BCC E;  3NXS A;  2WSS H;  2ZYD A;  3CXH W;  4EI2 A;  3VMY A;  1T2K C;  3CXH E;  3L72 E;  2KS1 B;  3CYT I;  2WSC H;  2GB8 B;  4YE1 A;  3ZOO A;  3DR0 A;  4IOI H;  4KJM A;  3G4S P;  3A3Y B;  1M7L A;  2QIW A;  1A56 A;  2IZ0 A;  4H44 C;  4QAO A;  4DJG A;  2V08 A;  1SQP D;  2B89 A;  1L0N J;  1OVV A;  1S72 P;  5KLV D;  1MZ4 A;  3HUS B;  3F5H A;  2CE1 A;  5KJ7 C;  5AW6 B;  1I6E A;  1KQS O;  1SQB J;  2AXC A;  1HRC A;  1KOR A;  4Y28 J;  4TLF A;  2B4Z A;  4Q5P A;  3G3Z A;  1MFT A;  2ZAE B;  1S5L E;  2ZZS 1;  3L71 G;  3DMI A;  4H13 D;  1DW1 A;  5APW A;  1CYC A;  3CWB J;  5B66 V;  3P8C E;  3SLE A;  3V2N A;  1SFC A;  2XND H;  3L37 A;  4AQR D;  1NKZ B;  4FAV A;  1VQN P;  3JCU E;  1N86 A;  3HTK A;  1LTJ A;  4GOF A;  1NTM J;  1GL2 A;  1YBK A;  1NTZ D;  2QA4 P;  2NPS B;  1DW3 A;  1YIJ P;  2BCC G;  1YI2 P;  3L72 G;  2FYN C;  4UB6 V;  3L70 J;  3AE4 C;  3V2R A;  1KIL C;  2M3E A;  2O01 J;  1KB0 A;  1SFC B;  5AVV B;  2OAR A;  4JQ0 D;  5AUR A;  3H32 B;  1R8E A;  2BAS A;  5CIB B;  2J59 M;  3GW6 A;  1CIE A;  5CYT R;  2E42 A;  2FWL A;  1CRC A;  1NIR A;  2A06 E;  3MUD C;  3OJA B;  2R32 A;  2YKP A;  3CL3 D;  1SQP J;  1N73 B;  2Q7C A;  4AX3 A;  5KLV J;  1CHI A;  3RK3 C;  1KFN A;  1AA0 A;  3MHV A;  1KYO H;  1BCC E;  1Q82 Q;  1QL3 A;  1VQ6 P;  1I6D A;  1BDC A;  3OA8 B;  1H33 A;  2P1J A;  4ASW A;  3I5C A;  4XYD B;  1FAV A;  4N0K A;  2C0W A;  3WUV A;  3TYY A;  3IN6 A;  1CIF A;  5B5E V;  3SWK A;  1HGV A;  1PGP A;  3B5N A;  2ZYG A;  3CC2 P;  1VQO P;  1CXA A;  1IC2 A;  1FZA A;  2E74 D;  3L71 D;  1IQC A;  3BCC J;  1NAF A;  4HH2 A;  1U74 B;  5BU5 A;  3RK3 E;  1KQG B;  4W7Y A;  1BGY E;  1OAE A;  1DEE G;  1PGO A;  1MUU A;  1C75 A;  2V7Q H;  2XV5 A;  1FJK A;  2HOD B;  2ZT9 D;  1ETP A;  1P84 I;  1CHJ A;  2RN0 A;  2BCC D;  2FY8 A;  2A06 G;  1DII C;  2L4D A;  2AI5 A;  3CXH D;  1N7S D;  1T3U A;  3M9H A;  2FFD C;  3L72 D;  5B6Q A;  3AEE C;  3AEG C;  1LP1 A;  5APV A;  2YXR B;  2H8P D;  1DT1 A;  1LGH B;  5AW0 B;  2JQR A;  2IDB A;  2WMM A;  2MJZ A;  2E75 C;  5DFS A;  1BCC G;  1RE4 C;  2FFD B;  1MV8 A;  1KB9 H;  3M0D C;  3V2P A;  5AW4 B;  3CCL P;  1RHZ B;  1GDV A;  5KKZ B;  1FOC A;  1IFP A;  2E75 B;  4PD4 H;  1EXJ A;  1U7J A;  1KC8 Q;  1NU1 E;  3KYQ A;  1VQ9 P;  5CBO A;  5AVX B;  1RAQ A;  3CLQ A;  3L4O A;  1Y8A A;  2Z5H A;  3RL0 B;  1IFM A;  5DJQ C;  2B11 B;  3PH0 A;  5B5E H;  3P8C D;  5B66 E;  1IFJ A;  3SJL A;  2Y9Z A;  1BGY G;  1RH5 B;  4H44 D;  3HE5 A;  4OGQ B;  4R4L A;  2QJY C;  1W2B O;  3RN0 A;  1YTZ I;  3CMA P;  2OTK E;  3HD7 A;  1AOF A;  5EFW B;  2JJL A;  1A8C A;  4PJ0 E;  5KJ7 D;  2D2C D;  1UII A;  4ZMD A;  1Q2N A;  5GTI V;  3SFD C;  1YIC A;  4UB6 E;  1YTZ T;  2KXP B;  4O9B A;  2C1D B;  3A0B V;  4I7Z C;  3SSU A;  1H0T B;  5CIH B;  3WUI A;  1OW6 A;  1HUC A;  1SQB E;  1JCD A;  1YNR A;  1X79 B;  3Q3D A;  4PWA A;  1RZ6 A;  1LJ2 A;  4KMG A;  1WRG A;  4EIC A;  5KAF V;  1IO4 A;  1FS0 E;  2C1U A;  2YK3 A;  1J1E B;  2N9Y B;  2A06 D;  5CCH C;  1BE3 E;  1NU1 G;  2IBZ E;  5C0Z A;  2AIU A;  3CWB E;  3MTU E;  3V5B A;  2WTY A;  2P67 A;  2KK7 A;  1HWT C;  1NHL A;  2WPQ A;  3O20 A;  1HGZ A;  1L4A A;  3HQ8 A;  3KZI V;  1OVU A;  2R44 A;  2OYI B;  1KV4 A;  1RE3 C;  2P10 A;  1BCC D;  3IFM A;  1YFC A;  4WQ8 A;  2B12 B;  1JEK A;  3L70 E;  3TK1 A;  1FI3 A;  2GC7 D;  4FA5 A;  4I1L A;  3RN1 A;  3ZDM A;  2MTA C;  1GJQ A;  2WSF J;  1L0N K;  2AXT H;  4GOD A;  1D7M A;  2ZOO A;  2Z5I A;  1L4A B;  1NH4 A;  2KB7 P;  1SQB K;  4EID A;  3AE1 C;  1JMM A;  1CZQ A;  1FC2 C;  2JWA A;  4U3F J;  3RK3 D;  1JTH B;  1BGY D;  1SQB G;  2Q5U A;  2WSE J;  2ZYA A;  1H88 A;  2ZBO A;  4H0L D;  5GTH H;  1H32 A;  5AW8 B;  1USD A;  4H13 B;  1I54 A;  5AW9 B;  1EB7 A;  2MKV A;  4BRY A;  2I8D A;  2K1A A;  1URQ C;  4MU8 A;  5KAI H;  2HG5 D;  2LXC B;  2WSC J;  1GTW A;  1T3J A;  2IBZ G;  1NTM K;  1CRG A;  3CWB G;  4I6M C;  1OXZ A;  2KP8 A;  3R2P A;  3M06 A;  3QH9 A;  2P2U A;  2GC4 D;  1CSB A;  1CNO A;  4TT3 H;  2WWW A;  3WUT A;  2OYH A;  2IYP A;  1RF1 A;  1EDJ A;  3L70 G;  3U59 A;  3PJS K;  4IL6 X;  3MK7 C;  3C9I A;  1NU1 D;  1GQ1 A;  1DVH A;  1BCC J;  3B5N D;  3T97 B;  1LT1 A;  1HRO A;  3WFC C;  4HB1 A;  4N78 D;  2JDI H;  1KQL A;  3ORV A;  1SQP K;  3AED C;  1GU2 A;  3AE3 C;  2HPC A;  2B87 B;  2BEQ D;  1M1J A;  1HJ4 A;  1GD2 E;  2W27 A;  2E76 D;  5KLV K;  1U7M A;  3EQ2 A;  4C46 A;  5AVZ B;  1GK6 A;  2CPB A;  3JBT B;  3CCV P;  4JPZ B;  1JB0 J;  5DJU B;  1J1D B;  3B71 A;  4EIF A;  1S4X A;  3Q5P A;  4KT0 J;  1JO5 A;  1IRW A;  1PFI A;  4L76 A;  5GTI E;  1X22 A;  2E43 A;  3A0B E;  1FZC C;  3CCM P;  3H1K J;  3M0A A;  5AVY B;  5H2F E;  2M8R A;  4UB8 V;  1Y9B A;  3BRV B;  3AE5 C;  1SS1 A;  1SQB D;  3SWS A;  3AE2 C;  3PLN A;  1W5C E;  2OZ1 B;  1P84 H;  2E74 B;  2AEM A;  5APT A;  1S2E A;  2HV4 A;  4GOE A;  2AEJ A;  2L91 A;  5KAF E;  1T8Z A;  1GDT A;  5IY5 1;  4WY4 A;  1N7S C;  3AEA C;  3FXD A;  1BE3 D;  2HLO A;  3IAO A;  1EDL A;  3BCC G;  2IBZ D;  3CWB D;  1MFZ A;  4IL6 V;  1F1C A;  2ZT9 B;  1PP9 J;  1VPC A;  1K04 A;  1KN7 A;  2C9N Y;  3KZI E;  3Q1M A;  1LTB C;  4EYY Q;  1NU1 J;  5APY A;  2K9Y A;  5CIF B;  1U57 A;  1NYH A;  4WQ7 A;  1RY3 A;  3I55 P;  5L8R J;  1N50 A;  2QE7 H;  3L70 D;  2Y9Y A;  3AEC C;  1ZME C;  1FZE A;  1ZN5 A;  1HJ0 A;  4EIE A;  1SQQ J;  3HUS A;  5CCH D;  3CU4 A;  1LWU C;  3MP7 B;  2ZVO B;  1CTZ A;  1VF5 C;  4NFG B;  1AQT A;  1XTC C;  2C9L Y;  2WPR A;  3CC4 P;  2O1K A;  1QL4 A;  3GHG C;  5AVU B;  2QG4 A;  1CTY A;  1ZZH A;  155C A;  3CX5 H;  5BVZ A;  5DJT B;  2V7Q J;  3O5C A;  5CJ4 A;  5AVW B;  3P7K A;  3PTZ A;  1SQV J;  5CIG B;  1PZQ A;  2B0Z B;  2D2C C;  4UB8 H;  2POH A;  1P84 E;  3GHG B;  4H44 B;  1MG2 D;  1JMB A;  3H1H J;  2H43 A;  1GU5 A;  4XFJ A;  1FHB A;  2ITA A;  4FA1 A;  2A45 G;  3D0W A;  3O6Q B;  2NPS A;  2KZI A;  1EDK A;  1DX7 A;  1JOC A;  2YMY A;  3PP5 A;  1BE3 J;  1HCM A;  1IO3 A;  2JP3 A;  1FDM A;  2R5B A;  4RSZ A;  2LR2 A;  3LIE A;  1AJY A;  2JTI B;  4IL6 H;  2YQB A;  1KTM A;  3D71 A;  1YQ4 C;  3H32 A;  3PHL A;  1HJB A;  2QM7 A;  3V4Q A;  1BSN A;  1QX8 A;  3BCC D;  2N9B A;  5APX A;  1OIP A;  1DIQ C;  5AVQ B;  1DW0 A;  4Y99 C;  1KIL A;  4U3F E;  1VQP P;  2FKW B;  2Q3E A;  4I2L C;  3PH2 B;  1CSV A;  1URQ D;  451C A;  1NWQ A;  3CME P;  1IK9 A;  2J58 A;  1N73 A;  2V07 A;  5CJ0 A;  3Q2Y A;  1MG3 D;  2GA1 A;  4WB4 A;  4YPC A;  4Y99 B;  1G1J A;  2FYN B;  3WMM 0;  1GL2 C;  5AW1 B;  1KIL B;  2G3A A;  1YEA A;  2N9J A;  3OA8 A;  4L73 A;  1FOS F;  4GDO A;  1MZ9 A;  1LMS A;  1VQ4 P;  4EOT A;  2FYU E;  2KIK A;  4L1Q A;  4K3A A;  4WWI A;  1R0Q A;  2GIW A;  4LC1 A;  2Z4E A;  1CSX A;  1ZOY C;  4H0L C;  3WU2 V;  5CCG A;  1KV9 A;  1CC5 A;  1WVE C;  1YCC A;  3RK3 B;  4P4Q B;  2N1T D;  2K9J B;  3FWL A;  2HOD A;  4H0L B;  3IF4 A;  2OQQ A;  4U3F G;  1K73 Q;  1YHQ P;  3OCD A;  5CIC B;  3AE6 C;  2N18 C;  1ZW0 A;  4NPF X;  1A02 F;  3PXS A;  3TGU J;  1S9K E;  3L75 J;  4YXW H;  2WT7 B;  3RL0 g;  2FFD A;  1NJI Q;  3H1K E;  3B5N C;  1G1I A;  4AAN A;  3ZOY A;  3NFQ A;  3OCD B;  1J2J B;  3O8Z A;  1RQV A;  1NOH A;  3KPE A;  1LT9 C;  1A2S A;  2FYU G;  2NRG A;  3S1K A;  2W6B A;  2CK3 H;  3SFE C;  3X39 A;  2E76 C;  2QJK C;  3M0D A;  1VQM P;  1MKM A;  3A2A A;  2YNY A;  3LID A;  1M1K Q;  1Q86 Q;  1QN2 A;  3NBT A;  1LT9 B;  1EDI A;  4DY9 A;  2W6A A;  4WQA A;  4H0J A;  1FDI A;  1PP9 E;  1CSW A;  3VP9 A;  1CO6 A;  3ZCF A;  4IFD K;  1KYO W;  2QJK B;  4A7P A;  1HZV A;  1KYO E;  1K05 A;  3CCQ P;  1P84 D;  2IPP A;  1NTK J;  4RES B;  4XE5 B;  3CP5 A;  3WU2 H;  2FXM A;  3BVH A;  3II6 A;  5CIE B;  3OA7 A;  1HVV A;  3I56 P;  2Q9I A;  2AXT V;  2O1J A;  1H9Y A;  3HQ7 A;  1VQ8 P;  2C1D A;  1E5W A;  1VF5 D;  3HE4 B;  1EQ7 A;  3L74 J;  3KQG A;  1H0T A;  1SQQ E;  3GLM A;  5AW5 B;  1KIB A;  5C9M A;  1X8Y A;  3L36 A;  1IJD B;  1PGQ A;  2R5D A;  3CX5 I;  3H1K G;  1SVF A;  5DJQ B;  4O1Q A;  3M91 A;  4U3F D;  3ITK A;  4H0K A;  1G2C A;  3VMZ A;  3VYI A;  5GTH V;  1LFM A;  1LC1 A;  1YJW P;  1LTG C;  2QJY B;  3BAT A;  3PRJ A;  1NMI A;  2DVH A;  2XTS B;  4GKG A;  3SXT A;  1SQV E;  1W2E A;  2QJP C;  5EXQ A;  1EZV E;  5KAI V;  1DD3 A;  3H1H E;  2OYI A;  4V2K A;  2FRC A;  1QKS A;  2CXB A;  1NU1 K;  2L5G B;  1SP4 A;  1OCD A;  2FBW C;  1PP9 G;  4I7Z B;  2OGU A;  3SVW A;  5TIS V;  1SQX J;  1G2C B;  1CHH A;  2WPS A;  3CC7 P;  1GK4 A;  1AFO A;  2FYU D;  1KB9 E;  1CTJ A;  3H25 A;  1KX2 A;  1L9B C;  4NPE A;  2B88 A;  1OWA A;  2XU6 A;  4PD4 E;  3Q5R A;  1JDL A;  3U1A A;  4CPG A;  4OWF A;  2C0X A;  2YCC A;  2IFN A;  2K3R A;  2V4H A;  4J20 A;  1SQQ G;  1SFC D;  2IFM A;  3TNU A;  2H7H A;  1JTH A;  5AW3 B;  1CRY A;  4LJI A;  1XTG B;  1Q81 Q;  1CRJ A;  2N3Y A;  2E5Y A;  1GL2 D;  2JO1 A;  5B5E E;  1CED A;  1S1C X;  1SQV K;  5APQ A;  1C52 A;  2FYZ A;  2C8S A;  1CI6 A;  2YIU C;  1S6V B;  5AW7 B;  1YJN P;  1KD1 Q;  1M6Z A;  2B9B A;  3IR9 A;  1PL5 A;  1JY2 P;  4KHX A;  1SQV G;  1S9K D;  1RF0 C;  1CSU A;  1EZV G;  3TNU B;  3RBX A;  1I5T A;  2GUV A;  3H1H G;  3D6Y A;  1FU1 A;  4AAO A;  4RKU J;  5KLI C;  4BWN A;  3L35 A;  3OW2 O;  3H1K D;  3VN0 A;  2KI7 B;  4EIJ A;  5E79 H;  1L0L E;  4ZKU A;  3P8M C;  1CI6 B;  4HKZ H;  1BE3 G;  5CID B;  1AVO A;  2Y0C A;  2KNC B;  4L75 A;  5AW2 B;  1PPJ E;  2OTL P;  1VQ7 P;  5KLI B;  1KX7 A;  2ZJS E;  1EXI A;  3T97 A;  1YYC A;  3M9Q A;  4EDF A;  4R4M A;  1FDO A;  1QLE D;  4AUW A;  2ORL A;  1X9V A;  5TIS H;  4M3L A;  3MGN A;  1CIH A;  1URQ B;  3ABV C;  1UIX A;  2FYU J;  4DCK A;  3MD0 A;  2B87 A;  1AQ5 A;  1JY3 P;  1L9J C;  1PP9 D;  1DD4 A;  1N90 A;  3H1I J;  5CMZ A;  4JYB A;  3E1I A;  1GU4 A;  1KYO D;  1E8E A;  351C A;  1ZR4 A;  4N6J A;  3TGU E;  4JYC A;  2E5T A;  2JEE A;  3H1L E;  1BDD A;  3L75 E;  1Q90 D;  4ASV A;  1VQL P;  3USS A;  2AXT E;  1BSH A;  2PAJ A;  3MK7 B;  2KSE A;  4IFF A;  2W83 C;  1RF1 C;  2KSJ A;  1SQQ D;  3FGA D;  2ZXX A;  3A7O A;  5BU8 B;  1FBM A;  3L73 J;  4PW9 B;  3ZOX A;  2PFX A;  2OZ1 A;  4DOJ A;  2N1T C;  3S4R A;  3H1J J;  1L0L G;  1FOS E;  1AKK A;  4RO0 A;  3A0H V;  1OX3 A;  2PP6 A;  1CYI A;  5GTH E;  1PPJ G;  2LKM A;  2FXO A;  3CXH H;  3NMD A;  1M1J C;  3KXD A;  2QRX A;  2KOG A;  2N1T B;  1SQV D;  1YQ3 C;  1EZV D;  3RK2 C;  1SLQ A;  1HZU A;  2IBZ I;  3SWF A;  5KAI E;  1NTK E;  3H1H D;  3RL0 D;  1QL2 A;  1OFC X;  1N7S A;  4BXL A;  2HFE D;  1L2P A;  3C2C A;  3FX0 A;  1FZC B;  4JBZ A;  2C1V A;  5TIS E;  3VTP C;  3TGU G;  1CRH A;  1E79 H;  1KB9 D;  3B8E B;  1S3J A;  1N15 A;  3H1L G;  3L74 E;  3L75 G;  2JKV A;  4C7N A;  4OH8 B;  3EFF K;  4PD4 D;  2C2C A;  3V4W A;  2P7J A;  3HQ6 A;  2WQY C;  1S5L H;  1N7S B;  4FB1 A;  1H89 A;  2G8Y A;  5CBN A;  4WY4 C;  4OVN F;  3U1C A;  1JY3 N;  4HYT B;  3CPW O;  4C7R A;  2IZ1 A;  1HJ3 A;  3HD7 D;  2ZXE B;  4C7N B;  2W90 A;  3JCU H;  4JCG A;  1KMI Z;  2P58 A;  1NTK K;  3GHG A;  3HQ9 A;  2I1K A;  2H88 C;  3O6Q A;  3C1L A;  1SQX E;  2JWD A;  3A0H H;  1NTK G;  5KJ7 A;  1QVG O;  1LWU B;  2BH5 X;  1HBW A;  2OTJ P;  3CD6 P;  2QEX P;  1VF5 B;  1L0L D;  1N2D C;  1KQF B;  3HUS C;  2ZXY A;  3O0R C;  1M57 D;  1IZL 0;  3CCU P;  1PPJ D;  1M90 Q;  3L74 G;  4WBA A;  4W80 A;  1NKN A;  1L4A D;  3CCR P;  4DT0 A;  2BPB B;  4MN4 C;  3JC2 2;  5AVR B;  4D6T J;  2XKM A;  1COR A;  2D2C B;  2KLV A;  1C6R A;  3TSI A;  4B86 A;  1NML A;  3RLM A;  5K5G B;  1NNO A;  2N3B A;  1I55 A;  3P32 A;  3LW5 H;  1JNM A;  2SPZ A;  3EFG A;  3WC8 A;  1WT6 A;  1LC2 A;  1LTI C;  3MIW A;  4XXL A;  1OW8 A;  3TGU D;  3H1L D;  1PGJ A;  2NPS C;  3L75 D;  2XNX A;  1SQX K;  1YTC A;  3CI9 A;  1K3H A;  2OYO A;  1ZXG A;  1ZV8 A;  1FZG A;  3G6E P;  1SQX G;  1SFC C;  3N4X A;  3L4F A;  1EC5 A;  4PJ0 V;  4AYC A;  2KYV A;  2Q6Q A;  3FXE A;  4WQ9 A;  1LTJ C;  3VOP A;  3MUD A;  1KFM A;  4DZO A;  1K9M Q;  4WQD A;  1N8R Q;  2QVA A;  4PV1 D;  4L74 A;  4YTP C;  1WMK A;  3A0H E;  3CX5 W;  3CX5 E;  1YIQ A;  3WFE C;  1HF9 A;  1YIT P;  3W67 A;  1N73 C;  2LIR A;  2K9J A;  2WZ7 A;  3HTK B;  1LTJ B;  1E2R A;  4FAN A;  1GL2 B;  2CA4 B;  2KZJ A;  3TDK A;  3NWV A;  1L0L J;  3H1I E;  4GIF A;  2PCB B;  1W5C T;  4UB8 E;  5APS A;  2R3S A;  3A9F A;  1NTK D;  4IFM A;  2A45 I;  3OAK A;  2BH4 X;  3RMZ A;  4LGD E;  1I8P A;  1H9X A;  4FA9 A;  2QM8 A;  2WIT A;  1ZR2 A;  1GZL A;  2DW3 A;  4WVZ A;  3PXT A;  4L3H A;  2WT7 A;  2BEZ F;  1QEX A;  1U75 B;  2BLF B;  1KIL E;  3L74 D;  3O1Y A;  3GG2 A;  4IL6 E;  1DVV A;  3AE9 C;  3L73 E;  5CHX A;  1LTT C;  3CCJ P;  3VNW A;  3ZBM A;  3H1J E;  5CCG C;  3NTN A;  3CXH I;  3H1L J;  1C2R A;  4U7J A;  2J5U A;  2M3B A;  3RK2 D;  1OW7 A;  2QSI A;  5B66 H;  1HH0 A;  2YMK A;  2N18 B;  2FYU K;  2K88 A;  1LT9 A;  1CRI A;  4AAM A;  1M56 D;  2O01 N;  2O3J A;  2PGD A;  2Y0E A;  3BRT B;  1NTZ J;  1H33 B;  1JM0 A;  2KLU A;  3VP8 A;  2M5A A;  5KTB A;  3AE8 C;  4PJ0 H;  2I8F A;  2HR3 A;  4UB6 H;  1RE4 A;  1AVY A;  1SQX D;  3H1I G;  3B5N B;  1YJ9 P;  1DEB A;  3R4Y A;  1GW4 A;  1OVR A;  1FE6 A;  4GED B;  3NBS A;  3HE4 A;  1IRV A;  2CA3 B;  2ZFC A;  3SWY A;  1WEJ F;  1QGK B;  1R5S A;  2W8Z A;  4WY4 D;  2E76 B;  5KKZ C;  1TU3 F;  2H89 C;  2M5A B;  3DP5 A;  3D6Z A;  1C6O A;  2PRR A;  5M1B A;  3C8V A;  2LXB A;  1FI9 A;  2AEF A;  3L73 G;  1Q7Y Q;  1GMJ A;  3RGU A;  4LLH A;  3RL0 C;  4NPD A;  2PAC A;  3H1J G;  4L3G A;  2XZR A;  1LP1 B; 
#chains in the Genus database with same CATH homology
 2ZON G;  5CID B;  2Y0C A;  2KNC B;  5CIB B;  3GW6 A;  1CIE A;  5CYT R;  5CIF B;  2FWL A;  1CRC A;  4WQ7 A;  5KLI B;  1KX7 A;  1NIR A;  4WQC A;  1N50 A;  2Y0D A;  4EDF A;  3L70 D;  2ORL A;  4FA4 A;  4AX3 A;  1CIH A;  1CHI A;  5E79 V;  4EIE A;  1L9J C;  1PP9 D;  3CU4 A;  1C7M A;  3ZOW A;  1N90 A;  1FJ0 A;  1QL3 A;  1KYO D;  1CTZ A;  1E8E A;  1I6D A;  351C A;  5DF5 A;  3OA8 B;  1H33 A;  4NFG B;  2MHM A;  4XYD B;  1QL4 A;  2QG4 A;  1CIG A;  1CTY A;  4N0K A;  1HJ5 A;  1ZZH A;  1QYZ A;  155C A;  1CIF A;  5B5E V;  2D0S A;  2QJP B;  5H2F V;  3CX5 D;  3O5C A;  1CCH A;  3MK7 B;  1F1F A;  1CXA A;  3PTZ A;  5CIG B;  3VMA A;  2C9X B;  2B0Z B;  3WFB C;  1SQQ D;  3L71 D;  1IQC A;  1DW2 A;  1J3S A;  1GIW A;  3H1I D;  1MG2 D;  4PW9 B;  3ZOX A;  1FHB A;  2OZ1 A;  4FA1 A;  1U74 B;  1FI7 A;  1OAE A;  1AKK A;  1C75 A;  3A0H V;  1HCM A;  1ETP A;  2PCC B;  1IO3 A;  1CYI A;  1CHJ A;  2RN0 A;  4RSZ A;  2BCC D;  1DII C;  2L4D A;  2AI5 A;  3CXH D;  1SQV D;  1VYD A;  3L72 D;  2JTI B;  5B6Q A;  2YQB A;  1EZV D;  1HZU A;  3PHL A;  1W2L A;  3VRD A;  1DT1 A;  3BCC D;  4K3I A;  2JQR A;  3H1H D;  3L73 D;  1DIQ C;  1DW0 A;  3H1J D;  2Q3E A;  3C2C A;  3PH2 B;  1LS9 A;  5DFS A;  1CSV A;  2C1V A;  451C A;  1FCD C;  3PXW A;  1AOQ A;  1CRH A;  1KB9 D;  1N15 A;  2V07 A;  2YIU B;  1CYJ A;  2N9I A;  1GDV A;  1MG3 D;  5KKZ B;  1FOC A;  1K3G A;  4PD4 D;  2C2C A;  1COT A;  3HQ6 A;  2FYN B;  2D0W A;  1BL9 A;  1B7V A;  1RAQ A;  4FB1 A;  4RJT A;  1YEA A;  3L4O A;  2N9J A;  3OA8 A;  1CCR A;  5DJQ C;  1LMS A;  2B11 B;  2B10 B;  1I8O A;  4L1Q A;  1HJ3 A;  3TF5 A;  1C2N A;  3SJL A;  2VHD A;  1R0Q A;  2EXV A;  3RN0 A;  4JCG A;  2GIW A;  1CSX A;  1N9C A;  3KHU A;  1E29 A;  3WU2 V;  1AOF A;  1S5L V;  1A8C A;  3HQ9 A;  1KV9 A;  1H1O A;  1CC5 A;  1H32 B;  1WVE C;  5GTI V;  1YIC A;  1YCC A;  2C1D B;  3A0B V;  4P4Q B;  2K9J B;  3FWL A;  4Y5R A;  2BH5 X;  5CIH B;  3WUI A;  1RAP A;  2DGE A;  3OCD A;  1L0L D;  5CIC B;  2N18 C;  1YNR A;  2ZXY A;  3O0R C;  1IZL 0;  4PWA A;  1RZ6 A;  3PXS A;  4KMG A;  1PPJ D;  4EIC A;  5KAF V;  2C1U A;  4AAL A;  2YK3 A;  2N9Y B;  2A06 D;  1H31 A;  2BPB B;  5C0Z A;  2AIU A;  3ZIY A;  5TJH A;  1COR A;  1C6R A;  1NML A;  3RLM A;  1NNO A;  2N3B A;  1I55 A;  4AAN A;  3O20 A;  3ZOY A;  3OCD B;  3L4M A;  3VYM A;  3HQ8 A;  3KZI V;  1BCC D;  1A2S A;  3WC8 A;  1LC2 A;  4XXL A;  3TGU D;  1YFC A;  3H1L D;  3X39 A;  4WQ8 A;  3L75 D;  2B12 B;  1AYG A;  1H31 B;  1L0N D;  1FI3 A;  2GC7 D;  4FA5 A;  3RN1 A;  2MTA C;  1GJQ A;  1YTC A;  2BCN B;  1QN2 A;  4D6T D;  3NBT A;  2BGV X;  4DY9 A;  1K3H A;  2ZOO A;  2CE0 A;  4WQA A;  4H0J A;  1M60 A;  1CSW A;  3TYI A;  1CO6 A;  3WFD C;  3ZCF A;  1KYO W;  2QJK B;  4A7P A;  1HZV A;  4PJ0 V;  4EID A;  1M70 A;  1P84 D;  4GYD A;  4WQ9 A;  3CP5 A;  3M97 X;  4WQE A;  2JWA A;  1RZ5 A;  1BGY D;  4WQD A;  5CIE B;  1GKS A;  2ZBO A;  3CX5 W;  1YIQ A;  1H32 A;  2AXT V;  1H9Y A;  3HQ7 A;  3WFE C;  2C1D A;  1I54 A;  2RMZ A;  2LIR A;  1EB7 A;  1E2R A;  2KS1 A;  4FAN A;  2CA4 B;  1HH7 A;  4MU8 A;  3TDK A;  1NTM D;  3NWV A;  1KIB A;  1ZRT D;  4O1W A;  2PCB B;  5C9M A;  1W5C T;  1CRG A;  3A9F A;  1NTK D;  1C6S A;  2BH4 X;  3RMZ A;  5DJQ B;  1I8P A;  1H9X A;  4O1Q A;  4FA9 A;  4U3F D;  1CXC A;  1YEB A;  4WQB A;  3ITK A;  4H0K A;  2LIT A;  2GC4 D;  1CNO A;  1LFM A;  5GTH V;  1LC1 A;  3PXT A;  2QJY B;  4L3H A;  3PRJ A;  1NMI A;  1U75 B;  3CXH W;  2BLF B;  2DVH A;  2XTS B;  3SXT A;  3L74 D;  3O1Y A;  3GG2 A;  3CYT I;  5EXQ A;  2GB8 B;  5KAI V;  4YE1 A;  3ZOO A;  3DR0 A;  3MK7 C;  1NU1 D;  1DVV A;  4V2K A;  2FRC A;  1QKS A;  2CXB A;  1GQ1 A;  1DVH A;  1A56 A;  1HRO A;  1OCD A;  3VNW A;  3WFC C;  3ZBM A;  4QAO A;  1C2R A;  2V08 A;  3SVW A;  1SQP D;  5TIS V;  3ORV A;  1CHH A;  1GU2 A;  5KLV D;  2FYU D;  1CTJ A;  1HJ4 A;  1MZ4 A;  1KX2 A;  2N18 B;  1L9B C;  2CE1 A;  1CRI A;  4AAM A;  1I6E A;  1HRC A;  2O3J A;  3JBT B;  2Y0E A;  2B4Z A;  1JDL A;  1H33 B;  4Q5P A;  4EIF A;  2YCC A;  4J20 A;  2ZZS 1;  2I8F A;  3DMI A;  1DW1 A;  1SQX D;  1IRW A;  1CRY A;  1CYC A;  4LJI A;  1CRJ A;  2N3Y A;  5B66 V;  3SLE A;  1CED A;  4GED B;  3NBS A;  1IRV A;  2CA3 B;  4UB8 V;  1WEJ F;  4FAV A;  1C52 A;  1SQB D;  3SWS A;  3PLN A;  2C8S A;  2OZ1 B;  1S6V B;  1NTZ D;  1DW3 A;  1M6Z A;  3DP5 A;  1C6O A;  2HV4 A;  1CSU A;  1FI9 A;  2L91 A;  4UB6 V;  5IY5 1;  1I5T A;  1BE3 D;  2IBZ D;  4AAO A;  1KB0 A;  3CWB D;  3H1K D;  2PAC A;  5AUR A;  4IL6 V;  4L3G A;  1F1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...