1SQVE

Crystal structure analysis of bovine bc1 with uhdbt
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome c reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 39
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1sqvE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1sqvE02
3BCCE 1O7MA 2HMKA 4NBAD 3L74E 2HMJA 2NVGA 2YIUC 1P84E 2BCCE 2B1XA 4QDFB 4QUQA 2JO6A 2NVEA 4H0LD 4NB8D 3GTSA 4NBED 3GZYA 4HM5A 1NTKE 2ZT9D 3GL0A 1SQXE 5CXMA 1G8KB 3N0QA 4NBBD 2E4PA 2E75D 3CX5E 2E74D 1L0LE 2XRXA 4P1CH 2I7FA 3VMID 4AAYB 4HKVA 1FQTA 2BMOA 2E4QA 1WQLA 3CWBE 3FOUA 4AIVA 1RIEA 2NUKA 1Q90C 2B24A 1VCKA 3GL2A 3AZCA 1O7WA 3H1KE 2YFLA 1PPJE 2NVFA 3C0DA 4QCKA 2JZAA 1O7GA 5KLIC 2FYUE 1SQBE 2HMOA 4EMJB 2Q3WA 4NBFD 2NWFA 3EQQA 4HJLA 2IBZE 3GZXA 2DE7D 1KYOE 1SQVE 4NBDD 2E76D 4D6TE 3L72E 2D2CD 2QPZA 3GKEA 1VM9A 4HM7A 3GTEA 4OGQD 4HM3A 4P1BH 4HM4A 1SQQE 3TGUE 4HM8A 1ULJA 1EZVE 2CKFA 1O7NA 3GOBA 2FYNC 2ZYLA 4H44D 3EN1A 4QDDA 2XSOA 3DQYA 1O7HA 1KB9E 1NU1E 3L71E 5AEWA 3VCAA 2NUMA 3GCEA 1ZRTE 4HM6A 1RFSA 1G8JB 3VMGD 1NYKA 4H13D 1BCCE 4QUPA 3D89A 1O7PA 4NBGD 1UUWA 4PV1D 4QDCA 1NTME 4QDFA 1UUVA 2HMLA 2HMNA 5KLVE 1EG9A 2DE5D 4PD4E 1JM1A 4NBCD 3H1HE 1PP9E 5BOKA 2BMRA 2GBXA 2DE6D 2A06E 3H1LE 5AEUA 1ULIA 2YFIA 2YFJA 3H1IE 1L0NE 1NDOA 4HM2A 3GB4A 1SQPE 2QJPC 2QJKC 2XSHA 1BE3E 3L73E 4QURA 3L70E 4NB9D 1SJGA 4NBHD 2QJYC 3H1JE 3VMHD 3VCPA 1VF5D 2BMQA 2XR8A 4HM1A 2HMMA 1NTZE 3CXHE 3L75E 2YVJB 4U3FE 5KKZC 1BGYE 2GBWA 4HM0A 5HL4A
chains in the Genus database with same CATH superfamily
3BCCE 2M8RA 3L71D 2ZVNB 2CPSA 1SQQK 3CWBG 2B1XA 2XV5A 2O3JA 1PIXA 1LP1A 2M3EA 3B8EB 4HKZH 5CXMA 1KQGB 3VMYA 4PD4H 5AVSB 2W27A 2IFNA 2E74D 1YJNP 2BCCD 1IFJA 1ZXGA 5APXA 2WVRA 1K73Q 4W80A 5K5GB 4K35A 1UIIA 5AVUB 2HYNA 1BDDA 2KUBA 3EQQA 1PPJG 1LWUC 2P58A 1SQBG 2JWDA 2KNCA 1VQPP 1LWUA 2KZIA 1VL2A 2M3BA 4HM4A 3TGUE 1GL2C 1YHQP 1KFMA 1H89A 2OYIC 2WSSH 3N7NA 1GU4A 1W2BO 2P7JA 1FZCB 3H1IJ 3L4FA 2G8YA 2PP6A 4XA4A 3CCUP 4UB6H 2ZT9C 1EZVD 1HJBA 3VN0A 1NTZJ 3U59A 1BGYJ 2WMMA 5AVRB 2A06E 2K37A 1ZRTD 2AEMA 2GA1A 4AUWA 4HM2A 3RL0g 1JMBA 2IYOA 1KN7A 3NMDA 1HTLC 4PD4D 2Y0CA 3B5NB 1H88A 3KQGA 1P84I 2LXCB 3V6IA 1OXZA 3V2RA 4JPZB 2P67A 2JO6A 3VYIA 4NPFX 1H0TA 4GOEA 1NTKE 3KYQA 1URQD 4ZNCA 3C8VA 1NKZB 2BASA 3CX5E 2IPPA 4EIJA 3OW2O 1Q81Q 1NO4A 1NTMK 1KMIZ 3V4WA 4L76A 5KLIC 3UIAA 1KQSO 4WY4A 1LTTC 3CWBD 5GTHE 3LW5H 4W7ZA 2JO1A 3GKEA 5CCHD 4JQ0D 4HM3A 3RK2C 1LP1B 1E5WA 1KORA 3BASA 1KB9I 2Q6QA 2XSOA 2ZVOB 2KK7A 1L0NJ 3PRJA 4IL6H 3BATA 1BE3J 3MZWB 2O01H 3S9OA 5BU8B 1UUVA 2HMNA 4EOTA 3VMXA 2WITA 1PPJD 1NTMG 5AEUA 2ZFCA 3H1IE 1LWUB 4EI2A 1FOSF 3H6PA 3G9RA 4U7JA 1VF5D 2OYIB 2W6AA 4ASWA 1NTZE 1BGYE 2QM7A 3L35A 1K05A 1QL2A 4OGQC 4H0LB 2R3SA 1EXIA 5CCGD 2ZT9B 3HD7A 3JCUH 1IK9A 2J58A 3KZIE 2FYUG 4RJTA 1T3JA 1GK4A 4O9BA 4D6TJ 3FOUA 1G1IA 1DH3A 2YXQB 1HUCA 3TYYA 2O1JA 4EYYQ 1L0LD 3CI9A 2C0XA 3FWNA 1NKNA 1IO4A 2JEEA 5APTA 4OVNF 1LGHB 2W90A 3I56P 4YTPC 5APUA 2ZYLA 1AFOA 3IAOA 2WSFH 3AEDC 1PP9G 5BVZA 2L5GB 1CZQA 1R5LA 1JM0A 1SQPG 1K9MQ 1Q90D 5KLIB 1QL1A 5KAFH 2ZXXA 1L0NE 1NDOA 1T6AA 2CK3H 1M57D 1BE3E 1RQUA 1R8EA 1NH4A 5GTIE 1PFIA 3RK2B 3RL0B 3PTZA 4N78E 1SQXJ 2PRRA 2GBWA 1RF0A 1JTHA 1S5LE 2HMKA 3L37A 2W83C 1EDJA 3L74G 4HM5A 4WVZA 1NU1K 1PZQA 2Z5HA 2OTKE 2HPCA 3CX5I 4PJ0E 3A0HH 4H13C 4P1CH 1T3UA 1FQTA 1G1JA 5KLVK 5AVZB 1Q86Q 4WWIA 3L71J 2D2CB 1JY3P 2LXBA 4OGQB 5B66H 4D6TE 5KJ7C 4OH8B 3HD7B 1T2KC 3AE3C 3D6YA 1HGZA 5KJ7A 1ULJA 2FYUD 2MJZA 2GUVA 3GG2A 3NXSA 4N6JA 3VTPC 2Q9IA 1LNQA 2YXRB 1L2PA 1QX8A 5CBOA 4LGDE 4IL6X 3L70G 1L4AD 2GUSA 3HRNA 2E75C 5DJTB 3L75J 5BOKA 3WUUA 1Q2NA 5KLVG 3HE4A 5H2FH 3M9HA 3GB4A 2ZYAA 1LTIC 2QG4A 1FU1A 2QJYC 1YQ3C 1JY2N 2IFMA 2HLOA 1PP9D 3A0BE 3P7KA 1EC5A 1YTZT 1N7LA 1SQPD 2UWJE 4IFMA 1KV4A 3RK3D 4H44C 2NVEA 2E5TA 3Q5RA 1KZUB 2BCCG 4ZKUA 1SQXE 1JEKA 2HFED 2YMYA 1J1DC 1VF5C 5AW7B 2E4PA 2KSJA 2RH0A 3L72J 2E4QA 1GTWA 2NUKA 3AZCA 3AEBC 1FJKA 1VQ7P 1HWTC 2G3AA 1S9KD 1JY3N 4Z1MH 1JY2O 2IBZG 1WMKA 4I6MC 1OFCX 1N73C 2HPCB 1PGQA 5AVWB 1ZMEC 4WY4D 3W67A 3H1HJ 3TSIA 3L71E 3T97A 4H13B 1OW7A 2E42A 3L73J 3LIDA 1NYKA 1IFMA 2QRXA 1MUUA 5AW3B 1EG9A 2KXPB 3CD6P 1KILC 4KJMA 4CPGA 2OYOA 2KLVA 2O1KA 3CC7P 3B5NA 1J1EB 2AXCA 1FZBA 3L75E 1U7MA 3NFQA 1FAVA 2IZ1A 4HB1A 3L70D 1S4XA 1M8OB 1VPCA 2IYPA 1N86A 1X22A 3U1AA 2E75B 3PH0A 1SQBJ 4R4MA 1FDIA 3A2AA 4IFFA 2NPSD 4A7PA 4HKVA 1X79B 2KP8A 2AXTH 1SQQJ 2QJYB 1PV3A 4KT0J 3OA7A 3R2PA 2B9BA 1FJPA 3P8CE 2XDJA 2H8PD 2YO3A 3L72E 5APYA 3WU2E 3IFMA 4H44B 3H1KD 2QJPB 2RN0A 3LW5J 3M0AA 1K8AQ 4JYBA 2A06G 1NYHA 1J1DB 3E1RA 5AW8B 4AQRD 4QUPA 1YITP 2DE5D 3I55P 3H1HE 4TLFA 1GL2A 2OYIA 2IBZD 2B87A 3L73E 5EFWB 4NBHD 1N73B 3T97B 1HVVA 1LTSC 3H1JG 4BRYB 3KPEA 1OVVA 4HYTB 1O7MA 3CLQA 1DEEG 1FS0E 2NVGA 1W5CE 4L73A 2Q5UA 4N3YB 1RF1C 2H7HA 1KILB 4RKUJ 1RF1A 2YMKA 1JB0J 2H89C 1KC8Q 1L0LG 1HBWA 1N7SD 1PPJE 3RK3C 1SQBE 1NJIQ 4C46A 3NTNA 4B86A 1VQ5P 2E76D 2WSEH 2N1TC 1NTMJ 1SQQE 1SQVG 1EDKA 3V5BA 2FYNC 4HH2A 3SSUA 1FOSE 4QDDA 2OYHC 1SVFA 3RBXA 1JMMA 3MTUE 1YBKA 3H1IG 3P8MC 5CMZA 4XFJA 1EXJA 2WTYA 1ZP0C 2H88C 1K04A 4PV1D 1MFTA 1HJ0A 3AEFC 3D71A 2W6JH 4U3FJ 2RMZA 1BGYG 4ZMDA 3A3YB 2H43A 3HUSC 4RESB 1YQ4C 1VQKP 1D7MA 3AE9C 2I1JA 3A7OA 2Y9ZA 2FYUK 3II6A 2YKQA 4IL6E 1MKMA 2A06D 2HMMA 2POHA 1NHLA 1OW8A 5HL4A 1HF9A 1SFCC 3PLNA 4DOJA 1LTJC 1KILE 3VMZA 1FZFA 4ASVA 3GLMA 2XU6A 1LTJA 2R44A 1NAYA 2A45G 2XKMA 2QSIA 1IFPA 2Y9YA 5AW2B 3C9IA 4GT1A 1VQNP 1GL2B 2LR2A 4OWFA 3IR9A 1NGMB 2B87B 2B89A 1EZVI 5TJHA 3PJSK 1XTGB 3E7KA 2PFXA 1DIPA 1IC2A 1Y9BA 1NTKD 4DT0A 4WBAA 2N9BA 3EFFK 3H1JD 3AE8C 1O7GA 3FX0A 1SQPK 3JCUE 2JP3A 2DE7D 4LLHA 1QEXA 4NPEA 4PD4I 1VM9A 2HG5D 1RE3C 4XE5B 1RF1B 1RE3A 2I8DA 1KFNA 4ZKPA 3RGUA 2NUMA 3ABVC 1VQMP 1LTGC 1L0NG 2K88A 1IFDA 1M7LA 3F5HA 5L8RJ 1NTME 3V2QA 4YXDC 4DJGA 2A45H 2E74C 5KAIE 5DJUB 3S4RA 5CHXA 2M0BA 1ZW0A 1KD1Q 5E79E 3L74J 1RE4C 4I7ZC 1CSBA 2QJKC 3AE5C 1SQVD 1PGOA 1RE4A 3Q2YA 2N1TB 2KOGA 2ZXEB 2WWWA 2FYNB 2OYHB 4U3FE 2WT7A 4HM0A 3H1ID 2Q7CA 4C7RA 1S72P 3B5ND 1IZNB 3GMAA 1JNMA 2FYZA 2W6BA 3O6QB 3Q5SA 1FDOA 1NTZD 3MHVA 1BGYD 1KYOH 5AVTB 3N0QA 5AW0B 4JBZA 3HUSB 2WSCJ 1QVGO 1WT6A 1LTBC 1O7WA 1NU1J 2QM8A 3TDKA 2VRSA 3HTKA 1XTCC 1SFCB 1S5LH 1LTJB 3K5BA 3G6EP 2KYVA 1BDCA 3GTEA 1M1JC 4HM8A 2XNDH 1M1KQ 5KLVJ 3M0DC 3CCLP 3GOBA 5BU5A 1N7SC 4PJ0H 3WUTA 3RK3E 2ZYDA 3CXHH 1A02F 3EWKA 1URQC 2JJLA 4IOIH 2HMLA 2V7QH 3R4YA 2NRGA 5B66E 1BCCG 4NBCD 1FZEA 3Q3DA 2BMRA 1VQ9P 4R4LA 5KTBA 3SWYA 2QVAA 1KYOD 2BCCJ 4QURA 1VQ4P 1VQOP 3IN6A 2JKVA 3AE7C 1SQXG 1L0ND 5CCHC 1BE3D 3L74E 2XNXA 3SWFA 1Y47A 4H0LD 5H2FE 3TK1A 2ZT9D 1IFNA 2E74B 3GF7A 2NZ2A 3BRVB 3GHGC 2ZYGA 4I7ZB 2BMOA 5AVQB 3SFDC 2WPSA 4KHXA 5APSA 2L91A 2WT7B 5B5EH 2WQYC 3CXHD 3H1KG 1AVOA 1JOCA 3WUVA 1NVOA 5TISE 2FBWC 1DD4A 1O7NA 3DQYA 1O7HA 1NU1E 4UB8H 1Y8AA 2KSEA 5CCGC 4D6TD 3AE4C 1GU5A 1Z56A 1Q82Q 5CCGA 1RH5B 1YTZI 1OW6A 5KLVE 2FFDC 1AV1A 3HTKB 1P84H 3VOPA 3AEAC 1CW5A 1N73A 2FXPA 2K1AA 2KLUA 3H1LG 1RY3A 3B4SA 4GIFA 4BRYA 4NB9D 2SPZA 4K3AA 4C7NA 3CMEP 1JCCA 1FZCC 3RK2D 3RL0D 1HH0A 1YYCA 2WZ7A 1LT9C 4NBAD 3P32A 1KILA 3CWBJ 3QH9A 4GOFA 1OX3A 1LT9A 3BCCG 2BCCE 1QGKB 4QUQA 4NB8D 4L75A 1URQB 3CCEP 4NBED 1BCCD 1YI2P 3GL0A 1S3JA 3RBZA 1G8KB 2FKWB 2FXMA 1DX7A 1GW3A 2K3RA 4EDFA 2XZRA 1EDIA 3L72G 4AIVA 1RIEA 1KB9H 1Q90C 1JY3O 1RHZB 1SQXD 4L74A 3W68A 3H25A 4GKGA 4NBFD 4Y99C 2E5YA 2IBZE 2P1JA 4NBDD 3KXDA 2D2CD 3OAKA 1S5LX 2K9YA 3FWLA 1OVRA 4HM7A 4OGQD 3M9QA 1P84D 2RKLA 1X0TA 1EZVE 3HD7D 2CKFA 2WSEJ 1FBMA 3GF3A 5AVVB 2YKOA 3TGUG 3AE2C 3C1LA 2HR3A 3VP9A 1ZRTE 4HM6A 1NWQA 2KI7B 3GHGB 1BSNA 3MGNA 1O7PA 1NTKK 2HODB 3H1JJ 1UUWA 2P2UA 4PD4E 2JR8A 1N8RQ 2XSHA 1FE6A 1VF5B 2Q3EA 3AECC 3WU2H 3D6ZA 3EFGA 4M3LA 3CCMP 2V4HA 2KS1A 1JUNA 4RO0A 1KB9D 1L0LJ 3AEGC 2O01J 1L0LK 2W8ZA 1KTMA 3JSVC 3M06A 3GZYA 2R3CA 4Y28J 4YPCA 3L75D 2FFDB 3U1CA 1NOHA 2YKPA 3B71A 2KB7P 1NTKG 4GODA 2BEQD 2QEXP 2C9LY 4UB6E 1L4AC 3H1LD 1SQVJ 3N4XA 1SQVK 1WQLA 3CWBE 4C7NB 1L4AA 2B24A 3PP5A 1VCKA 1SQQG 2QE7H 4QCKA 4H0LC 5AVXB 3BCCD 1LT9B 3A5TA 3CCVP 1AJYA 3H32B 4P1BH 2JWAA 1NTZK 1SS1A 3P8CD 1CI6A 2M5AB 1OIPA 3L72D 1BSHA 4H13D 2J59M 1KQLA 5AW4B 3EQ2A 1J2JB 3O8ZA 2DE6D 1OWAA 1TU3F 4Y99B 2N1TA 1QVFO 1E79H 3JC22 1PGJA 2OYHA 2PGDA 1AQ5A 3H1JE 3VMHD 3VCPA 2WSFJ 3CX5H 5KJ7D 4NPDA 3H1HD 2Q3IA 3TGUD 1T2KD 4HM1A 3O6QA 5KKZC 3L36A 5APVA 3USSA 1NTZG 3L73D 3TNUA 3CL3D 2HMJA 2YIUC 3HE5B 2IDBA 1GD2E 4IFDK 4WY4C 1X8YA 3HUSA 5GTHH 1RQVA 2FYUJ 1A02J 2E75D 2XRXA 1L0LE 3RL0C 1ZN5A 2KS1B 2BEZF 2YFLA 3FXDA 1SFCA 2OTLP 1L0NK 3AE6C 3VP8A 2IBZI 4WB4A 1MV8A 3CCQP 3CCJP 1JCDA 1SQVE 2WPQA 3CCSP 5C39A 1HGVA 1S1CX 1IK7A 1SQBD 5AW9B 4H44D 2KNCB 1PP9J 4I2LC 4TT3H 1L4AB 1SQPJ 3CX5D 2R5DA 1SQQD 5CBNA 1VQ8P 1AVYA 4QDCA 4QDFA 2D2CC 3G3ZA 4AYCA 1JM1A 2NPSC 3M9BA 5AW6B 4U3FG 2NPSA 3HD7C 2V7QJ 2YFJA 1T8ZA 3QWOC 1G2CA 3WMM0 1M90Q 2OQQA 4LC1A 3KZIH 3BRTB 2E43A 1YJWP 1CI6B 1GMJA 2C9NY 2OTJP 1BE3G 2QIWA 1Q7YQ 4DCKA 1LJ2A 2Z5IA 4QMAA 2I1KA 3CPWO 4W7YA 2DW3A 3RK3B 1OZHA 1FC2C 1VQ6P 5AW1B 2ZAEB 3CC4P 2O01N 3GW6A 1IJDB 1EQ7A 2Y0DA 2Y0EA 1ZOYC 1X9VA 2K9JA 5KAIH 4NBBD 1KILD 1FDMA 3SFEC 1H0TB 2FXOA 1IFIA 1VQLP 5E79H 3GL2A 3ITKA 3KHUA 5KAFE 3Q1MA 2NVFA 2FYUE 2HMOA 5KKZB 3TNUB 2NWFA 3M91A 2WPRA 1H8AA 3CCRP 1MZ9A 1KYOE 3BVHA 1DEBA 1EDLA 2YIUB 1BCCJ 2QPZA 1AA0A 1LT1A 4WY4B 3F89A 2FY8A 2YNYA 4D6TG 3V2PA 1W2EA 1ZV8A 3MIWA 4I1LA 1OMIA 1GZLA 4BXLA 5AEWA 1JY2P 5GTIH 1G8JB 1RF0C 3VMGD 3L70J 3V4QA 4NBGD 2IZ0A 1SQXK 3D70A 3A0HE 3S1KA 1PP9E 4JF7A 1ULIA 1M1JA 3M0DA 3I5CA 1SQPE 1U7JA 1NTMD 4JYCA 1SJGA 1ZR2A 2OARA 1N7SA 1PGPA 3AE1C 2BMQA 1ZLLA 3CXHE 2YVJB 2E76C 1QLED 1GW4A 1URQA 3IF4A 3MUDC 2AEJA 3ZDMA 5CJ4A 3MUDA 4QDFB 1OVUA 5APQA 3GTSA 3H1KJ 4U3FD 2NPSB 1G2CB 3TF5A 1J1EC 4PV1C 3VMID 4AAYB 1GL2D 1SP4A 2YO2A 1GDTA 1S9KE 1PL5A 5CCHA 3C0DA 2JZAA 4N78D 3MD0A 1FZGA 4HJGH 1NU1G 1SLQA 2PAJA 1LTAC 3GZXA 3FXEA 1WRGA 4GDOA 2QJKB 5M1BA 1GK6A 2ITAA 2K9JB 3EN1A 3GHGA 1MFZA 3H1LJ 2HODA 2J5UA 2R5BA 1R5SA 5B5EE 3A0BH 2LKMA 3L71G 1FZAA 1BCCE 3FGAD 3D89A 1KQFB 2N9YB 2MKVA 2GBXA 3BCCJ 2YFIA 1DD3A 2QJPC 3AEEC 3L70E 4UB8E 4DZOA 2WSCH 5TISH 2OGUA 2R32A 2N1TD 3CMAP 3KDPB 3G4SP 1VDFA 2A45I 2Z4EA 2C0WA 2FFDA 3L75G 2QA4P 1USDA 3VMAA 1P84E 1NAFA 1JTHB 1S2EA 1JO5A 2Q1KA 2WPVB 5AW5B 1M1JB 3L74D 2I7FA 3OJAB 1FZCA 5CJ0A 1N7SB 2AEFA 3TGUJ 2KZJA 2CPBA 3H1KE 1EZVG 3LIEA 4EMJB 2E76B 2Q3WA 3V2NA 3H32A 1KYOI 4HJLA 1M56D 2JDIH 4YXWH 5APWA 2M5AA 1N2DC 1SFCD 3B5NC 2KIKA 4MN4C 1KB9E 3G71P 3VCAA 1UIXA 5AVYB 2GM4A 3GCEA 4PV1B 1USEA 1RFSA 2ZJSE 2IX7C 3PHLA 1U57A 1NU1D 3E1IA 1YIJP 3H1LE 3MP7B 3SWKA 3H1HG 2B88A 4BWNA 2AXTE 1YJ9P 5KLVD 1ZR4A 3Q5PA 3HE4B 1SQBK 1NTKJ 3CXHI 3L73G 2P10A 3CC2P 2XR8A 1AQTA 3HE5A
chains in the Genus database with same CATH topology
3BCCE 1O7MA 2HMKA 4NBAD 3L74E 2HMJA 2NVGA 2YIUC 1P84E 2BCCE 2B1XA 4QDFB 4QUQA 2JO6A 2NVEA 4H0LD 4NB8D 3GTSA 4NBED 3GZYA 4HM5A 1NTKE 2ZT9D 3GL0A 1SQXE 5CXMA 1G8KB 3N0QA 4NBBD 2E4PA 2E75D 3CX5E 2E74D 1L0LE 2XRXA 4P1CH 2I7FA 3VMID 4AAYB 4HKVA 1FQTA 2BMOA 2E4QA 1WQLA 3CWBE 3FOUA 4AIVA 1RIEA 2NUKA 1Q90C 2B24A 1VCKA 3GL2A 3AZCA 1O7WA 3H1KE 2YFLA 1PPJE 2NVFA 3C0DA 4QCKA 2JZAA 1O7GA 5KLIC 2FYUE 1SQBE 2HMOA 4EMJB 2Q3WA 4NBFD 2NWFA 3EQQA 4HJLA 2IBZE 3GZXA 2DE7D 1KYOE 1SQVE 4NBDD 2E76D 4D6TE 3L72E 2D2CD 2QPZA 3GKEA 1VM9A 4HM7A 3GTEA 4OGQD 4HM3A 4P1BH 4HM4A 1SQQE 3TGUE 4HM8A 1ULJA 1EZVE 2CKFA 1O7NA 3GOBA 2FYNC 2ZYLA 4H44D 3EN1A 4QDDA 2XSOA 3DQYA 1O7HA 1KB9E 1NU1E 3L71E 5AEWA 3VCAA 2NUMA 3GCEA 1ZRTE 4HM6A 1RFSA 1G8JB 3VMGD 1NYKA 4H13D 1BCCE 4QUPA 3D89A 1O7PA 4NBGD 1UUWA 4PV1D 4QDCA 1NTME 4QDFA 1UUVA 2HMLA 2HMNA 5KLVE 1EG9A 2DE5D 4PD4E 1JM1A 4NBCD 3H1HE 1PP9E 5BOKA 2BMRA 2GBXA 2DE6D 2A06E 3H1LE 5AEUA 1ULIA 2YFIA 2YFJA 3H1IE 1L0NE 1NDOA 4HM2A 3GB4A 1SQPE 2QJPC 2QJKC 2XSHA 1BE3E 3L73E 4QURA 3L70E 4NB9D 1SJGA 4NBHD 2QJYC 3H1JE 3VMHD 3VCPA 1VF5D 2BMQA 2XR8A 4HM1A 2HMMA 1NTZE 3CXHE 3L75E 2YVJB 4U3FE 5KKZC 1BGYE 2GBWA 4HM0A 5HL4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BCC E;  1O7M A;  2HMK A;  4NBA D;  3L74 E;  2HMJ A;  2NVG A;  2YIU C;  1P84 E;  2BCC E;  2B1X A;  4QDF B;  4QUQ A;  2JO6 A;  2NVE A;  4H0L D;  4NB8 D;  3GTS A;  4NBE D;  3GZY A;  4HM5 A;  1NTK E;  2ZT9 D;  3GL0 A;  1SQX E;  5CXM A;  1G8K B;  3N0Q A;  4NBB D;  2E4P A;  2E75 D;  3CX5 E;  2E74 D;  1L0L E;  2XRX A;  4P1C H;  2I7F A;  3VMI D;  4AAY B;  4HKV A;  1FQT A;  2BMO A;  2E4Q A;  1WQL A;  3CWB E;  3FOU A;  4AIV A;  1RIE A;  2NUK A;  1Q90 C;  2B24 A;  1VCK A;  3GL2 A;  3AZC A;  1O7W A;  3H1K E;  2YFL A;  1PPJ E;  2NVF A;  3C0D A;  4QCK A;  2JZA A;  1O7G A;  5KLI C;  2FYU E;  1SQB E;  2HMO A;  4EMJ B;  2Q3W A;  4NBF D;  2NWF A;  3EQQ A;  4HJL A;  2IBZ E;  3GZX A;  2DE7 D;  1KYO E;  1SQV E;  4NBD D;  2E76 D;  4D6T E;  3L72 E;  2D2C D;  2QPZ A;  3GKE A;  1VM9 A;  4HM7 A;  3GTE A;  4OGQ D;  4HM3 A;  4P1B H;  4HM4 A;  1SQQ E;  3TGU E;  4HM8 A;  1ULJ A;  1EZV E;  2CKF A;  1O7N A;  3GOB A;  2FYN C;  2ZYL A;  4H44 D;  3EN1 A;  4QDD A;  2XSO A;  3DQY A;  1O7H A;  1KB9 E;  1NU1 E;  3L71 E;  5AEW A;  3VCA A;  2NUM A;  3GCE A;  1ZRT E;  4HM6 A;  1RFS A;  1G8J B;  3VMG D;  1NYK A;  4H13 D;  1BCC E;  4QUP A;  3D89 A;  1O7P A;  4NBG D;  1UUW A;  4PV1 D;  4QDC A;  1NTM E;  4QDF A;  1UUV A;  2HML A;  2HMN A;  5KLV E;  1EG9 A;  2DE5 D;  4PD4 E;  1JM1 A;  4NBC D;  3H1H E;  1PP9 E;  5BOK A;  2BMR A;  2GBX A;  2DE6 D;  2A06 E;  3H1L E;  5AEU A;  1ULI A;  2YFI A;  2YFJ A;  3H1I E;  1L0N E;  1NDO A;  4HM2 A;  3GB4 A;  1SQP E;  2QJP C;  2QJK C;  2XSH A;  1BE3 E;  3L73 E;  4QUR A;  3L70 E;  4NB9 D;  1SJG A;  4NBH D;  2QJY C;  3H1J E;  3VMH D;  3VCP A;  1VF5 D;  2BMQ A;  2XR8 A;  4HM1 A;  2HMM A;  1NTZ E;  3CXH E;  3L75 E;  2YVJ B;  4U3F E;  5KKZ C;  1BGY E;  2GBW A;  4HM0 A;  5HL4 A; 
#chains in the Genus database with same CATH topology
 3BCC E;  2M8R A;  3L71 D;  2ZVN B;  2CPS A;  1SQQ K;  3CWB G;  2B1X A;  2XV5 A;  2O3J A;  1PIX A;  1LP1 A;  2M3E A;  3B8E B;  4HKZ H;  5CXM A;  1KQG B;  3VMY A;  4PD4 H;  5AVS B;  2W27 A;  2IFN A;  2E74 D;  1YJN P;  2BCC D;  1IFJ A;  1ZXG A;  5APX A;  2WVR A;  1K73 Q;  4W80 A;  5K5G B;  4K35 A;  1UII A;  5AVU B;  2HYN A;  1BDD A;  2KUB A;  3EQQ A;  1PPJ G;  1LWU C;  2P58 A;  1SQB G;  2JWD A;  2KNC A;  1VQP P;  1LWU A;  2KZI A;  1VL2 A;  2M3B A;  4HM4 A;  3TGU E;  1GL2 C;  1YHQ P;  1KFM A;  1H89 A;  2OYI C;  2WSS H;  3N7N A;  1GU4 A;  1W2B O;  2P7J A;  1FZC B;  3H1I J;  3L4F A;  2G8Y A;  2PP6 A;  4XA4 A;  3CCU P;  4UB6 H;  2ZT9 C;  1EZV D;  1HJB A;  3VN0 A;  1NTZ J;  3U59 A;  1BGY J;  2WMM A;  5AVR B;  2A06 E;  2K37 A;  1ZRT D;  2AEM A;  2GA1 A;  4AUW A;  4HM2 A;  3RL0 g;  1JMB A;  2IYO A;  1KN7 A;  3NMD A;  1HTL C;  4PD4 D;  2Y0C A;  3B5N B;  1H88 A;  3KQG A;  1P84 I;  2LXC B;  3V6I A;  1OXZ A;  3V2R A;  4JPZ B;  2P67 A;  2JO6 A;  3VYI A;  4NPF X;  1H0T A;  4GOE A;  1NTK E;  3KYQ A;  1URQ D;  4ZNC A;  3C8V A;  1NKZ B;  2BAS A;  3CX5 E;  2IPP A;  4EIJ A;  3OW2 O;  1Q81 Q;  1NO4 A;  1NTM K;  1KMI Z;  3V4W A;  4L76 A;  5KLI C;  3UIA A;  1KQS O;  4WY4 A;  1LTT C;  3CWB D;  5GTH E;  3LW5 H;  4W7Z A;  2JO1 A;  3GKE A;  5CCH D;  4JQ0 D;  4HM3 A;  3RK2 C;  1LP1 B;  1E5W A;  1KOR A;  3BAS A;  1KB9 I;  2Q6Q A;  2XSO A;  2ZVO B;  2KK7 A;  1L0N J;  3PRJ A;  4IL6 H;  3BAT A;  1BE3 J;  3MZW B;  2O01 H;  3S9O A;  5BU8 B;  1UUV A;  2HMN A;  4EOT A;  3VMX A;  2WIT A;  1PPJ D;  1NTM G;  5AEU A;  2ZFC A;  3H1I E;  1LWU B;  4EI2 A;  1FOS F;  3H6P A;  3G9R A;  4U7J A;  1VF5 D;  2OYI B;  2W6A A;  4ASW A;  1NTZ E;  1BGY E;  2QM7 A;  3L35 A;  1K05 A;  1QL2 A;  4OGQ C;  4H0L B;  2R3S A;  1EXI A;  5CCG D;  2ZT9 B;  3HD7 A;  3JCU H;  1IK9 A;  2J58 A;  3KZI E;  2FYU G;  4RJT A;  1T3J A;  1GK4 A;  4O9B A;  4D6T J;  3FOU A;  1G1I A;  1DH3 A;  2YXQ B;  1HUC A;  3TYY A;  2O1J A;  4EYY Q;  1L0L D;  3CI9 A;  2C0X A;  3FWN A;  1NKN A;  1IO4 A;  2JEE A;  5APT A;  4OVN F;  1LGH B;  2W90 A;  3I56 P;  4YTP C;  5APU A;  2ZYL A;  1AFO A;  3IAO A;  2WSF H;  3AED C;  1PP9 G;  5BVZ A;  2L5G B;  1CZQ A;  1R5L A;  1JM0 A;  1SQP G;  1K9M Q;  1Q90 D;  5KLI B;  1QL1 A;  5KAF H;  2ZXX A;  1L0N E;  1NDO A;  1T6A A;  2CK3 H;  1M57 D;  1BE3 E;  1RQU A;  1R8E A;  1NH4 A;  5GTI E;  1PFI A;  3RK2 B;  3RL0 B;  3PTZ A;  4N78 E;  1SQX J;  2PRR A;  2GBW A;  1RF0 A;  1JTH A;  1S5L E;  2HMK A;  3L37 A;  2W83 C;  1EDJ A;  3L74 G;  4HM5 A;  4WVZ A;  1NU1 K;  1PZQ A;  2Z5H A;  2OTK E;  2HPC A;  3CX5 I;  4PJ0 E;  3A0H H;  4H13 C;  4P1C H;  1T3U A;  1FQT A;  1G1J A;  5KLV K;  5AVZ B;  1Q86 Q;  4WWI A;  3L71 J;  2D2C B;  1JY3 P;  2LXB A;  4OGQ B;  5B66 H;  4D6T E;  5KJ7 C;  4OH8 B;  3HD7 B;  1T2K C;  3AE3 C;  3D6Y A;  1HGZ A;  5KJ7 A;  1ULJ A;  2FYU D;  2MJZ A;  2GUV A;  3GG2 A;  3NXS A;  4N6J A;  3VTP C;  2Q9I A;  1LNQ A;  2YXR B;  1L2P A;  1QX8 A;  5CBO A;  4LGD E;  4IL6 X;  3L70 G;  1L4A D;  2GUS A;  3HRN A;  2E75 C;  5DJT B;  3L75 J;  5BOK A;  3WUU A;  1Q2N A;  5KLV G;  3HE4 A;  5H2F H;  3M9H A;  3GB4 A;  2ZYA A;  1LTI C;  2QG4 A;  1FU1 A;  2QJY C;  1YQ3 C;  1JY2 N;  2IFM A;  2HLO A;  1PP9 D;  3A0B E;  3P7K A;  1EC5 A;  1YTZ T;  1N7L A;  1SQP D;  2UWJ E;  4IFM A;  1KV4 A;  3RK3 D;  4H44 C;  2NVE A;  2E5T A;  3Q5R A;  1KZU B;  2BCC G;  4ZKU A;  1SQX E;  1JEK A;  2HFE D;  2YMY A;  1J1D C;  1VF5 C;  5AW7 B;  2E4P A;  2KSJ A;  2RH0 A;  3L72 J;  2E4Q A;  1GTW A;  2NUK A;  3AZC A;  3AEB C;  1FJK A;  1VQ7 P;  1HWT C;  2G3A A;  1S9K D;  1JY3 N;  4Z1M H;  1JY2 O;  2IBZ G;  1WMK A;  4I6M C;  1OFC X;  1N73 C;  2HPC B;  1PGQ A;  5AVW B;  1ZME C;  4WY4 D;  3W67 A;  3H1H J;  3TSI A;  3L71 E;  3T97 A;  4H13 B;  1OW7 A;  2E42 A;  3L73 J;  3LID A;  1NYK A;  1IFM A;  2QRX A;  1MUU A;  5AW3 B;  1EG9 A;  2KXP B;  3CD6 P;  1KIL C;  4KJM A;  4CPG A;  2OYO A;  2KLV A;  2O1K A;  3CC7 P;  3B5N A;  1J1E B;  2AXC A;  1FZB A;  3L75 E;  1U7M A;  3NFQ A;  1FAV A;  2IZ1 A;  4HB1 A;  3L70 D;  1S4X A;  1M8O B;  1VPC A;  2IYP A;  1N86 A;  1X22 A;  3U1A A;  2E75 B;  3PH0 A;  1SQB J;  4R4M A;  1FDI A;  3A2A A;  4IFF A;  2NPS D;  4A7P A;  4HKV A;  1X79 B;  2KP8 A;  2AXT H;  1SQQ J;  2QJY B;  1PV3 A;  4KT0 J;  3OA7 A;  3R2P A;  2B9B A;  1FJP A;  3P8C E;  2XDJ A;  2H8P D;  2YO3 A;  3L72 E;  5APY A;  3WU2 E;  3IFM A;  4H44 B;  3H1K D;  2QJP B;  2RN0 A;  3LW5 J;  3M0A A;  1K8A Q;  4JYB A;  2A06 G;  1NYH A;  1J1D B;  3E1R A;  5AW8 B;  4AQR D;  4QUP A;  1YIT P;  2DE5 D;  3I55 P;  3H1H E;  4TLF A;  1GL2 A;  2OYI A;  2IBZ D;  2B87 A;  3L73 E;  5EFW B;  4NBH D;  1N73 B;  3T97 B;  1HVV A;  1LTS C;  3H1J G;  4BRY B;  3KPE A;  1OVV A;  4HYT B;  1O7M A;  3CLQ A;  1DEE G;  1FS0 E;  2NVG A;  1W5C E;  4L73 A;  2Q5U A;  4N3Y B;  1RF1 C;  2H7H A;  1KIL B;  4RKU J;  1RF1 A;  2YMK A;  1JB0 J;  2H89 C;  1KC8 Q;  1L0L G;  1HBW A;  1N7S D;  1PPJ E;  3RK3 C;  1SQB E;  1NJI Q;  4C46 A;  3NTN A;  4B86 A;  1VQ5 P;  2E76 D;  2WSE H;  2N1T C;  1NTM J;  1SQQ E;  1SQV G;  1EDK A;  3V5B A;  2FYN C;  4HH2 A;  3SSU A;  1FOS E;  4QDD A;  2OYH C;  1SVF A;  3RBX A;  1JMM A;  3MTU E;  1YBK A;  3H1I G;  3P8M C;  5CMZ A;  4XFJ A;  1EXJ A;  2WTY A;  1ZP0 C;  2H88 C;  1K04 A;  4PV1 D;  1MFT A;  1HJ0 A;  3AEF C;  3D71 A;  2W6J H;  4U3F J;  2RMZ A;  1BGY G;  4ZMD A;  3A3Y B;  2H43 A;  3HUS C;  4RES B;  1YQ4 C;  1VQK P;  1D7M A;  3AE9 C;  2I1J A;  3A7O A;  2Y9Z A;  2FYU K;  3II6 A;  2YKQ A;  4IL6 E;  1MKM A;  2A06 D;  2HMM A;  2POH A;  1NHL A;  1OW8 A;  5HL4 A;  1HF9 A;  1SFC C;  3PLN A;  4DOJ A;  1LTJ C;  1KIL E;  3VMZ A;  1FZF A;  4ASV A;  3GLM A;  2XU6 A;  1LTJ A;  2R44 A;  1NAY A;  2A45 G;  2XKM A;  2QSI A;  1IFP A;  2Y9Y A;  5AW2 B;  3C9I A;  4GT1 A;  1VQN P;  1GL2 B;  2LR2 A;  4OWF A;  3IR9 A;  1NGM B;  2B87 B;  2B89 A;  1EZV I;  5TJH A;  3PJS K;  1XTG B;  3E7K A;  2PFX A;  1DIP A;  1IC2 A;  1Y9B A;  1NTK D;  4DT0 A;  4WBA A;  2N9B A;  3EFF K;  3H1J D;  3AE8 C;  1O7G A;  3FX0 A;  1SQP K;  3JCU E;  2JP3 A;  2DE7 D;  4LLH A;  1QEX A;  4NPE A;  4PD4 I;  1VM9 A;  2HG5 D;  1RE3 C;  4XE5 B;  1RF1 B;  1RE3 A;  2I8D A;  1KFN A;  4ZKP A;  3RGU A;  2NUM A;  3ABV C;  1VQM P;  1LTG C;  1L0N G;  2K88 A;  1IFD A;  1M7L A;  3F5H A;  5L8R J;  1NTM E;  3V2Q A;  4YXD C;  4DJG A;  2A45 H;  2E74 C;  5KAI E;  5DJU B;  3S4R A;  5CHX A;  2M0B A;  1ZW0 A;  1KD1 Q;  5E79 E;  3L74 J;  1RE4 C;  4I7Z C;  1CSB A;  2QJK C;  3AE5 C;  1SQV D;  1PGO A;  1RE4 A;  3Q2Y A;  2N1T B;  2KOG A;  2ZXE B;  2WWW A;  2FYN B;  2OYH B;  4U3F E;  2WT7 A;  4HM0 A;  3H1I D;  2Q7C A;  4C7R A;  1S72 P;  3B5N D;  1IZN B;  3GMA A;  1JNM A;  2FYZ A;  2W6B A;  3O6Q B;  3Q5S A;  1FDO A;  1NTZ D;  3MHV A;  1BGY D;  1KYO H;  5AVT B;  3N0Q A;  5AW0 B;  4JBZ A;  3HUS B;  2WSC J;  1QVG O;  1WT6 A;  1LTB C;  1O7W A;  1NU1 J;  2QM8 A;  3TDK A;  2VRS A;  3HTK A;  1XTC C;  1SFC B;  1S5L H;  1LTJ B;  3K5B A;  3G6E P;  2KYV A;  1BDC A;  3GTE A;  1M1J C;  4HM8 A;  2XND H;  1M1K Q;  5KLV J;  3M0D C;  3CCL P;  3GOB A;  5BU5 A;  1N7S C;  4PJ0 H;  3WUT A;  3RK3 E;  2ZYD A;  3CXH H;  1A02 F;  3EWK A;  1URQ C;  2JJL A;  4IOI H;  2HML A;  2V7Q H;  3R4Y A;  2NRG A;  5B66 E;  1BCC G;  4NBC D;  1FZE A;  3Q3D A;  2BMR A;  1VQ9 P;  4R4L A;  5KTB A;  3SWY A;  2QVA A;  1KYO D;  2BCC J;  4QUR A;  1VQ4 P;  1VQO P;  3IN6 A;  2JKV A;  3AE7 C;  1SQX G;  1L0N D;  5CCH C;  1BE3 D;  3L74 E;  2XNX A;  3SWF A;  1Y47 A;  4H0L D;  5H2F E;  3TK1 A;  2ZT9 D;  1IFN A;  2E74 B;  3GF7 A;  2NZ2 A;  3BRV B;  3GHG C;  2ZYG A;  4I7Z B;  2BMO A;  5AVQ B;  3SFD C;  2WPS A;  4KHX A;  5APS A;  2L91 A;  2WT7 B;  5B5E H;  2WQY C;  3CXH D;  3H1K G;  1AVO A;  1JOC A;  3WUV A;  1NVO A;  5TIS E;  2FBW C;  1DD4 A;  1O7N A;  3DQY A;  1O7H A;  1NU1 E;  4UB8 H;  1Y8A A;  2KSE A;  5CCG C;  4D6T D;  3AE4 C;  1GU5 A;  1Z56 A;  1Q82 Q;  5CCG A;  1RH5 B;  1YTZ I;  1OW6 A;  5KLV E;  2FFD C;  1AV1 A;  3HTK B;  1P84 H;  3VOP A;  3AEA C;  1CW5 A;  1N73 A;  2FXP A;  2K1A A;  2KLU A;  3H1L G;  1RY3 A;  3B4S A;  4GIF A;  4BRY A;  4NB9 D;  2SPZ A;  4K3A A;  4C7N A;  3CME P;  1JCC A;  1FZC C;  3RK2 D;  3RL0 D;  1HH0 A;  1YYC A;  2WZ7 A;  1LT9 C;  4NBA D;  3P32 A;  1KIL A;  3CWB J;  3QH9 A;  4GOF A;  1OX3 A;  1LT9 A;  3BCC G;  2BCC E;  1QGK B;  4QUQ A;  4NB8 D;  4L75 A;  1URQ B;  3CCE P;  4NBE D;  1BCC D;  1YI2 P;  3GL0 A;  1S3J A;  3RBZ A;  1G8K B;  2FKW B;  2FXM A;  1DX7 A;  1GW3 A;  2K3R A;  4EDF A;  2XZR A;  1EDI A;  3L72 G;  4AIV A;  1RIE A;  1KB9 H;  1Q90 C;  1JY3 O;  1RHZ B;  1SQX D;  4L74 A;  3W68 A;  3H25 A;  4GKG A;  4NBF D;  4Y99 C;  2E5Y A;  2IBZ E;  2P1J A;  4NBD D;  3KXD A;  2D2C D;  3OAK A;  1S5L X;  2K9Y A;  3FWL A;  1OVR A;  4HM7 A;  4OGQ D;  3M9Q A;  1P84 D;  2RKL A;  1X0T A;  1EZV E;  3HD7 D;  2CKF A;  2WSE J;  1FBM A;  3GF3 A;  5AVV B;  2YKO A;  3TGU G;  3AE2 C;  3C1L A;  2HR3 A;  3VP9 A;  1ZRT E;  4HM6 A;  1NWQ A;  2KI7 B;  3GHG B;  1BSN A;  3MGN A;  1O7P A;  1NTK K;  2HOD B;  3H1J J;  1UUW A;  2P2U A;  4PD4 E;  2JR8 A;  1N8R Q;  2XSH A;  1FE6 A;  1VF5 B;  2Q3E A;  3AEC C;  3WU2 H;  3D6Z A;  3EFG A;  4M3L A;  3CCM P;  2V4H A;  2KS1 A;  1JUN A;  4RO0 A;  1KB9 D;  1L0L J;  3AEG C;  2O01 J;  1L0L K;  2W8Z A;  1KTM A;  3JSV C;  3M06 A;  3GZY A;  2R3C A;  4Y28 J;  4YPC A;  3L75 D;  2FFD B;  3U1C A;  1NOH A;  2YKP A;  3B71 A;  2KB7 P;  1NTK G;  4GOD A;  2BEQ D;  2QEX P;  2C9L Y;  4UB6 E;  1L4A C;  3H1L D;  1SQV J;  3N4X A;  1SQV K;  1WQL A;  3CWB E;  4C7N B;  1L4A A;  2B24 A;  3PP5 A;  1VCK A;  1SQQ G;  2QE7 H;  4QCK A;  4H0L C;  5AVX B;  3BCC D;  1LT9 B;  3A5T A;  3CCV P;  1AJY A;  3H32 B;  4P1B H;  2JWA A;  1NTZ K;  1SS1 A;  3P8C D;  1CI6 A;  2M5A B;  1OIP A;  3L72 D;  1BSH A;  4H13 D;  2J59 M;  1KQL A;  5AW4 B;  3EQ2 A;  1J2J B;  3O8Z A;  2DE6 D;  1OWA A;  1TU3 F;  4Y99 B;  2N1T A;  1QVF O;  1E79 H;  3JC2 2;  1PGJ A;  2OYH A;  2PGD A;  1AQ5 A;  3H1J E;  3VMH D;  3VCP A;  2WSF J;  3CX5 H;  5KJ7 D;  4NPD A;  3H1H D;  2Q3I A;  3TGU D;  1T2K D;  4HM1 A;  3O6Q A;  5KKZ C;  3L36 A;  5APV A;  3USS A;  1NTZ G;  3L73 D;  3TNU A;  3CL3 D;  2HMJ A;  2YIU C;  3HE5 B;  2IDB A;  1GD2 E;  4IFD K;  4WY4 C;  1X8Y A;  3HUS A;  5GTH H;  1RQV A;  2FYU J;  1A02 J;  2E75 D;  2XRX A;  1L0L E;  3RL0 C;  1ZN5 A;  2KS1 B;  2BEZ F;  2YFL A;  3FXD A;  1SFC A;  2OTL P;  1L0N K;  3AE6 C;  3VP8 A;  2IBZ I;  4WB4 A;  1MV8 A;  3CCQ P;  3CCJ P;  1JCD A;  1SQV E;  2WPQ A;  3CCS P;  5C39 A;  1HGV A;  1S1C X;  1IK7 A;  1SQB D;  5AW9 B;  4H44 D;  2KNC B;  1PP9 J;  4I2L C;  4TT3 H;  1L4A B;  1SQP J;  3CX5 D;  2R5D A;  1SQQ D;  5CBN A;  1VQ8 P;  1AVY A;  4QDC A;  4QDF A;  2D2C C;  3G3Z A;  4AYC A;  1JM1 A;  2NPS C;  3M9B A;  5AW6 B;  4U3F G;  2NPS A;  3HD7 C;  2V7Q J;  2YFJ A;  1T8Z A;  3QWO C;  1G2C A;  3WMM 0;  1M90 Q;  2OQQ A;  4LC1 A;  3KZI H;  3BRT B;  2E43 A;  1YJW P;  1CI6 B;  1GMJ A;  2C9N Y;  2OTJ P;  1BE3 G;  2QIW A;  1Q7Y Q;  4DCK A;  1LJ2 A;  2Z5I A;  4QMA A;  2I1K A;  3CPW O;  4W7Y A;  2DW3 A;  3RK3 B;  1OZH A;  1FC2 C;  1VQ6 P;  5AW1 B;  2ZAE B;  3CC4 P;  2O01 N;  3GW6 A;  1IJD B;  1EQ7 A;  2Y0D A;  2Y0E A;  1ZOY C;  1X9V A;  2K9J A;  5KAI H;  4NBB D;  1KIL D;  1FDM A;  3SFE C;  1H0T B;  2FXO A;  1IFI A;  1VQL P;  5E79 H;  3GL2 A;  3ITK A;  3KHU A;  5KAF E;  3Q1M A;  2NVF A;  2FYU E;  2HMO A;  5KKZ B;  3TNU B;  2NWF A;  3M91 A;  2WPR A;  1H8A A;  3CCR P;  1MZ9 A;  1KYO E;  3BVH A;  1DEB A;  1EDL A;  2YIU B;  1BCC J;  2QPZ A;  1AA0 A;  1LT1 A;  4WY4 B;  3F89 A;  2FY8 A;  2YNY A;  4D6T G;  3V2P A;  1W2E A;  1ZV8 A;  3MIW A;  4I1L A;  1OMI A;  1GZL A;  4BXL A;  5AEW A;  1JY2 P;  5GTI H;  1G8J B;  1RF0 C;  3VMG D;  3L70 J;  3V4Q A;  4NBG D;  2IZ0 A;  1SQX K;  3D70 A;  3A0H E;  3S1K A;  1PP9 E;  4JF7 A;  1ULI A;  1M1J A;  3M0D A;  3I5C A;  1SQP E;  1U7J A;  1NTM D;  4JYC A;  1SJG A;  1ZR2 A;  2OAR A;  1N7S A;  1PGP A;  3AE1 C;  2BMQ A;  1ZLL A;  3CXH E;  2YVJ B;  2E76 C;  1QLE D;  1GW4 A;  1URQ A;  3IF4 A;  3MUD C;  2AEJ A;  3ZDM A;  5CJ4 A;  3MUD A;  4QDF B;  1OVU A;  5APQ A;  3GTS A;  3H1K J;  4U3F D;  2NPS B;  1G2C B;  3TF5 A;  1J1E C;  4PV1 C;  3VMI D;  4AAY B;  1GL2 D;  1SP4 A;  2YO2 A;  1GDT A;  1S9K E;  1PL5 A;  5CCH A;  3C0D A;  2JZA A;  4N78 D;  3MD0 A;  1FZG A;  4HJG H;  1NU1 G;  1SLQ A;  2PAJ A;  1LTA C;  3GZX A;  3FXE A;  1WRG A;  4GDO A;  2QJK B;  5M1B A;  1GK6 A;  2ITA A;  2K9J B;  3EN1 A;  3GHG A;  1MFZ A;  3H1L J;  2HOD A;  2J5U A;  2R5B A;  1R5S A;  5B5E E;  3A0B H;  2LKM A;  3L71 G;  1FZA A;  1BCC E;  3FGA D;  3D89 A;  1KQF B;  2N9Y B;  2MKV A;  2GBX A;  3BCC J;  2YFI A;  1DD3 A;  2QJP C;  3AEE C;  3L70 E;  4UB8 E;  4DZO A;  2WSC H;  5TIS H;  2OGU A;  2R32 A;  2N1T D;  3CMA P;  3KDP B;  3G4S P;  1VDF A;  2A45 I;  2Z4E A;  2C0W A;  2FFD A;  3L75 G;  2QA4 P;  1USD A;  3VMA A;  1P84 E;  1NAF A;  1JTH B;  1S2E A;  1JO5 A;  2Q1K A;  2WPV B;  5AW5 B;  1M1J B;  3L74 D;  2I7F A;  3OJA B;  1FZC A;  5CJ0 A;  1N7S B;  2AEF A;  3TGU J;  2KZJ A;  2CPB A;  3H1K E;  1EZV G;  3LIE A;  4EMJ B;  2E76 B;  2Q3W A;  3V2N A;  3H32 A;  1KYO I;  4HJL A;  1M56 D;  2JDI H;  4YXW H;  5APW A;  2M5A A;  1N2D C;  1SFC D;  3B5N C;  2KIK A;  4MN4 C;  1KB9 E;  3G71 P;  3VCA A;  1UIX A;  5AVY B;  2GM4 A;  3GCE A;  4PV1 B;  1USE A;  1RFS A;  2ZJS E;  2IX7 C;  3PHL A;  1U57 A;  1NU1 D;  3E1I A;  1YIJ P;  3H1L E;  3MP7 B;  3SWK A;  3H1H G;  2B88 A;  4BWN A;  2AXT E;  1YJ9 P;  5KLV D;  1ZR4 A;  3Q5P A;  3HE4 B;  1SQB K;  1NTK J;  3CXH I;  3L73 G;  2P10 A;  3CC2 P;  2XR8 A;  1AQT A;  3HE5 A; 
#chains in the Genus database with same CATH homology
 3BCC E;  1O7M A;  2HMK A;  4NBA D;  3L74 E;  2HMJ A;  2NVG A;  2YIU C;  1P84 E;  2BCC E;  2B1X A;  4QDF B;  4QUQ A;  2JO6 A;  2NVE A;  4H0L D;  4NB8 D;  3GTS A;  4NBE D;  3GZY A;  4HM5 A;  1NTK E;  2ZT9 D;  3GL0 A;  1SQX E;  5CXM A;  1G8K B;  3N0Q A;  4NBB D;  2E4P A;  2E75 D;  3CX5 E;  2E74 D;  1L0L E;  2XRX A;  4P1C H;  2I7F A;  3VMI D;  4AAY B;  4HKV A;  1FQT A;  2BMO A;  2E4Q A;  1WQL A;  3CWB E;  3FOU A;  4AIV A;  1RIE A;  2NUK A;  1Q90 C;  2B24 A;  1VCK A;  3GL2 A;  3AZC A;  1O7W A;  3H1K E;  2YFL A;  1PPJ E;  2NVF A;  3C0D A;  4QCK A;  2JZA A;  1O7G A;  5KLI C;  2FYU E;  1SQB E;  2HMO A;  4EMJ B;  2Q3W A;  4NBF D;  2NWF A;  3EQQ A;  4HJL A;  2IBZ E;  3GZX A;  2DE7 D;  1KYO E;  1SQV E;  4NBD D;  2E76 D;  4D6T E;  3L72 E;  2D2C D;  2QPZ A;  3GKE A;  1VM9 A;  4HM7 A;  3GTE A;  4OGQ D;  4HM3 A;  4P1B H;  4HM4 A;  1SQQ E;  3TGU E;  4HM8 A;  1ULJ A;  1EZV E;  2CKF A;  1O7N A;  3GOB A;  2FYN C;  2ZYL A;  4H44 D;  3EN1 A;  4QDD A;  2XSO A;  3DQY A;  1O7H A;  1KB9 E;  1NU1 E;  3L71 E;  5AEW A;  3VCA A;  2NUM A;  3GCE A;  1ZRT E;  4HM6 A;  1RFS A;  1G8J B;  3VMG D;  1NYK A;  4H13 D;  1BCC E;  4QUP A;  3D89 A;  1O7P A;  4NBG D;  1UUW A;  4PV1 D;  4QDC A;  1NTM E;  4QDF A;  1UUV A;  2HML A;  2HMN A;  5KLV E;  1EG9 A;  2DE5 D;  4PD4 E;  1JM1 A;  4NBC D;  3H1H E;  1PP9 E;  5BOK A;  2BMR A;  2GBX A;  2DE6 D;  2A06 E;  3H1L E;  5AEU A;  1ULI A;  2YFI A;  2YFJ A;  3H1I E;  1L0N E;  1NDO A;  4HM2 A;  3GB4 A;  1SQP E;  2QJP C;  2QJK C;  2XSH A;  1BE3 E;  3L73 E;  4QUR A;  3L70 E;  4NB9 D;  1SJG A;  4NBH D;  2QJY C;  3H1J E;  3VMH D;  3VCP A;  1VF5 D;  2BMQ A;  2XR8 A;  4HM1 A;  2HMM A;  1NTZ E;  3CXH E;  3L75 E;  2YVJ B;  4U3F E;  5KKZ C;  1BGY E;  2GBW A;  4HM0 A;  5HL4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...