1SQVE

Crystal structure analysis of bovine bc1 with uhdbt
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
196
structure length
196
Chain Sequence
b'SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome c reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 39
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1sqvE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1sqvE02
2QJYC 2DE6D 2FYUE 2HMOA 4NBDD 3GZYA 3H1KE 2BMQA 1JM1A 4H44D 4P1CH 5AEWA 3GOBA 5KLVE 1O7PA 4H0LD 4AIVA 1SQQE 3D89A 1KB9E 3VCPA 5BOKA 2XSOA 2E76D 1L0LE 3VMID 4HKVA 4HM5A 3GKEA 1G8JB 3GL2A 3GTSA 3C0DA 3L72E 3H1LE 1VCKA 2GBXA 1G8KB 2B24A 4QURA 2NVEA 2E74D 2BMOA 2XRXA 2DE5D 1WQLA 1NYKA 4NBCD 2ZT9D 2GBWA 1ULJA 1NTME 4HM6A 2BCCE 2E4PA 1SJGA 2NWFA 1UUWA 1O7NA 2E4QA 4HM7A 1SQXE 3VMGD 5HL4A 1BCCE 2A06E 2YFIA 1EG9A 2QJPC 1O7GA 5KLIC 3TGUE 3L75E 1RFSA 3L70E 3CWBE 3FOUA 4NBAD 4QUPA 2IBZE 2B1XA 1VF5D 2HMMA 4H13D 4NB9D 5CXMA 1FQTA 1O7HA 1SQPE 1Q90C 2NVFA 4NB8D 4NBFD 4NBED 2HMKA 4NBGD 4QDDA 4QDFB 1P84E 2NVGA 2YFLA 3L73E 1O7MA 4HM2A 5AEUA 2NUKA 2YFJA 3GL0A 3N0QA 3H1IE 4HM8A 4EMJB 2D2CD 2XSHA 2QJKC 1RIEA 2HMLA 2YIUC 3L71E 2JZAA 1SQVE 3GTEA 4HJLA 4NBBD 3H1HE 1ZRTE 2I7FA 4HM1A 4P1BH 3VMHD 1PPJE 3L74E 3BCCE 3GZXA 3GCEA 2JO6A 1O7WA 2NUMA 2FYNC 3VCAA 4PV1D 1UUVA 4HM3A 3GB4A 1BGYE 4D6TE 4QDCA 1NDOA 1BE3E 2E75D 3AZCA 1ULIA 1NTKE 3CXHE 4NBHD 4QCKA 5KKZC 4HM4A 2XR8A 3EN1A 3EQQA 4PD4E 2HMJA 2YVJB 4QDFA 4QUQA 4U3FE 1NTZE 2BMRA 1KYOE 2ZYLA 2Q3WA 1PP9E 2DE7D 2HMNA 3H1JE 1SQBE 4OGQD 1EZVE 3CX5E 1VM9A 4HM0A 2QPZA 3DQYA 1L0NE 4AAYB 1NU1E 2CKFA
chains in the Genus database with same CATH superfamily
1GW4A 2PFXA 5AW1B 3II6A 1L4AC 5KLVK 5H2FH 1JM1A 3LW5H 3VP8A 4ZKUA 1M7LA 2WSFJ 1VL2A 3CX5D 1PV3A 3H1IJ 3GMAA 1KB9I 2P2UA 3AE4C 1VCKA 3WUUA 2YKQA 2N1TA 3RK2B 1EZVI 1BGYG 1BE3G 1AVYA 3G4SP 1OIPA 2KOGA 2E4QA 4IL6H 5AVXB 4HM7A 4R4LA 2AXTH 1IK7A 3TGUE 1PIXA 4WB4A 3M06A 2WPSA 1VF5D 1M1JB 1FQTA 5AVTB 2NVGA 3CMEP 4HM2A 5AEUA 4DT0A 2WSSH 3RK2C 2HMLA 3GTEA 3H1KJ 1H0TB 1ZRTE 5M1BA 1QEXA 1K73Q 5AVYB 3Q5SA 5CCGC 1W2BO 4OVNF 2XNXA 3H1LG 1SFCD 4C7NB 4QCKA 1QL1A 2IZ0A 3Q2YA 1NTZK 2OTJP 2FBWC 3WU2H 1JUNA 1SQBK 1URQB 1RF1B 5E79H 4I7ZB 2ITAA 3L71J 3N4XA 4HM0A 1U7MA 4D6TD 4NPDA 1HWTC 3HUSC 1KFMA 3SSUA 2QJYC 2HMOA 1SQQK 3FXDA 4HB1A 3RGUA 4H0LD 2LR2A 2QE7H 3H1JD 3V2PA 1ZV8A 1UIIA 1GDTA 4PD4I 1G8JB 1OXZA 2XZRA 2C0XA 4PD4H 5KJ7A 3CCMP 1ZR2A 3C0DA 2O1KA 3AE7C 3AE1C 3I56P 1NTMK 3GG2A 1MV8A 2QJPB 2VRSA 3OW2O 4N78D 1PGQA 2ZFCA 1CZQA 4CPGA 3I5CA 1KILE 1HBWA 4QMAA 2WSCH 1NH4A 2KLUA 3V2QA 2M3EA 2WPRA 2W83C 1FS0E 1ZOYC 1JTHA 3L74D 3TGUD 3CCLP 2FYNC 2IFMA 5BU8B 2J59M 1RF0C 2GUSA 2WT7A 2OGUA 1NTKE 2IBZI 5AVQB 5C39A 1KORA 2BEQD 3EFFK 1ZRTD 4GKGA 3H1KG 2C9LY 3CPWO 3NTNA 3AEGC 2QPZA 4AAYB 4L75A 4C46A 1K04A 4AUWA 1PGPA 1GL2A 3L70J 2DE6D 1JCCA 2FYUE 2QVAA 2KS1B 3IAOA 3RK2D 2O01J 3SWKA 1QL2A 5AEWA 3B5NB 1VQLP 1YTZT 2V7QJ 2YXQB 2Q1KA 2FFDA 3L71G 3Q1MA 5GTHE 4HJGH 3LW5J 3TK1A 1KMIZ 1WMKA 5KLIB 1W2EA 2XDJA 1ZLLA 5AW8B 3HE5B 1O7GA 1OFCX 1G2CA 1GZLA 2NVFA 1LWUC 1JY2O 1Y8AA 3VOPA 1JOCA 1MFTA 3H1IE 3UIAA 4HJLA 2YIUC 1YI2P 4NBBD 1QVFO 2I1KA 2SPZA 1URQD 5B5EE 4WWIA 3IN6A 1KTMA 1BGYD 3E1RA 5L8RJ 1BE3D 1SQPK 3V2NA 3CXHE 2W6AA 2M0BA 2O01N 3USSA 1KQLA 1P84I 2HMNA 1CW5A 1P84H 1LTBC 1KZUB 3L36A 1U57A 1ZR4A 2YNYA 1IZNB 1NTKD 2IX7C 2B88A 2IZ1A 3H1KE 2ZYGA 1N86A 1IFDA 4DOJA 5APTA 3VMID 1E79H 2QG4A 3H1HG 1NTZJ 2JWAA 1DD4A 2AEJA 1SQBJ 3L74J 1KYOH 5GTIH 4W7ZA 2O3JA 1OVVA 1KD1Q 2YKOA 1HJ0A 2PP6A 1LP1B 1MKMA 2Q3EA 3AEBC 1DX7A 1SQXK 3CCSP 3HD7C 5APWA 3ITKA 3G71P 1FZCA 2KSEA 5CJ4A 2Y9ZA 3CCJP 2L5GB 1QLED 3OAKA 4HYTB 1Q90C 1NKZB 2W8ZA 4N6JA 3Q5RA 1KN7A 2Z5HA 2YFLA 3TNUB 1LTAC 1Q81Q 2POHA 3H32B 1FOSF 1NTMJ 1EDIA 1EDJA 3D70A 2B87A 2WSCJ 4HM3A 1EZVG 4U7JA 3A0HH 1OMIA 1VQ9P 2OYHB 1KYOD 1OZHA 3BRVB 3PP5A 3R4YA 3B5ND 2BMRA 4UB8E 2J58A 2BCCG 4PJ0E 2GA1A 1BDDA 1BCCG 1L0NE 1NU1E 1LTJB 3CC2P 2OTKE 2CK3H 3B71A 3CXHD 3L75J 3AECC 3BVHA 4GDOA 1RE3C 1N7SB 4NBDD 3GZYA 3O6QA 1N73B 1S3JA 1S5LH 2ZXEB 2W27A 4LC1A 4OGQB 4WY4B 4HM5A 2E5TA 3VP9A 1SLQA 3MUDC 4BRYA 1J1EC 3H1KD 3D6YA 1BGYJ 4C7RA 2C9NY 3AE2C 1BE3J 2NWFA 1UUWA 1N7LA 1FU1A 1LJ2A 1YJWP 1NTZG 3L70E 1KQSO 1WRGA 1SQBG 1VDFA 2B1XA 3R2PA 3S9OA 3D71A 3GHGC 1K9MQ 3SWFA 5KAIH 2IDBA 1FAVA 2OYOA 1FJPA 3L71D 1SQVK 3QWOC 3V4QA 5CMZA 1VQKP 2V4HA 3G3ZA 5CCHD 1VQNP 3HRNA 1T2KC 5KTBA 2H7HA 5H2FE 1FBMA 3CLQA 3M9HA 3GB4A 1Q82Q 1HTLC 5AW6B 1M1JA 3H1LJ 2HMJA 2FYZA 2KUBA 5APSA 1RQVA 1NTMG 1QGKB 2NPSC 1EZVE 1M57D 4PV1B 1H0TA 1L4AB 2A06G 1L2PA 2J5UA 3TSIA 1CI6B 1AQTA 4IL6E 4Z1MH 5B66H 3A0BH 2AXTE 3A2AA 3MGNA 4ASWA 4IL6X 1SQPJ 1L0LK 3KPEA 4UB6E 2V7QH 1URQA 1RF1A 1KILA 5KAFH 2FXMA 3BCCG 1IC2A 3L75G 1DIPA 3M91A 5AW4B 2IBZG 2P1JA 1S2EA 4PV1C 1JY3N 4NBCD 2PRRA 3H6PA 3KQGA 1FDOA 3S4RA 2WWWA 2K9YA 3VN0A 3TDKA 1LT9B 1O7NA 4O9BA 1RHZB 4JF7A 1EG9A 4U3FG 4N78E 3FOUA 3P8MC 1KB9H 1HF9A 1VQ6P 5E79E 1USEA 2H43A 1S9KE 1HH0A 2JZAA 3SWYA 5AW9B 3L70D 3GF7A 4TLFA 3L74E 2YMYA 2GUVA 4ZMDA 3JSVC 2XU6A 1LT9C 1FE6A 2OYIA 3PRJA 3AEFC 3M0DC 1ULIA 1Q86Q 1N7SD 2XR8A 1HGVA 3LIDA 1RE4A 2YO3A 4PD4E 1M8OB 3HUSB 2QJYB 5DJUB 3IR9A 4OGQD 4WY4D 1K05A 2E75B 3CMAP 1USDA 2KP8A 1KB9D 1JM0A 3U1AA 1VQOP 1IFJA 2RMZA 1EZVD 1FZEA 3T97B 2K37A 2LKMA 1LGHB 2GM4A 3SFEC 3PH0A 4XFJA 4EOTA 2DE5D 1A02J 2Z4EA 2KXPB 1SQPG 2NPSD 2E75C 1BCCD 2KS1A 3BATA 1DEEG 3B5NA 4LLHA 3KZIH 2YFIA 3NFQA 2L91A 3L75E 5KKZB 2IBZE 1JY3P 3G9RA 3CI9A 2P67A 2HMKA 3B8EB 2YKPA 2XKMA 1JCDA 2FYNB 2N9BA 1JMMA 2A45I 2I7FA 2A45H 4NPEA 1YQ4C 2N1TB 3GCEA 1O7WA 4L76A 4H13B 4WBAA 1M90Q 4PV1D 1L4AD 1BGYE 2WVRA 1BE3E 2K9JB 1MFZA 2HYNA 5KKZC 1S9KD 1OW8A 1IO4A 1NTZD 2N9YB 1SQBD 1PL5A 3AE8C 5APXA 1RY3A 1YHQP 1SQXG 1EDLA 1U7JA 2AEFA 2N1TC 1IFMA 4H13C 4PD4D 2R44A 1YYCA 2KIKA 4JYBA 1D7MA 1X22A 2YMKA 4WVZA 2WMMA 5CCHA 3GL2A 3H1HJ 4IFMA 3H1LE 1FC2C 1YQ3C 1NTMD 1AV1A 1NYKA 2MJZA 3G6EP 2A06D 2E4PA 3W68A 4HKZH 4K3AA 1GK4A 2NZ2A 5CCGD 3VMGD 1NO4A 1LWUB 2E76C 3VMYA 2FXPA 3H25A 3PLNA 2JDIH 1SQPE 1NAFA 2B89A 2YIUB 5AVSB 1AFOA 1P84E 1M1KQ 2YFJA 1AA0A 2BEZF 3EFGA 4R4MA 2XSHA 3KXDA 2ZT9C 3L75D 5KLVJ 2KNCA 2IBZD 2M3BA 3CCVP 1GTWA 2MKVA 1FZGA 1NTKK 4QDCA 2E75D 1OX3A 3CCQP 4HM4A 3L72J 4NPFX 3HTKB 4U3FD 3OJAB 4QUQA 3TNUA 2ZYDA 3MTUE 1KYOE 5GTIE 2Q3WA 2DE7D 2K88A 2BCCJ 1ZW0A 2R32A 2LXCB 1BCCJ 2FYUK 5KJ7C 1JTHB 5AVRB 1X0TA 2KI7B 3RL0g 1X9VA 5AW5B 1SP4A 1N2DC 2KSJA 2OYHA 3A7OA 1SQVG 4AQRD 3GKEA 1PPJG 3RK3C 4QURA 1FDMA 3HD7B 1LTJA 3RBXA 4RKUJ 2KZIA 2YO2A 2WQYC 1VQ8P 1N7SA 4HM6A 1MZ9A 1N73A 1GL2B 3BASA 3A0HE 1FZAA 3H1LD 4QUPA 2N1TD 3I55P 4H13D 2HMMA 4WY4A 5CXMA 3V4WA 1NHLA 3AE6C 2JKVA 2M5AA 1SFCA 3GLMA 2BASA 3N0QA 3L71E 2AXCA 1SQQJ 1L0LG 2O1JA 2W90A 2HR3A 3CL3D 1SQPD 1T3UA 1S5LE 4ASVA 1YIJP 4GOFA 1P84D 1GL2C 1S5LX 4NBHD 3EQQA 2K1AA 2CPBA 2QM7A 5KLVG 2E5YA 2D2CC 5DJTB 5AW7B 2JWDA 2FFDC 5BVZA 3DQYA 3IF4A 4OH8B 3W67A 1HVVA 2WSEJ 3L72G 4Y99C 5CBNA 2WZ7A 3GOBA 3P8CD 1K8AQ 1J1EB 4L74A 5KAIE 1UIXA 4GOEA 2KLVA 1LTIC 3BCCJ 1L4AA 3E1IA 3NXSA 1CI6A 1R5LA 2QM8A 5CJ0A 3K5BA 2HPCB 3PJSK 3WUVA 5KJ7D 1LTSC 1J2JB 3GHGB 4U3FJ 3H1JG 4EI2A 4NB9D 4NBED 4NB8D 4QDDA 2QA4P 1YBKA 1HGZA 3H1HE 5B66E 3A0BE 2JJLA 1NVOA 3FX0A 2Y0EA 1SS1A 2NPSB 3JCUH 4GT1A 5KAFE 5TISH 1E5WA 1L0NK 1SQQG 1NU1K 2G8YA 5CCGA 2ZVOB 2HFED 3WUTA 3GTSA 2OTLP 1S1CX 2YXRB 3A3YB 1R8EA 2NRGA 3HD7D 1IJDB 2JO1A 1NJIQ 3CCRP 5KLVE 4AIVA 4DCKA 1KB9E 2A45G 3AE9C 1AQ5A 3VCPA 3S1KA 2G3AA 1JY2N 2H88C 2JP3A 1FZCC 1Y9BA 3HUSA 1GL2D 1Q90D 4EDFA 3FGAD 3L72E 4JQ0D 2C0WA 1YTZI 1OW7A 1KFNA 2XRXA 3HE4B 3CX5I 1WQLA 2JEEA 3CX5H 3AE3C 5AVWB 2BCCE 4C7NA 3O8ZA 4KJMA 4H0LC 1BCCE 3QH9A 3T97A 1PP9J 2B9BA 2WTYA 1IFPA 5BU5A 1HUCA 4HM8A 3AEAC 1PPJD 3CD6P 1RQUA 1GW3A 1H89A 2QIWA 3D6ZA 1BDCA 1JEKA 3IFMA 1JMBA 1EQ7A 2HODB 3WU2E 1NKNA 3N7NA 3U59A 1YJ9P 1FZBA 1KQFB 4MN4C 2Y0DA 2E43A 1J1DC 3H1HD 1NTZE 1SVFA 3KYQA 1SQBE 1X8YA 2CPSA 1SQXJ 1RF0A 2H89C 2UWJE 4Y28J 3EWKA 1KC8Q 3RBZA 3U1CA 1Q2NA 2Q5UA 1QVGO 3KZIE 1T3JA 2BMQA 2K9JA 1L0LD 4DJGA 1SQQE 3D89A 2PAJA 3L73J 1VQMP 4I1LA 4HKVA 4IFFA 2QSIA 4UB6H 2GBXA 3RL0B 2BMOA 5APUA 2P10A 5AVVB 5KLVD 3BRTB 1NTKG 3CC4P 2Z5IA 1NTME 5TJHA 1JY2P 1S4XA 1T2KD 5AW3B 1GU4A 3CC7P 2A06E 4YTPC 1RFSA 1FJKA 3L72D 2Q7CA 1O7HA 1LTGC 3TYYA 2RN0A 4QDFB 2Q9IA 1O7MA 1M1JC 2FYUG 2BCCD 2NUKA 3RL0C 3MZWB 4EYYQ 1H8AA 1KILB 3BCCE 2DW3A 2JO6A 1X79B 1PP9G 3M9QA 5K5GB 3VCAA 1LWUA 1KV4A 3F89A 3CCEP 1DH3A 3NMDA 1RH5B 1QX8A 1G1IA 1IFNA 1FZFA 1XTGB 1PZQA 4U3FE 1NWQA 2ZYLA 2ZXXA 1NAYA 4GIFA 5CHXA 2W6JH 1AVOA 3L4FA 5AW0B 1URQC 1RF1C 3B4SA 1R5SA 1KILC 4I7ZC 3HE5A 3AEDC 3CWBJ 4I2LC 3EQ2A 1W5CE 1VQPP 1NGMB 2WSEH 3HTKA 2KK7A 3H1IG 2OYIB 1GD2E 2ZJSE 2P7JA 3FWLA 1SQVJ 3M9BA 5APVA 3V2RA 1L0NJ 1NU1J 4H44B 1MUUA 1SQQD 2IFNA 1ZMEC 2E76B 3L73G 1SJGA 1NOHA 2QJPC 4RJTA 1KQGB 2E74B 4JPZB 2OYIC 4NBFD 1XTCC 1NYHA 5APQA 4LGDE 2ZT9B 4EIJA 3HD7A 1RE4C 3ZDMA 4B86A 4W7YA 3VYIA 2KZJA 1PGOA 4H44C 2QRXA 3P32A 3WMM0 3VMHD 3E7KA 3GZXA 1VQ7P 4RO0A 4BWNA 1L0LJ 2WPQA 1VQ5P 3SFDC 3VMXA 3AZCA 4HH2A 1Z56A 3EN1A 2E74C 2FY8A 1LP1A 3C8VA 1N8RQ 1PP9E 3BCCD 1EDKA 1DD3A 1LTTC 2CKFA 2YVJB 1AJYA 1T8ZA 3RL0D 2E42A 1O7PA 4JBZA 1FOSE 3RK3B 3P8CE 3B5NC 1OWAA 1G1JA 2PGDA 3H32A 4YXWH 1G8KB 2R3CA 1RE3A 3CWBG 4D6TJ 3C9IA 1HJBA 3FWNA 4W80A 2Y0CA 3ABVC 2KYVA 2FXOA 2I8DA 1SQXE 1KILD 2IPPA 3FXEA 1BSNA 5KLIC 3M0AA 3MUDA 2WT7B 1YJNP 3C1LA 3JC22 1OW6A 5APYA 3H1JJ 1L0NG 1NU1G 2RKLA 3L73E 5GTHH 1ZN5A 1JO5A 3GL0A 2WITA 3V6IA 2HPCA 1JY3O 1T6AA 1OVRA 3RK3E 3AEEC 4M3LA 3GHGA 5AW2B 3P7KA 2D2CB 1CSBA 2FFDB 3AE5C 2ZYAA 1IFIA 4GODA 4KT0J 2WSFH 3L37A 4Y99B 1KYOI 5CCHC 2FYUD 3L70G 3TGUJ 4I6MC 2LXBA 3VMAA 5B5EH 3Q3DA 2W6BA 1OVUA 1JB0J 1FDIA 4H44D 1LT1A 2IYPA 2KNCB 2XNDH 1PP9D 2H8PD 2IYOA 2NPSA 2E76D 3CXHI 3CXHH 1G2CB 3TF5A 3MHVA 4N3YB 1H88A 1GU5A 2B24A 2NVEA 4A7PA 2E74D 4IOIH 1VPCA 5EFWB 2RH0A 4RESB 2ZT9D 1WT6A 1GMJA 2M8RA 3PHLA 5HL4A 4ZKPA 3CWBE 1ZP0C 3JCUE 2ZVNB 4ZNCA 4JYCA 2K3RA 1LNQA 4KHXA 3F5HA 5TISE 1EXIA 4D6TG 3H1ID 1PFIA 3HE4A 1PGJA 1SQXD 1RIEA 1SQVE 2KB7P 4P1BH 1PPJE 2I1JA 3MP7B 2NUMA 2FKWB 1VF5B 5AVZB 4BXLA 1NDOA 3GW6A 2HG5D 3L73D 2XV5A 3A5TA 3LIEA 2R3SA 2R5DA 2OYHC 3RK3D 3CX5E 4YPCA 1LT9A 5AVUB 1IK9A 2M5AB 3M0DA 2R5BA 1SFCB 4K35A 1VF5C 1LTJC 2HODA 4P1CH 4L73A 3Q5PA 1FZCB 1N7SC 1DEBA 1ZXGA 2XSOA 5BOKA 1M56D 1L0LE 3L35A 1N73C 4AYCA 3OA7A 2Y9YA 1TU3F 3L74G 1A02F 4OGQC 1GK6A 3TGUG 2P58A 3CCUP 4WY4C 4UB8H 3VMZA 1Y47A 2Q3IA 2QJKB 1VQ4P 3KHUA 4PJ0H 2AEMA 5CBOA 4H0LB 1S72P 4DZOA 1BSHA 1ULJA 2GBWA 1NTKJ 1SFCC 2B87B 3V5BA 4NBAD 4XA4A 2OARA 2JR8A 4NBGD 4OWFA 3KDPB 1EXJA 2FYUJ 4EMJB 1EC5A 2D2CD 2QJKC 3GF3A 4HM1A 3CWBD 2Q6QA 2WPVB 1UUVA 4D6TE 3O6QB 4XE5B 1J1DB 2QEXP 1YITP 3MIWA 3MD0A 1JNMA 2ZAEB 4TT3H 1SQVD 3VTPC 2O01H 4QDFA 2HLOA 3PTZA 2OQQA 4BRYB 1L0ND 1NU1D 3H1JE 1VM9A 4YXDC 4IFDK 1Q7YQ
chains in the Genus database with same CATH topology
2QJYC 2DE6D 2FYUE 2HMOA 4NBDD 3GZYA 3H1KE 2BMQA 1JM1A 4H44D 4P1CH 5AEWA 3GOBA 5KLVE 1O7PA 4H0LD 4AIVA 1SQQE 3D89A 1KB9E 3VCPA 5BOKA 2XSOA 2E76D 1L0LE 3VMID 4HKVA 4HM5A 3GKEA 1G8JB 3GL2A 3GTSA 3C0DA 3L72E 3H1LE 1VCKA 2GBXA 1G8KB 2B24A 4QURA 2NVEA 2E74D 2BMOA 2XRXA 2DE5D 1WQLA 1NYKA 4NBCD 2ZT9D 2GBWA 1ULJA 1NTME 4HM6A 2BCCE 2E4PA 1SJGA 2NWFA 1UUWA 1O7NA 2E4QA 4HM7A 1SQXE 3VMGD 5HL4A 1BCCE 2A06E 2YFIA 1EG9A 2QJPC 1O7GA 5KLIC 3TGUE 3L75E 1RFSA 3L70E 3CWBE 3FOUA 4NBAD 4QUPA 2IBZE 2B1XA 1VF5D 2HMMA 4H13D 4NB9D 5CXMA 1FQTA 1O7HA 1SQPE 1Q90C 2NVFA 4NB8D 4NBFD 4NBED 2HMKA 4NBGD 4QDDA 4QDFB 1P84E 2NVGA 2YFLA 3L73E 1O7MA 4HM2A 5AEUA 2NUKA 2YFJA 3GL0A 3N0QA 3H1IE 4HM8A 4EMJB 2D2CD 2XSHA 2QJKC 1RIEA 2HMLA 2YIUC 3L71E 2JZAA 1SQVE 3GTEA 4HJLA 4NBBD 3H1HE 1ZRTE 2I7FA 4HM1A 4P1BH 3VMHD 1PPJE 3L74E 3BCCE 3GZXA 3GCEA 2JO6A 1O7WA 2NUMA 2FYNC 3VCAA 4PV1D 1UUVA 4HM3A 3GB4A 1BGYE 4D6TE 4QDCA 1NDOA 1BE3E 2E75D 3AZCA 1ULIA 1NTKE 3CXHE 4NBHD 4QCKA 5KKZC 4HM4A 2XR8A 3EN1A 3EQQA 4PD4E 2HMJA 2YVJB 4QDFA 4QUQA 4U3FE 1NTZE 2BMRA 1KYOE 2ZYLA 2Q3WA 1PP9E 2DE7D 2HMNA 3H1JE 1SQBE 4OGQD 1EZVE 3CX5E 1VM9A 4HM0A 2QPZA 3DQYA 1L0NE 4AAYB 1NU1E 2CKFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QJY C;  2DE6 D;  2FYU E;  2HMO A;  4NBD D;  3GZY A;  3H1K E;  2BMQ A;  1JM1 A;  4H44 D;  4P1C H;  5AEW A;  3GOB A;  5KLV E;  1O7P A;  4H0L D;  4AIV A;  1SQQ E;  3D89 A;  1KB9 E;  3VCP A;  5BOK A;  2XSO A;  2E76 D;  1L0L E;  3VMI D;  4HKV A;  4HM5 A;  3GKE A;  1G8J B;  3GL2 A;  3GTS A;  3C0D A;  3L72 E;  3H1L E;  1VCK A;  2GBX A;  1G8K B;  2B24 A;  4QUR A;  2NVE A;  2E74 D;  2BMO A;  2XRX A;  2DE5 D;  1WQL A;  1NYK A;  4NBC D;  2ZT9 D;  2GBW A;  1ULJ A;  1NTM E;  4HM6 A;  2BCC E;  2E4P A;  1SJG A;  2NWF A;  1UUW A;  1O7N A;  2E4Q A;  4HM7 A;  1SQX E;  3VMG D;  5HL4 A;  1BCC E;  2A06 E;  2YFI A;  1EG9 A;  2QJP C;  1O7G A;  5KLI C;  3TGU E;  3L75 E;  1RFS A;  3L70 E;  3CWB E;  3FOU A;  4NBA D;  4QUP A;  2IBZ E;  2B1X A;  1VF5 D;  2HMM A;  4H13 D;  4NB9 D;  5CXM A;  1FQT A;  1O7H A;  1SQP E;  1Q90 C;  2NVF A;  4NB8 D;  4NBF D;  4NBE D;  2HMK A;  4NBG D;  4QDD A;  4QDF B;  1P84 E;  2NVG A;  2YFL A;  3L73 E;  1O7M A;  4HM2 A;  5AEU A;  2NUK A;  2YFJ A;  3GL0 A;  3N0Q A;  3H1I E;  4HM8 A;  4EMJ B;  2D2C D;  2XSH A;  2QJK C;  1RIE A;  2HML A;  2YIU C;  3L71 E;  2JZA A;  1SQV E;  3GTE A;  4HJL A;  4NBB D;  3H1H E;  1ZRT E;  2I7F A;  4HM1 A;  4P1B H;  3VMH D;  1PPJ E;  3L74 E;  3BCC E;  3GZX A;  3GCE A;  2JO6 A;  1O7W A;  2NUM A;  2FYN C;  3VCA A;  4PV1 D;  1UUV A;  4HM3 A;  3GB4 A;  1BGY E;  4D6T E;  4QDC A;  1NDO A;  1BE3 E;  2E75 D;  3AZC A;  1ULI A;  1NTK E;  3CXH E;  4NBH D;  4QCK A;  5KKZ C;  4HM4 A;  2XR8 A;  3EN1 A;  3EQQ A;  4PD4 E;  2HMJ A;  2YVJ B;  4QDF A;  4QUQ A;  4U3F E;  1NTZ E;  2BMR A;  1KYO E;  2ZYL A;  2Q3W A;  1PP9 E;  2DE7 D;  2HMN A;  3H1J E;  1SQB E;  4OGQ D;  1EZV E;  3CX5 E;  1VM9 A;  4HM0 A;  2QPZ A;  3DQY A;  1L0N E;  4AAY B;  1NU1 E;  2CKF A; 
#chains in the Genus database with same CATH topology
 1GW4 A;  2PFX A;  5AW1 B;  3II6 A;  1L4A C;  5KLV K;  5H2F H;  1JM1 A;  3LW5 H;  3VP8 A;  4ZKU A;  1M7L A;  2WSF J;  1VL2 A;  3CX5 D;  1PV3 A;  3H1I J;  3GMA A;  1KB9 I;  2P2U A;  3AE4 C;  1VCK A;  3WUU A;  2YKQ A;  2N1T A;  3RK2 B;  1EZV I;  1BGY G;  1BE3 G;  1AVY A;  3G4S P;  1OIP A;  2KOG A;  2E4Q A;  4IL6 H;  5AVX B;  4HM7 A;  4R4L A;  2AXT H;  1IK7 A;  3TGU E;  1PIX A;  4WB4 A;  3M06 A;  2WPS A;  1VF5 D;  1M1J B;  1FQT A;  5AVT B;  2NVG A;  3CME P;  4HM2 A;  5AEU A;  4DT0 A;  2WSS H;  3RK2 C;  2HML A;  3GTE A;  3H1K J;  1H0T B;  1ZRT E;  5M1B A;  1QEX A;  1K73 Q;  5AVY B;  3Q5S A;  5CCG C;  1W2B O;  4OVN F;  2XNX A;  3H1L G;  1SFC D;  4C7N B;  4QCK A;  1QL1 A;  2IZ0 A;  3Q2Y A;  1NTZ K;  2OTJ P;  2FBW C;  3WU2 H;  1JUN A;  1SQB K;  1URQ B;  1RF1 B;  5E79 H;  4I7Z B;  2ITA A;  3L71 J;  3N4X A;  4HM0 A;  1U7M A;  4D6T D;  4NPD A;  1HWT C;  3HUS C;  1KFM A;  3SSU A;  2QJY C;  2HMO A;  1SQQ K;  3FXD A;  4HB1 A;  3RGU A;  4H0L D;  2LR2 A;  2QE7 H;  3H1J D;  3V2P A;  1ZV8 A;  1UII A;  1GDT A;  4PD4 I;  1G8J B;  1OXZ A;  2XZR A;  2C0X A;  4PD4 H;  5KJ7 A;  3CCM P;  1ZR2 A;  3C0D A;  2O1K A;  3AE7 C;  3AE1 C;  3I56 P;  1NTM K;  3GG2 A;  1MV8 A;  2QJP B;  2VRS A;  3OW2 O;  4N78 D;  1PGQ A;  2ZFC A;  1CZQ A;  4CPG A;  3I5C A;  1KIL E;  1HBW A;  4QMA A;  2WSC H;  1NH4 A;  2KLU A;  3V2Q A;  2M3E A;  2WPR A;  2W83 C;  1FS0 E;  1ZOY C;  1JTH A;  3L74 D;  3TGU D;  3CCL P;  2FYN C;  2IFM A;  5BU8 B;  2J59 M;  1RF0 C;  2GUS A;  2WT7 A;  2OGU A;  1NTK E;  2IBZ I;  5AVQ B;  5C39 A;  1KOR A;  2BEQ D;  3EFF K;  1ZRT D;  4GKG A;  3H1K G;  2C9L Y;  3CPW O;  3NTN A;  3AEG C;  2QPZ A;  4AAY B;  4L75 A;  4C46 A;  1K04 A;  4AUW A;  1PGP A;  1GL2 A;  3L70 J;  2DE6 D;  1JCC A;  2FYU E;  2QVA A;  2KS1 B;  3IAO A;  3RK2 D;  2O01 J;  3SWK A;  1QL2 A;  5AEW A;  3B5N B;  1VQL P;  1YTZ T;  2V7Q J;  2YXQ B;  2Q1K A;  2FFD A;  3L71 G;  3Q1M A;  5GTH E;  4HJG H;  3LW5 J;  3TK1 A;  1KMI Z;  1WMK A;  5KLI B;  1W2E A;  2XDJ A;  1ZLL A;  5AW8 B;  3HE5 B;  1O7G A;  1OFC X;  1G2C A;  1GZL A;  2NVF A;  1LWU C;  1JY2 O;  1Y8A A;  3VOP A;  1JOC A;  1MFT A;  3H1I E;  3UIA A;  4HJL A;  2YIU C;  1YI2 P;  4NBB D;  1QVF O;  2I1K A;  2SPZ A;  1URQ D;  5B5E E;  4WWI A;  3IN6 A;  1KTM A;  1BGY D;  3E1R A;  5L8R J;  1BE3 D;  1SQP K;  3V2N A;  3CXH E;  2W6A A;  2M0B A;  2O01 N;  3USS A;  1KQL A;  1P84 I;  2HMN A;  1CW5 A;  1P84 H;  1LTB C;  1KZU B;  3L36 A;  1U57 A;  1ZR4 A;  2YNY A;  1IZN B;  1NTK D;  2IX7 C;  2B88 A;  2IZ1 A;  3H1K E;  2ZYG A;  1N86 A;  1IFD A;  4DOJ A;  5APT A;  3VMI D;  1E79 H;  2QG4 A;  3H1H G;  1NTZ J;  2JWA A;  1DD4 A;  2AEJ A;  1SQB J;  3L74 J;  1KYO H;  5GTI H;  4W7Z A;  2O3J A;  1OVV A;  1KD1 Q;  2YKO A;  1HJ0 A;  2PP6 A;  1LP1 B;  1MKM A;  2Q3E A;  3AEB C;  1DX7 A;  1SQX K;  3CCS P;  3HD7 C;  5APW A;  3ITK A;  3G71 P;  1FZC A;  2KSE A;  5CJ4 A;  2Y9Z A;  3CCJ P;  2L5G B;  1QLE D;  3OAK A;  4HYT B;  1Q90 C;  1NKZ B;  2W8Z A;  4N6J A;  3Q5R A;  1KN7 A;  2Z5H A;  2YFL A;  3TNU B;  1LTA C;  1Q81 Q;  2POH A;  3H32 B;  1FOS F;  1NTM J;  1EDI A;  1EDJ A;  3D70 A;  2B87 A;  2WSC J;  4HM3 A;  1EZV G;  4U7J A;  3A0H H;  1OMI A;  1VQ9 P;  2OYH B;  1KYO D;  1OZH A;  3BRV B;  3PP5 A;  3R4Y A;  3B5N D;  2BMR A;  4UB8 E;  2J58 A;  2BCC G;  4PJ0 E;  2GA1 A;  1BDD A;  1BCC G;  1L0N E;  1NU1 E;  1LTJ B;  3CC2 P;  2OTK E;  2CK3 H;  3B71 A;  3CXH D;  3L75 J;  3AEC C;  3BVH A;  4GDO A;  1RE3 C;  1N7S B;  4NBD D;  3GZY A;  3O6Q A;  1N73 B;  1S3J A;  1S5L H;  2ZXE B;  2W27 A;  4LC1 A;  4OGQ B;  4WY4 B;  4HM5 A;  2E5T A;  3VP9 A;  1SLQ A;  3MUD C;  4BRY A;  1J1E C;  3H1K D;  3D6Y A;  1BGY J;  4C7R A;  2C9N Y;  3AE2 C;  1BE3 J;  2NWF A;  1UUW A;  1N7L A;  1FU1 A;  1LJ2 A;  1YJW P;  1NTZ G;  3L70 E;  1KQS O;  1WRG A;  1SQB G;  1VDF A;  2B1X A;  3R2P A;  3S9O A;  3D71 A;  3GHG C;  1K9M Q;  3SWF A;  5KAI H;  2IDB A;  1FAV A;  2OYO A;  1FJP A;  3L71 D;  1SQV K;  3QWO C;  3V4Q A;  5CMZ A;  1VQK P;  2V4H A;  3G3Z A;  5CCH D;  1VQN P;  3HRN A;  1T2K C;  5KTB A;  2H7H A;  5H2F E;  1FBM A;  3CLQ A;  3M9H A;  3GB4 A;  1Q82 Q;  1HTL C;  5AW6 B;  1M1J A;  3H1L J;  2HMJ A;  2FYZ A;  2KUB A;  5APS A;  1RQV A;  1NTM G;  1QGK B;  2NPS C;  1EZV E;  1M57 D;  4PV1 B;  1H0T A;  1L4A B;  2A06 G;  1L2P A;  2J5U A;  3TSI A;  1CI6 B;  1AQT A;  4IL6 E;  4Z1M H;  5B66 H;  3A0B H;  2AXT E;  3A2A A;  3MGN A;  4ASW A;  4IL6 X;  1SQP J;  1L0L K;  3KPE A;  4UB6 E;  2V7Q H;  1URQ A;  1RF1 A;  1KIL A;  5KAF H;  2FXM A;  3BCC G;  1IC2 A;  3L75 G;  1DIP A;  3M91 A;  5AW4 B;  2IBZ G;  2P1J A;  1S2E A;  4PV1 C;  1JY3 N;  4NBC D;  2PRR A;  3H6P A;  3KQG A;  1FDO A;  3S4R A;  2WWW A;  2K9Y A;  3VN0 A;  3TDK A;  1LT9 B;  1O7N A;  4O9B A;  1RHZ B;  4JF7 A;  1EG9 A;  4U3F G;  4N78 E;  3FOU A;  3P8M C;  1KB9 H;  1HF9 A;  1VQ6 P;  5E79 E;  1USE A;  2H43 A;  1S9K E;  1HH0 A;  2JZA A;  3SWY A;  5AW9 B;  3L70 D;  3GF7 A;  4TLF A;  3L74 E;  2YMY A;  2GUV A;  4ZMD A;  3JSV C;  2XU6 A;  1LT9 C;  1FE6 A;  2OYI A;  3PRJ A;  3AEF C;  3M0D C;  1ULI A;  1Q86 Q;  1N7S D;  2XR8 A;  1HGV A;  3LID A;  1RE4 A;  2YO3 A;  4PD4 E;  1M8O B;  3HUS B;  2QJY B;  5DJU B;  3IR9 A;  4OGQ D;  4WY4 D;  1K05 A;  2E75 B;  3CMA P;  1USD A;  2KP8 A;  1KB9 D;  1JM0 A;  3U1A A;  1VQO P;  1IFJ A;  2RMZ A;  1EZV D;  1FZE A;  3T97 B;  2K37 A;  2LKM A;  1LGH B;  2GM4 A;  3SFE C;  3PH0 A;  4XFJ A;  4EOT A;  2DE5 D;  1A02 J;  2Z4E A;  2KXP B;  1SQP G;  2NPS D;  2E75 C;  1BCC D;  2KS1 A;  3BAT A;  1DEE G;  3B5N A;  4LLH A;  3KZI H;  2YFI A;  3NFQ A;  2L91 A;  3L75 E;  5KKZ B;  2IBZ E;  1JY3 P;  3G9R A;  3CI9 A;  2P67 A;  2HMK A;  3B8E B;  2YKP A;  2XKM A;  1JCD A;  2FYN B;  2N9B A;  1JMM A;  2A45 I;  2I7F A;  2A45 H;  4NPE A;  1YQ4 C;  2N1T B;  3GCE A;  1O7W A;  4L76 A;  4H13 B;  4WBA A;  1M90 Q;  4PV1 D;  1L4A D;  1BGY E;  2WVR A;  1BE3 E;  2K9J B;  1MFZ A;  2HYN A;  5KKZ C;  1S9K D;  1OW8 A;  1IO4 A;  1NTZ D;  2N9Y B;  1SQB D;  1PL5 A;  3AE8 C;  5APX A;  1RY3 A;  1YHQ P;  1SQX G;  1EDL A;  1U7J A;  2AEF A;  2N1T C;  1IFM A;  4H13 C;  4PD4 D;  2R44 A;  1YYC A;  2KIK A;  4JYB A;  1D7M A;  1X22 A;  2YMK A;  4WVZ A;  2WMM A;  5CCH A;  3GL2 A;  3H1H J;  4IFM A;  3H1L E;  1FC2 C;  1YQ3 C;  1NTM D;  1AV1 A;  1NYK A;  2MJZ A;  3G6E P;  2A06 D;  2E4P A;  3W68 A;  4HKZ H;  4K3A A;  1GK4 A;  2NZ2 A;  5CCG D;  3VMG D;  1NO4 A;  1LWU B;  2E76 C;  3VMY A;  2FXP A;  3H25 A;  3PLN A;  2JDI H;  1SQP E;  1NAF A;  2B89 A;  2YIU B;  5AVS B;  1AFO A;  1P84 E;  1M1K Q;  2YFJ A;  1AA0 A;  2BEZ F;  3EFG A;  4R4M A;  2XSH A;  3KXD A;  2ZT9 C;  3L75 D;  5KLV J;  2KNC A;  2IBZ D;  2M3B A;  3CCV P;  1GTW A;  2MKV A;  1FZG A;  1NTK K;  4QDC A;  2E75 D;  1OX3 A;  3CCQ P;  4HM4 A;  3L72 J;  4NPF X;  3HTK B;  4U3F D;  3OJA B;  4QUQ A;  3TNU A;  2ZYD A;  3MTU E;  1KYO E;  5GTI E;  2Q3W A;  2DE7 D;  2K88 A;  2BCC J;  1ZW0 A;  2R32 A;  2LXC B;  1BCC J;  2FYU K;  5KJ7 C;  1JTH B;  5AVR B;  1X0T A;  2KI7 B;  3RL0 g;  1X9V A;  5AW5 B;  1SP4 A;  1N2D C;  2KSJ A;  2OYH A;  3A7O A;  1SQV G;  4AQR D;  3GKE A;  1PPJ G;  3RK3 C;  4QUR A;  1FDM A;  3HD7 B;  1LTJ A;  3RBX A;  4RKU J;  2KZI A;  2YO2 A;  2WQY C;  1VQ8 P;  1N7S A;  4HM6 A;  1MZ9 A;  1N73 A;  1GL2 B;  3BAS A;  3A0H E;  1FZA A;  3H1L D;  4QUP A;  2N1T D;  3I55 P;  4H13 D;  2HMM A;  4WY4 A;  5CXM A;  3V4W A;  1NHL A;  3AE6 C;  2JKV A;  2M5A A;  1SFC A;  3GLM A;  2BAS A;  3N0Q A;  3L71 E;  2AXC A;  1SQQ J;  1L0L G;  2O1J A;  2W90 A;  2HR3 A;  3CL3 D;  1SQP D;  1T3U A;  1S5L E;  4ASV A;  1YIJ P;  4GOF A;  1P84 D;  1GL2 C;  1S5L X;  4NBH D;  3EQQ A;  2K1A A;  2CPB A;  2QM7 A;  5KLV G;  2E5Y A;  2D2C C;  5DJT B;  5AW7 B;  2JWD A;  2FFD C;  5BVZ A;  3DQY A;  3IF4 A;  4OH8 B;  3W67 A;  1HVV A;  2WSE J;  3L72 G;  4Y99 C;  5CBN A;  2WZ7 A;  3GOB A;  3P8C D;  1K8A Q;  1J1E B;  4L74 A;  5KAI E;  1UIX A;  4GOE A;  2KLV A;  1LTI C;  3BCC J;  1L4A A;  3E1I A;  3NXS A;  1CI6 A;  1R5L A;  2QM8 A;  5CJ0 A;  3K5B A;  2HPC B;  3PJS K;  3WUV A;  5KJ7 D;  1LTS C;  1J2J B;  3GHG B;  4U3F J;  3H1J G;  4EI2 A;  4NB9 D;  4NBE D;  4NB8 D;  4QDD A;  2QA4 P;  1YBK A;  1HGZ A;  3H1H E;  5B66 E;  3A0B E;  2JJL A;  1NVO A;  3FX0 A;  2Y0E A;  1SS1 A;  2NPS B;  3JCU H;  4GT1 A;  5KAF E;  5TIS H;  1E5W A;  1L0N K;  1SQQ G;  1NU1 K;  2G8Y A;  5CCG A;  2ZVO B;  2HFE D;  3WUT A;  3GTS A;  2OTL P;  1S1C X;  2YXR B;  3A3Y B;  1R8E A;  2NRG A;  3HD7 D;  1IJD B;  2JO1 A;  1NJI Q;  3CCR P;  5KLV E;  4AIV A;  4DCK A;  1KB9 E;  2A45 G;  3AE9 C;  1AQ5 A;  3VCP A;  3S1K A;  2G3A A;  1JY2 N;  2H88 C;  2JP3 A;  1FZC C;  1Y9B A;  3HUS A;  1GL2 D;  1Q90 D;  4EDF A;  3FGA D;  3L72 E;  4JQ0 D;  2C0W A;  1YTZ I;  1OW7 A;  1KFN A;  2XRX A;  3HE4 B;  3CX5 I;  1WQL A;  2JEE A;  3CX5 H;  3AE3 C;  5AVW B;  2BCC E;  4C7N A;  3O8Z A;  4KJM A;  4H0L C;  1BCC E;  3QH9 A;  3T97 A;  1PP9 J;  2B9B A;  2WTY A;  1IFP A;  5BU5 A;  1HUC A;  4HM8 A;  3AEA C;  1PPJ D;  3CD6 P;  1RQU A;  1GW3 A;  1H89 A;  2QIW A;  3D6Z A;  1BDC A;  1JEK A;  3IFM A;  1JMB A;  1EQ7 A;  2HOD B;  3WU2 E;  1NKN A;  3N7N A;  3U59 A;  1YJ9 P;  1FZB A;  1KQF B;  4MN4 C;  2Y0D A;  2E43 A;  1J1D C;  3H1H D;  1NTZ E;  1SVF A;  3KYQ A;  1SQB E;  1X8Y A;  2CPS A;  1SQX J;  1RF0 A;  2H89 C;  2UWJ E;  4Y28 J;  3EWK A;  1KC8 Q;  3RBZ A;  3U1C A;  1Q2N A;  2Q5U A;  1QVG O;  3KZI E;  1T3J A;  2BMQ A;  2K9J A;  1L0L D;  4DJG A;  1SQQ E;  3D89 A;  2PAJ A;  3L73 J;  1VQM P;  4I1L A;  4HKV A;  4IFF A;  2QSI A;  4UB6 H;  2GBX A;  3RL0 B;  2BMO A;  5APU A;  2P10 A;  5AVV B;  5KLV D;  3BRT B;  1NTK G;  3CC4 P;  2Z5I A;  1NTM E;  5TJH A;  1JY2 P;  1S4X A;  1T2K D;  5AW3 B;  1GU4 A;  3CC7 P;  2A06 E;  4YTP C;  1RFS A;  1FJK A;  3L72 D;  2Q7C A;  1O7H A;  1LTG C;  3TYY A;  2RN0 A;  4QDF B;  2Q9I A;  1O7M A;  1M1J C;  2FYU G;  2BCC D;  2NUK A;  3RL0 C;  3MZW B;  4EYY Q;  1H8A A;  1KIL B;  3BCC E;  2DW3 A;  2JO6 A;  1X79 B;  1PP9 G;  3M9Q A;  5K5G B;  3VCA A;  1LWU A;  1KV4 A;  3F89 A;  3CCE P;  1DH3 A;  3NMD A;  1RH5 B;  1QX8 A;  1G1I A;  1IFN A;  1FZF A;  1XTG B;  1PZQ A;  4U3F E;  1NWQ A;  2ZYL A;  2ZXX A;  1NAY A;  4GIF A;  5CHX A;  2W6J H;  1AVO A;  3L4F A;  5AW0 B;  1URQ C;  1RF1 C;  3B4S A;  1R5S A;  1KIL C;  4I7Z C;  3HE5 A;  3AED C;  3CWB J;  4I2L C;  3EQ2 A;  1W5C E;  1VQP P;  1NGM B;  2WSE H;  3HTK A;  2KK7 A;  3H1I G;  2OYI B;  1GD2 E;  2ZJS E;  2P7J A;  3FWL A;  1SQV J;  3M9B A;  5APV A;  3V2R A;  1L0N J;  1NU1 J;  4H44 B;  1MUU A;  1SQQ D;  2IFN A;  1ZME C;  2E76 B;  3L73 G;  1SJG A;  1NOH A;  2QJP C;  4RJT A;  1KQG B;  2E74 B;  4JPZ B;  2OYI C;  4NBF D;  1XTC C;  1NYH A;  5APQ A;  4LGD E;  2ZT9 B;  4EIJ A;  3HD7 A;  1RE4 C;  3ZDM A;  4B86 A;  4W7Y A;  3VYI A;  2KZJ A;  1PGO A;  4H44 C;  2QRX A;  3P32 A;  3WMM 0;  3VMH D;  3E7K A;  3GZX A;  1VQ7 P;  4RO0 A;  4BWN A;  1L0L J;  2WPQ A;  1VQ5 P;  3SFD C;  3VMX A;  3AZC A;  4HH2 A;  1Z56 A;  3EN1 A;  2E74 C;  2FY8 A;  1LP1 A;  3C8V A;  1N8R Q;  1PP9 E;  3BCC D;  1EDK A;  1DD3 A;  1LTT C;  2CKF A;  2YVJ B;  1AJY A;  1T8Z A;  3RL0 D;  2E42 A;  1O7P A;  4JBZ A;  1FOS E;  3RK3 B;  3P8C E;  3B5N C;  1OWA A;  1G1J A;  2PGD A;  3H32 A;  4YXW H;  1G8K B;  2R3C A;  1RE3 A;  3CWB G;  4D6T J;  3C9I A;  1HJB A;  3FWN A;  4W80 A;  2Y0C A;  3ABV C;  2KYV A;  2FXO A;  2I8D A;  1SQX E;  1KIL D;  2IPP A;  3FXE A;  1BSN A;  5KLI C;  3M0A A;  3MUD A;  2WT7 B;  1YJN P;  3C1L A;  3JC2 2;  1OW6 A;  5APY A;  3H1J J;  1L0N G;  1NU1 G;  2RKL A;  3L73 E;  5GTH H;  1ZN5 A;  1JO5 A;  3GL0 A;  2WIT A;  3V6I A;  2HPC A;  1JY3 O;  1T6A A;  1OVR A;  3RK3 E;  3AEE C;  4M3L A;  3GHG A;  5AW2 B;  3P7K A;  2D2C B;  1CSB A;  2FFD B;  3AE5 C;  2ZYA A;  1IFI A;  4GOD A;  4KT0 J;  2WSF H;  3L37 A;  4Y99 B;  1KYO I;  5CCH C;  2FYU D;  3L70 G;  3TGU J;  4I6M C;  2LXB A;  3VMA A;  5B5E H;  3Q3D A;  2W6B A;  1OVU A;  1JB0 J;  1FDI A;  4H44 D;  1LT1 A;  2IYP A;  2KNC B;  2XND H;  1PP9 D;  2H8P D;  2IYO A;  2NPS A;  2E76 D;  3CXH I;  3CXH H;  1G2C B;  3TF5 A;  3MHV A;  4N3Y B;  1H88 A;  1GU5 A;  2B24 A;  2NVE A;  4A7P A;  2E74 D;  4IOI H;  1VPC A;  5EFW B;  2RH0 A;  4RES B;  2ZT9 D;  1WT6 A;  1GMJ A;  2M8R A;  3PHL A;  5HL4 A;  4ZKP A;  3CWB E;  1ZP0 C;  3JCU E;  2ZVN B;  4ZNC A;  4JYC A;  2K3R A;  1LNQ A;  4KHX A;  3F5H A;  5TIS E;  1EXI A;  4D6T G;  3H1I D;  1PFI A;  3HE4 A;  1PGJ A;  1SQX D;  1RIE A;  1SQV E;  2KB7 P;  4P1B H;  1PPJ E;  2I1J A;  3MP7 B;  2NUM A;  2FKW B;  1VF5 B;  5AVZ B;  4BXL A;  1NDO A;  3GW6 A;  2HG5 D;  3L73 D;  2XV5 A;  3A5T A;  3LIE A;  2R3S A;  2R5D A;  2OYH C;  3RK3 D;  3CX5 E;  4YPC A;  1LT9 A;  5AVU B;  1IK9 A;  2M5A B;  3M0D A;  2R5B A;  1SFC B;  4K35 A;  1VF5 C;  1LTJ C;  2HOD A;  4P1C H;  4L73 A;  3Q5P A;  1FZC B;  1N7S C;  1DEB A;  1ZXG A;  2XSO A;  5BOK A;  1M56 D;  1L0L E;  3L35 A;  1N73 C;  4AYC A;  3OA7 A;  2Y9Y A;  1TU3 F;  3L74 G;  1A02 F;  4OGQ C;  1GK6 A;  3TGU G;  2P58 A;  3CCU P;  4WY4 C;  4UB8 H;  3VMZ A;  1Y47 A;  2Q3I A;  2QJK B;  1VQ4 P;  3KHU A;  4PJ0 H;  2AEM A;  5CBO A;  4H0L B;  1S72 P;  4DZO A;  1BSH A;  1ULJ A;  2GBW A;  1NTK J;  1SFC C;  2B87 B;  3V5B A;  4NBA D;  4XA4 A;  2OAR A;  2JR8 A;  4NBG D;  4OWF A;  3KDP B;  1EXJ A;  2FYU J;  4EMJ B;  1EC5 A;  2D2C D;  2QJK C;  3GF3 A;  4HM1 A;  3CWB D;  2Q6Q A;  2WPV B;  1UUV A;  4D6T E;  3O6Q B;  4XE5 B;  1J1D B;  2QEX P;  1YIT P;  3MIW A;  3MD0 A;  1JNM A;  2ZAE B;  4TT3 H;  1SQV D;  3VTP C;  2O01 H;  4QDF A;  2HLO A;  3PTZ A;  2OQQ A;  4BRY B;  1L0N D;  1NU1 D;  3H1J E;  1VM9 A;  4YXD C;  4IFD K;  1Q7Y Q; 
#chains in the Genus database with same CATH homology
 2QJY C;  2DE6 D;  2FYU E;  2HMO A;  4NBD D;  3GZY A;  3H1K E;  2BMQ A;  1JM1 A;  4H44 D;  4P1C H;  5AEW A;  3GOB A;  5KLV E;  1O7P A;  4H0L D;  4AIV A;  1SQQ E;  3D89 A;  1KB9 E;  3VCP A;  5BOK A;  2XSO A;  2E76 D;  1L0L E;  3VMI D;  4HKV A;  4HM5 A;  3GKE A;  1G8J B;  3GL2 A;  3GTS A;  3C0D A;  3L72 E;  3H1L E;  1VCK A;  2GBX A;  1G8K B;  2B24 A;  4QUR A;  2NVE A;  2E74 D;  2BMO A;  2XRX A;  2DE5 D;  1WQL A;  1NYK A;  4NBC D;  2ZT9 D;  2GBW A;  1ULJ A;  1NTM E;  4HM6 A;  2BCC E;  2E4P A;  1SJG A;  2NWF A;  1UUW A;  1O7N A;  2E4Q A;  4HM7 A;  1SQX E;  3VMG D;  5HL4 A;  1BCC E;  2A06 E;  2YFI A;  1EG9 A;  2QJP C;  1O7G A;  5KLI C;  3TGU E;  3L75 E;  1RFS A;  3L70 E;  3CWB E;  3FOU A;  4NBA D;  4QUP A;  2IBZ E;  2B1X A;  1VF5 D;  2HMM A;  4H13 D;  4NB9 D;  5CXM A;  1FQT A;  1O7H A;  1SQP E;  1Q90 C;  2NVF A;  4NB8 D;  4NBF D;  4NBE D;  2HMK A;  4NBG D;  4QDD A;  4QDF B;  1P84 E;  2NVG A;  2YFL A;  3L73 E;  1O7M A;  4HM2 A;  5AEU A;  2NUK A;  2YFJ A;  3GL0 A;  3N0Q A;  3H1I E;  4HM8 A;  4EMJ B;  2D2C D;  2XSH A;  2QJK C;  1RIE A;  2HML A;  2YIU C;  3L71 E;  2JZA A;  1SQV E;  3GTE A;  4HJL A;  4NBB D;  3H1H E;  1ZRT E;  2I7F A;  4HM1 A;  4P1B H;  3VMH D;  1PPJ E;  3L74 E;  3BCC E;  3GZX A;  3GCE A;  2JO6 A;  1O7W A;  2NUM A;  2FYN C;  3VCA A;  4PV1 D;  1UUV A;  4HM3 A;  3GB4 A;  1BGY E;  4D6T E;  4QDC A;  1NDO A;  1BE3 E;  2E75 D;  3AZC A;  1ULI A;  1NTK E;  3CXH E;  4NBH D;  4QCK A;  5KKZ C;  4HM4 A;  2XR8 A;  3EN1 A;  3EQQ A;  4PD4 E;  2HMJ A;  2YVJ B;  4QDF A;  4QUQ A;  4U3F E;  1NTZ E;  2BMR A;  1KYO E;  2ZYL A;  2Q3W A;  1PP9 E;  2DE7 D;  2HMN A;  3H1J E;  1SQB E;  4OGQ D;  1EZV E;  3CX5 E;  1VM9 A;  4HM0 A;  2QPZ A;  3DQY A;  1L0N E;  4AAY B;  1NU1 E;  2CKF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...