1SQVE

Crystal structure analysis of bovine bc1 with uhdbt
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
196
structure length
196
Chain Sequence
b'SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome c reductase complex core protein I, mit
molecule tags Oxidoreductase
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
total genus 39
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1sqvE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1sqvE02
2E74D 3VCPA 3L75E 1G8KB 2DE5D 2HMMA 4H0LD 1RFSA 3VMID 1SQPE 2NUKA 4QCKA 2B1XA 3BCCE 3L70E 5CXMA 1SQVE 3CXHE 2NVGA 2NVFA 3GZXA 4PV1D 4HM1A 4QDFA 1SQXE 1SJGA 2QPZA 2D2CD 5KLVE 3C0DA 2QJPC 1ULIA 2QJYC 3L71E 3GL2A 2BMRA 1ULJA 1P84E 4NBED 4QDDA 2E4QA 1BGYE 3GTSA 4HM0A 1SQBE 3GOBA 4HJLA 1FQTA 5AEUA 2HMOA 2I7FA 1PPJE 2BCCE 2JO6A 4QUQA 3DQYA 1NTZE 3VCAA 4HKVA 3EQQA 2FYNC 2A06E 4PD4E 2JZAA 2NWFA 3EN1A 4OGQD 4P1CH 5HL4A 4HM5A 2YVJB 1O7HA 3H1IE 4HM2A 5KKZC 2DE7D 3TGUE 2GBXA 2HMNA 2NVEA 2YFLA 3VMGD 4HM3A 2Q3WA 4NBCD 1NYKA 4P1BH 3GB4A 4H44D 1VM9A 1UUWA 1PP9E 2XR8A 3GTEA 3GZYA 1KB9E 1BCCE 3H1LE 4QDFB 4NBDD 2YIUC 2CKFA 1NTKE 4U3FE 2GBWA 3AZCA 2IBZE 2YFIA 2BMOA 3GL0A 1O7MA 1VCKA 3CX5E 3H1HE 3N0QA 1O7WA 2QJKC 4QUPA 5AEWA 4NBFD 1KYOE 2NUMA 2DE6D 2B24A 2E76D 4HM6A 1JM1A 1O7PA 5BOKA 2ZT9D 3H1JE 1O7NA 3CWBE 2ZYLA 4NB9D 4NB8D 1WQLA 3FOUA 2FYUE 4NBHD 4QDCA 4H13D 3L72E 1UUVA 3L74E 1NU1E 1ZRTE 4HM7A 1L0LE 4AIVA 4HM8A 3GKEA 3VMHD 1Q90C 2HMKA 2HMLA 4QURA 1SQQE 4AAYB 1NDOA 3D89A 4D6TE 4HM4A 1O7GA 1L0NE 4NBAD 1EG9A 1VF5D 1G8JB 1NTME 5KLIC 1RIEA 2XSOA 2XSHA 2HMJA 2BMQA 1BE3E 3GCEA 4EMJB 2YFJA 4NBGD 2XRXA 2E4PA 1EZVE 3H1KE 3L73E 2E75D 4NBBD
chains in the Genus database with same CATH superfamily
2NPSC 2JP3A 4C7RA 2M3EA 2I1KA 3PLNA 1N86A 2O1KA 4H0LC 1SQVK 2QJPC 5CCHC 3L71E 1A02J 1U7MA 3L70J 2WSSH 3BRVB 3N7NA 1BDDA 1XTGB 4RJTA 3VCAA 1W2BO 4XE5B 4OGQD 3VMXA 4N78E 2CPBA 1GTWA 2E42A 1BCCG 3PJSK 1LTGC 1YJNP 2Q3IA 2QVAA 1P84D 1FZEA 3L74J 4NBDD 4IOIH 1JCCA 1QVFO 5AVTB 4O9BA 2FFDB 3VN0A 2AEJA 1O7WA 2WT7A 1KYOE 1K04A 4C46A 2B24A 3KXDA 1DD4A 2N1TB 1O7NA 2QJKB 4AIVA 3CI9A 2KSEA 3RBZA 1YTZI 5KLIB 1WRGA 1NTMG 3HUSB 1NVOA 1IJDB 4XFJA 1EQ7A 3M9HA 2XSHA 1FDIA 3U1CA 3PRJA 1CW5A 1VQNP 1IO4A 2E75C 3AE2C 3C9IA 5AW9B 1EZVE 3CCMP 4H44D 1VQ5P 2N1TD 1N2DC 2W6AA 5CBOA 1PGOA 1OW6A 5AVSB 3CXHH 1IFDA 2WSEH 2GUVA 3AEBC 1ULIA 3CWBG 1VQPP 5AW5B 1JO5A 1FBMA 1BE3G 1ZR2A 4JYBA 1RF0C 4JYCA 5M1BA 1BE3J 2D2CB 1JEKA 1YIJP 2WZ7A 1N8RQ 1RQVA 2DE7D 1Y8AA 1IFJA 3OJAB 1SFCA 3RL0C 4HKZH 4LC1A 1M8OB 1OVVA 3V2NA 4RKUJ 2FYUJ 2N9BA 3Q3DA 1LT1A 3H1HE 2FYNB 2GM4A 5L8RJ 5AEWA 2QA4P 1URQC 5B5EH 1N7SA 1VQ8P 3H1KG 3H1IG 4HM6A 1S9KE 2J59M 3H1JE 1BE3D 3M0DA 1EDIA 5B66E 4WBAA 5C39A 2K9YA 3EFGA 1PGJA 1Q81Q 5AW0B 2KZJA 3OAKA 1KILD 1NTME 2V7QJ 2ZYDA 4Y99B 2K1AA 1FDMA 3C1LA 2Q7CA 1L0NG 1DEEG 4H44C 3MZWB 1L0LK 1E79H 2WSFH 3GF7A 1USDA 1KB9I 5TJHA 3HRNA 1OWAA 4OGQB 2QPZA 3BRTB 2W90A 4WY4B 4EOTA 3FXEA 2HPCB 2FKWB 2JZAA 3H1JG 2YVJB 1O7HA 2IZ0A 2BCCG 1J1DC 1JMBA 1DD3A 3USSA 1LTJB 5E79E 2A06G 1SQQJ 3IAOA 3AEAC 2HODA 2SPZA 2GBWA 2BMOA 1GL2C 1R8EA 3FWLA 1SP4A 4QUPA 2QJPB 4NBFD 2R5BA 2DE6D 1SQQG 4YXDC 3L72D 2JWAA 3F89A 3L72E 1H8AA 2A45I 3SFDC 1QVGO 1OZHA 1M1JB 1O7GA 2KSJA 2IBZI 1KQGB 2PAJA 2BCCJ 2H7HA 2UWJE 1BE3E 5H2FE 2NPSD 3D71A 3GCEA 4H13B 2YFJA 1M1JA 4NBGD 2OYIB 1HJ0A 1M90Q 5APWA 4C7NA 3L73G 3K5BA 3AE6C 2Q9IA 1RFSA 2E76B 3VMZA 1KFMA 2D2CD 5KLVG 2YIUB 3G9RA 1IFMA 3H1JD 2YO2A 3GOBA 1LNQA 5AEUA 1SLQA 3H32B 2FYUG 2ZYGA 3FWNA 1DIPA 1Y9BA 2A06E 2HODB 1J1DB 3RK3E 5AVZB 4P1CH 2JO1A 4HM5A 1VQ6P 2GBXA 1NTZK 2OARA 3GHGB 1LTJA 1L4AC 3CXHD 3VMGD 2ZVOB 5AVUB 1NU1K 2QM7A 1UUWA 2FXOA 5APQA 1GU5A 1RE4C 1NJIQ 2QJYB 4PJ0E 1BGYD 1RHZB 4H13C 1NTKG 5KJ7D 2NUMA 1K73Q 3AE9C 4U3FJ 3IN6A 1L0LG 1L4AD 2ZYLA 3L35A 3CC4P 1HF9A 1HVVA 4MN4C 1L0LE 1AFOA 1WT6A 3VMHD 1Q90C 1IFNA 2B88A 3D89A 3I55P 1JCDA 3TGUJ 1ZMEC 1CI6B 3CXHI 1FOSF 2P67A 2IYPA 1VQMP 2C0WA 3L75E 2CPSA 3TDKA 4PD4D 1M7LA 2KNCB 1H88A 3L71J 1SJGA 4HH2A 2RH0A 3A0HH 2ZAEB 2OYHC 1N7SB 1YJWP 1BGYE 3KHUA 4HJGH 3I5CA 2FYNC 2NWFA 1XTCC 1LT9A 3M0DC 3MUDA 5E79H 2YMKA 1SQQK 2OTLP 4K35A 4WB4A 2YKPA 2KK7A 3GTEA 1KB9H 3B5NC 2ZXXA 3V4WA 2PGDA 1JY2N 3TK1A 2WPQA 1ZXGA 2WWWA 1HWTC 1JOCA 1P84I 1YYCA 1KQFB 3R2PA 3CWBE 3P7KA 4I1LA 1IC2A 2GUSA 4ZKPA 1VQ4P 2OQQA 1HBWA 2AEMA 2W83C 2XNXA 2YNYA 3RL0B 1VF5D 1NU1G 2DW3A 3VP8A 4I6MC 3GHGC 2Y0CA 3NFQA 4EI2A 1ZW0A 3JCUH 2H8PD 2M5AA 2FYZA 4BWNA 1VQ7P 2E74C 1FOSE 2E4PA 3CCLP 2DE5D 2NUKA 2AXCA 3JC22 2H88C 2VRSA 3L4FA 3GZXA 3AE5C 1BCCD 3Q5RA 1S72P 3RK3B 2O3JA 4NPEA 3D70A 1AV1A 1SQPJ 4R4LA 3MHVA 3IF4A 2WT7B 3RK2B 1KILC 3P8CE 1K05A 2V7QH 3L75D 1L4AB 3S4RA 5BU8B 3LIDA 2PFXA 3EN1A 1YITP 3SWFA 1OW8A 1NO4A 2HMNA 1PFIA 2NVEA 1L0LJ 2Q6QA 3H6PA 1RH5B 2J5UA 4GKGA 1URQD 3H1HG 5APUA 4U3FE 4U3FD 1O7MA 1NTMD 3CX5H 3AE3C 4N78D 4PJ0H 2KOGA 3GMAA 3AE8C 3L75G 1PP9J 1T8ZA 2O01N 1WMKA 1NU1E 1FZAA 1ZRTE 3H1LJ 3VTPC 4HM8A 1D7MA 4CPGA 2W6JH 2JJLA 4QURA 1SQBK 1Q82Q 1RF1A 1L0NE 3H1HD 3G71P 1RE3A 3SFEC 1R5LA 2IZ1A 3CWBD 1HTLC 2W8ZA 1SS1A 3UIAA 1PP9D 2HYNA 3A0BE 3A7OA 2R3SA 4WY4D 4OH8B 1OW7A 2E75D 2WSEJ 1KC8Q 5EFWB 5CCGC 1KMIZ 3BCCE 3A2AA 4AUWA 2NPSA 1SQVE 5KLVJ 1NYHA 3W67A 5KLVE 2B89A 2YXQB 3BCCJ 2OYOA 2I8DA 1JY3O 1TU3F 3M91A 1FQTA 2N1TC 1NOHA 3L73J 1X0TA 3E1RA 3U1AA 1QEXA 3HE4A 2QEXP 1ZRTD 2M0BA 1RF0A 3BATA 3HTKB 2FFDC 4IFFA 2KI7B 1OX3A 4U3FG 2B9BA 1SQPD 3L70G 1L0ND 3FXDA 1FC2C 1KB9E 4QDFB 2KB7P 2ZT9C 4NPFX 1AQTA 1FDOA 3HD7D 4ZMDA 2J58A 2A45G 1KYOH 3RGUA 1EZVG 3LW5H 2YMYA 3R4YA 2FXMA 4GIFA 3CCEP 3C8VA 3CMAP 4NB8D 1OVUA 1SQQD 5KAIE 4OGQC 1LP1B 3G3ZA 2M3BA 2WITA 4TLFA 4Y28J 1LTBC 3L70D 1L2PA 3H25A 2HLOA 3JCUE 1FE6A 4ASWA 3CCVP 4EMJB 1EDJA 3CLQA 1U57A 2M8RA 2R32A 2E74D 3VCPA 3VMYA 2JWDA 2HMMA 1NTKK 2B1XA 3A5TA 4JBZA 2NVGA 3ITKA 4N3YB 3C0DA 1GK4A 1JTHB 1EDLA 1GL2B 4NBED 3PH0A 3GLMA 4HJLA 1NTMK 4UB8H 4PD4I 4BRYB 1G1IA 4Z1MH 4HKVA 1YTZT 1UIXA 5HL4A 1ZV8A 1VF5B 2LXCB 2YFLA 1IK9A 5AW2B 3HD7A 1BDCA 3KPEA 4P1BH 5CCHA 1RY3A 2OYHA 2Y9ZA 1SQBG 2CKFA 4D6TD 2JDIH 1KQLA 4EIJA 2O1JA 1FZCA 2E5TA 3O6QA 1NU1D 1L0NK 1OVRA 3L71G 1JM1A 2ZT9D 4DZOA 5KLVD 3G6EP 1K9MQ 3BCCG 4GOEA 2XNDH 2HMLA 3B5NA 3WUVA 3CX5D 5KLIC 3L37A 2HMJA 2IYOA 5GTIE 3AE4C 3Q5PA 2P58A 3H1KD 3O6QB 2W27A 1OIPA 1R5SA 3IFMA 5CXMA 4PV1D 4EDFA 3CC7P 3GF3A 3V6IA 1P84E 4AQRD 3Q1MA 1KORA 4QDDA 3M06A 1HH0A 2HG5D 3D6ZA 4GOFA 1JMMA 3HE5A 1N73B 1E5WA 1OXZA 1CSBA 4IFMA 3L74G 4YXWH 2BEQD 5DJTB 4WY4C 4BRYA 3V2PA 1Z56A 3TGUE 2K9JA 1YBKA 1NYKA 3O8ZA 1JTHA 2L5GB 2WSCH 3CMEP 2YKQA 1BCCE 4DJGA 4DT0A 4L75A 5AVRB 3BVHA 3RK3D 1RE3C 3V2QA 1QX8A 3TNUA 1IZNB 1AVYA 3TGUG 2Y9YA 1BCCJ 3L74D 3VP9A 2BCCD 2ZVNB 5KAIH 5APVA 2L91A 2FBWC 1N7SD 4W7ZA 5TISH 2HMKA 2K37A 1QL1A 2ZFCA 1J1EB 3QWOC 2RMZA 2Q3EA 4L73A 2FY8A 4IL6H 1S4XA 1X79B 2E75B 3WUTA 1U7JA 1SQBJ 3B8EB 4K3AA 4QCKA 5AW1B 4HM1A 4QDFA 2KUBA 2QJYC 1K8AQ 1LTIC 1KILA 3CL3D 2C9NY 3GTSA 1KILE 1GD2E 5AVVB 1MUUA 1KB9D 2IDBA 3HE4B 1ZN5A 4PD4E 3H1IE 4HM2A 2RN0A 1LT9C 3PP5A 2IX7C 1DEBA 4HM3A 3ZDMA 1KD1Q 1KTMA 1SQVG 1LTJC 1BSNA 1LWUB 2E43A 3L72J 2NPSB 2Y0EA 3TSIA 1Q7YQ 1G1JA 2LR2A 1RE4A 1PGQA 4ZNCA 1O7PA 4W80A 1YJ9P 2ITAA 5GTHH 2KIKA 1RF1C 1PIXA 3VOPA 1RF1B 1KYOI 2BASA 1J1EC 1SQQE 3FX0A 1Q86Q 4AYCA 2QG4A 3FGAD 1ZP0C 4BXLA 3KQGA 1M1JC 3I56P 2BMQA 3CCQP 4GDOA 5KLVK 3CPWO 4H44B 1NTZJ 1NTKD 1JB0J 2B87B 1YI2P 1SFCD 1G8KB 1EZVI 3MGNA 2A06D 2G3AA 5AW6B 5AVWB 2OTKE 1PGPA 5AW8B 3AEFC 1NH4A 2Q1KA 2I7FA 1URQB 3KZIE 3WU2H 4ZKUA 1NTZE 1H0TB 1N7SC 3CCRP 2HFED 1S2EA 1L4AA 3F5HA 4PV1B 2NZ2A 1HJBA 1AQ5A 1Q90D 3RK3C 2Q3WA 2KS1A 1LTSC 1PP9G 5KTBA 3GZYA 4LGDE 2FXPA 3AE1C 1NKNA 3PHLA 3H1JJ 1SQPK 1HGZA 4GODA 2E76D 2LKMA 5APTA 5BOKA 3EWKA 2IPPA 2M5AB 3CCUP 3VYIA 1JY3N 3H1HJ 1JY3P 3T97B 2FYUE 1KZUB 2IFNA 5KJ7C 4H13D 4QDCA 1UUVA 3ABVC 3H1LD 1AVOA 2P7JA 4OVNF 2O01H 4R4MA 1A02F 3LIEA 5CHXA 1VL2A 2XSOA 3N4XA 3H1IJ 2KYVA 4DCKA 1DH3A 2V4HA 1NAFA 1GDTA 3S9OA 3VMID 2I1JA 3T97A 1KYOD 3PTZA 1KQSO 1GW3A 3D6YA 4DOJA 1SQPG 1Q2NA 1NTZD 2D2CC 1SQBE 3RK2D 3B5ND 3KYQA 2HMOA 1PPJE 5KAFH 2JO6A 2ZXEB 1LT9B 4JQ0D 4HYTB 1SQXK 1M1KQ 4YPCA 2MKVA 2KS1B 4ASVA 1NU1J 2OGUA 2YKOA 4HB1A 1BSHA 2K3RA 1JY2P 1JY2O 1PP9E 5APXA 3M9BA 1QGKB 1M57D 1H0TA 1NTKE 2IBZD 2KNCA 1SQBD 2BEZF 4UB6H 2YFIA 1URQA 4L74A 4D6TG 5CJ4A 5B5EE 2G8YA 1YQ3C 1RQUA 4NB9D 4KT0J 1CI6A 4NBHD 3L74E 4HM7A 2XDJA 1PPJG 1UIIA 2B87A 5AW4B 5BU5A 1NDOA 4D6TE 5APSA 1EG9A 2RKLA 1QLED 3Q5SA 1HGVA 4IFDK 3A0BH 1LGHB 4M3LA 3H1KE 2XU6A 5CMZA 2XZRA 2QE7H 4L76A 3L70E 5CBNA 2JKVA 2NVFA 3RL0D 1S5LH 1VPCA 3L71D 3GL2A 1PPJD 3S1KA 4QMAA 3GHGA 3BCCD 2WSFJ 1LTTC 3KZIH 3WU2E 1PV3A 1FJKA 3OW2O 3RBXA 1JUNA 1LWUA 3V2RA 2KXPB 2O01J 1FU1A 3H32A 2WPVB 3MTUE 1OFCX 4RO0A 5AVQB 3JSVC 3KDPB 3CWBJ 3P32A 1AJYA 2XR8A 3NTNA 3HD7C 3LW5J 3CCSP 1X8YA 3GL0A 3N0QA 4RESB 2P2UA 4C7NB 2YXRB 1KILB 3AEGC 1VQLP 2OYIA 2POHA 2ZJSE 3TGUD 1T2KD 2E74B 2JEEA 4JPZB 3GG2A 3CCJP 3GKEA 3V5BA 3MD0A 3AEEC 4JF7A 4NBAD 2NRGA 4OWFA 2FYUD 3AECC 1YQ4C 3MIWA 1EDKA 5H2FH 1VQ9P 3NXSA 2AEFA 4IL6X 1BGYJ 4A7PA 2PRRA 1EZVD 2Z5HA 1DX7A 1AA0A 4XA4A 3WMM0 3BASA 3MUDC 2E5YA 3L75J 1SQXJ 5DJUB 2WQYC 1CZQA 1X9VA 2BMRA 3H1KJ 1ULJA 4HM0A 3TNUB 3TYYA 1BGYG 3SWYA 5KAFE 4I2LC 4UB8E 1FZGA 4QUQA 3CX5I 3DQYA 1NAYA 1J2JB 2WPRA 1FZFA 4D6TJ 2HPCA 1FJPA 3U59A 5KKZC 1T6AA 4WY4A 4LLHA 1MFTA 1IK7A 4KHXA 2K9JB 5BVZA 4WVZA 1M56D 3TF5A 3GB4A 1SQVD 3RL0g 1ZR4A 1N73C 3CC2P 2H43A 2IFMA 4UB6E 3HE5B 1N73A 4Y99C 4WWIA 2A45H 1NTKJ 1S9KD 5AW3B 2FYUK 1SVFA 3CD6P 2HR3A 5APYA 3FOUA 1JNMA 1H89A 1N7LA 1Y47A 4AAYB 1MV8A 2AXTE 3AE7C 1NWQA 3P8CD 1G8JB 2CK3H 2ZYAA 3E1IA 1VDFA 5GTIH 3EQ2A 3W68A 2N9YB 2XRXA 2R3CA 3L73E 3B5NB 3VMAA 1NGMB 3SWKA 4H0LD 2QIWA 3SSUA 2WMMA 3L36A 1SQXG 4B86A 2LXBA 1S5LE 3MP7B 3A0HE 1HUCA 1SQVJ 1SFCB 2KLVA 3OA7A 2OTJP 1P84H 1NKZB 2H89C 1JM0A 1KFNA 1FAVA 1FZCB 3L72G 1PZQA 2BCCE 2IBZG 1QL2A 1LTAC 5CCHD 3L73D 2R44A 5KKZB 2OYHB 3HD7B 1OMIA 2K88A 1VF5C 2QRXA 3V4QA 1L0NJ 2WVRA 3QH9A 5KJ7A 4TT3H 3EFFK 1KN7A 3RK2C 1IFPA 1SQXD 3B4SA 1MKMA 3H1LE 1FZCC 1W5CE 2XV5A 3WUUA 2Q5UA 1VCKA 2QJKC 2Y0DA 1GL2A 3HUSC 2GA1A 2WSCJ 1T3JA 2C9LY 1GU4A 2KP8A 1T3UA 3HUSA 5TISE 2ZT9B 2P10A 3M0AA 3P8MC 1LJ2A 4HM4A 1EC5A 5K5GB 1VQKP 3H1ID 4W7YA 3GW6A 4IL6E 3IR9A 2MJZA 4EYYQ 1IFIA 2N1TA 4PV1C 1W2EA 2WTYA 4NBBD 1FZBA 1USEA 1FS0E 1LP1A 1SQPE 2FFDA 2P1JA 3CXHE 3A3YB 1MZ9A 1S1CX 1SQXE 1L0LD 3NMDA 2WPSA 1S3JA 4H0LB 2E4QA 1GW4A 2Z4EA 5CJ0A 1KV4A 3E7KA 2W6BA 1GK6A 1NTMJ 3EQQA 4PD4H 2OYIC 1T2KC 1SFCC 2QSIA 3HTKA 4NBCD 2JR8A 1EXIA 1YHQP 1NHLA 1ZLLA 1VM9A 4GT1A 3Q2YA 3G4SP 2YIUC 4N6JA 1GMJA 3AZCA 3H1LG 2IBZE 4NPDA 3CX5E 1GZLA 1X22A 1LWUC 5CCGD 2R5DA 3B71A 2E76C 5AVYB 5GTHE 5AW7B 1EXJA 2PP6A 1WQLA 5B66H 1VQOP 2XKMA 2KLUA 3II6A 5CCGA 3M9QA 4I7ZB 4YTPC 4I7ZC 1GL2D 2QM8A 1G2CB 1G2CA 4KJMA 2AXTH 2KZIA 1MFZA 1RIEA 5AVXB 2C0XA 1NTZG 2Z5IA 1S5LX 4U7JA 3AEDC 1ZOYC 2YO3A 1PL5A
chains in the Genus database with same CATH topology
2E74D 3VCPA 3L75E 1G8KB 2DE5D 2HMMA 4H0LD 1RFSA 3VMID 1SQPE 2NUKA 4QCKA 2B1XA 3BCCE 3L70E 5CXMA 1SQVE 3CXHE 2NVGA 2NVFA 3GZXA 4PV1D 4HM1A 4QDFA 1SQXE 1SJGA 2QPZA 2D2CD 5KLVE 3C0DA 2QJPC 1ULIA 2QJYC 3L71E 3GL2A 2BMRA 1ULJA 1P84E 4NBED 4QDDA 2E4QA 1BGYE 3GTSA 4HM0A 1SQBE 3GOBA 4HJLA 1FQTA 5AEUA 2HMOA 2I7FA 1PPJE 2BCCE 2JO6A 4QUQA 3DQYA 1NTZE 3VCAA 4HKVA 3EQQA 2FYNC 2A06E 4PD4E 2JZAA 2NWFA 3EN1A 4OGQD 4P1CH 5HL4A 4HM5A 2YVJB 1O7HA 3H1IE 4HM2A 5KKZC 2DE7D 3TGUE 2GBXA 2HMNA 2NVEA 2YFLA 3VMGD 4HM3A 2Q3WA 4NBCD 1NYKA 4P1BH 3GB4A 4H44D 1VM9A 1UUWA 1PP9E 2XR8A 3GTEA 3GZYA 1KB9E 1BCCE 3H1LE 4QDFB 4NBDD 2YIUC 2CKFA 1NTKE 4U3FE 2GBWA 3AZCA 2IBZE 2YFIA 2BMOA 3GL0A 1O7MA 1VCKA 3CX5E 3H1HE 3N0QA 1O7WA 2QJKC 4QUPA 5AEWA 4NBFD 1KYOE 2NUMA 2DE6D 2B24A 2E76D 4HM6A 1JM1A 1O7PA 5BOKA 2ZT9D 3H1JE 1O7NA 3CWBE 2ZYLA 4NB9D 4NB8D 1WQLA 3FOUA 2FYUE 4NBHD 4QDCA 4H13D 3L72E 1UUVA 3L74E 1NU1E 1ZRTE 4HM7A 1L0LE 4AIVA 4HM8A 3GKEA 3VMHD 1Q90C 2HMKA 2HMLA 4QURA 1SQQE 4AAYB 1NDOA 3D89A 4D6TE 4HM4A 1O7GA 1L0NE 4NBAD 1EG9A 1VF5D 1G8JB 1NTME 5KLIC 1RIEA 2XSOA 2XSHA 2HMJA 2BMQA 1BE3E 3GCEA 4EMJB 2YFJA 4NBGD 2XRXA 2E4PA 1EZVE 3H1KE 3L73E 2E75D 4NBBD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E74 D;  3VCP A;  3L75 E;  1G8K B;  2DE5 D;  2HMM A;  4H0L D;  1RFS A;  3VMI D;  1SQP E;  2NUK A;  4QCK A;  2B1X A;  3BCC E;  3L70 E;  5CXM A;  1SQV E;  3CXH E;  2NVG A;  2NVF A;  3GZX A;  4PV1 D;  4HM1 A;  4QDF A;  1SQX E;  1SJG A;  2QPZ A;  2D2C D;  5KLV E;  3C0D A;  2QJP C;  1ULI A;  2QJY C;  3L71 E;  3GL2 A;  2BMR A;  1ULJ A;  1P84 E;  4NBE D;  4QDD A;  2E4Q A;  1BGY E;  3GTS A;  4HM0 A;  1SQB E;  3GOB A;  4HJL A;  1FQT A;  5AEU A;  2HMO A;  2I7F A;  1PPJ E;  2BCC E;  2JO6 A;  4QUQ A;  3DQY A;  1NTZ E;  3VCA A;  4HKV A;  3EQQ A;  2FYN C;  2A06 E;  4PD4 E;  2JZA A;  2NWF A;  3EN1 A;  4OGQ D;  4P1C H;  5HL4 A;  4HM5 A;  2YVJ B;  1O7H A;  3H1I E;  4HM2 A;  5KKZ C;  2DE7 D;  3TGU E;  2GBX A;  2HMN A;  2NVE A;  2YFL A;  3VMG D;  4HM3 A;  2Q3W A;  4NBC D;  1NYK A;  4P1B H;  3GB4 A;  4H44 D;  1VM9 A;  1UUW A;  1PP9 E;  2XR8 A;  3GTE A;  3GZY A;  1KB9 E;  1BCC E;  3H1L E;  4QDF B;  4NBD D;  2YIU C;  2CKF A;  1NTK E;  4U3F E;  2GBW A;  3AZC A;  2IBZ E;  2YFI A;  2BMO A;  3GL0 A;  1O7M A;  1VCK A;  3CX5 E;  3H1H E;  3N0Q A;  1O7W A;  2QJK C;  4QUP A;  5AEW A;  4NBF D;  1KYO E;  2NUM A;  2DE6 D;  2B24 A;  2E76 D;  4HM6 A;  1JM1 A;  1O7P A;  5BOK A;  2ZT9 D;  3H1J E;  1O7N A;  3CWB E;  2ZYL A;  4NB9 D;  4NB8 D;  1WQL A;  3FOU A;  2FYU E;  4NBH D;  4QDC A;  4H13 D;  3L72 E;  1UUV A;  3L74 E;  1NU1 E;  1ZRT E;  4HM7 A;  1L0L E;  4AIV A;  4HM8 A;  3GKE A;  3VMH D;  1Q90 C;  2HMK A;  2HML A;  4QUR A;  1SQQ E;  4AAY B;  1NDO A;  3D89 A;  4D6T E;  4HM4 A;  1O7G A;  1L0N E;  4NBA D;  1EG9 A;  1VF5 D;  1G8J B;  1NTM E;  5KLI C;  1RIE A;  2XSO A;  2XSH A;  2HMJ A;  2BMQ A;  1BE3 E;  3GCE A;  4EMJ B;  2YFJ A;  4NBG D;  2XRX A;  2E4P A;  1EZV E;  3H1K E;  3L73 E;  2E75 D;  4NBB D; 
#chains in the Genus database with same CATH topology
 2NPS C;  2JP3 A;  4C7R A;  2M3E A;  2I1K A;  3PLN A;  1N86 A;  2O1K A;  4H0L C;  1SQV K;  2QJP C;  5CCH C;  3L71 E;  1A02 J;  1U7M A;  3L70 J;  2WSS H;  3BRV B;  3N7N A;  1BDD A;  1XTG B;  4RJT A;  3VCA A;  1W2B O;  4XE5 B;  4OGQ D;  3VMX A;  4N78 E;  2CPB A;  1GTW A;  2E42 A;  1BCC G;  3PJS K;  1LTG C;  1YJN P;  2Q3I A;  2QVA A;  1P84 D;  1FZE A;  3L74 J;  4NBD D;  4IOI H;  1JCC A;  1QVF O;  5AVT B;  4O9B A;  2FFD B;  3VN0 A;  2AEJ A;  1O7W A;  2WT7 A;  1KYO E;  1K04 A;  4C46 A;  2B24 A;  3KXD A;  1DD4 A;  2N1T B;  1O7N A;  2QJK B;  4AIV A;  3CI9 A;  2KSE A;  3RBZ A;  1YTZ I;  5KLI B;  1WRG A;  1NTM G;  3HUS B;  1NVO A;  1IJD B;  4XFJ A;  1EQ7 A;  3M9H A;  2XSH A;  1FDI A;  3U1C A;  3PRJ A;  1CW5 A;  1VQN P;  1IO4 A;  2E75 C;  3AE2 C;  3C9I A;  5AW9 B;  1EZV E;  3CCM P;  4H44 D;  1VQ5 P;  2N1T D;  1N2D C;  2W6A A;  5CBO A;  1PGO A;  1OW6 A;  5AVS B;  3CXH H;  1IFD A;  2WSE H;  2GUV A;  3AEB C;  1ULI A;  3CWB G;  1VQP P;  5AW5 B;  1JO5 A;  1FBM A;  1BE3 G;  1ZR2 A;  4JYB A;  1RF0 C;  4JYC A;  5M1B A;  1BE3 J;  2D2C B;  1JEK A;  1YIJ P;  2WZ7 A;  1N8R Q;  1RQV A;  2DE7 D;  1Y8A A;  1IFJ A;  3OJA B;  1SFC A;  3RL0 C;  4HKZ H;  4LC1 A;  1M8O B;  1OVV A;  3V2N A;  4RKU J;  2FYU J;  2N9B A;  3Q3D A;  1LT1 A;  3H1H E;  2FYN B;  2GM4 A;  5L8R J;  5AEW A;  2QA4 P;  1URQ C;  5B5E H;  1N7S A;  1VQ8 P;  3H1K G;  3H1I G;  4HM6 A;  1S9K E;  2J59 M;  3H1J E;  1BE3 D;  3M0D A;  1EDI A;  5B66 E;  4WBA A;  5C39 A;  2K9Y A;  3EFG A;  1PGJ A;  1Q81 Q;  5AW0 B;  2KZJ A;  3OAK A;  1KIL D;  1NTM E;  2V7Q J;  2ZYD A;  4Y99 B;  2K1A A;  1FDM A;  3C1L A;  2Q7C A;  1L0N G;  1DEE G;  4H44 C;  3MZW B;  1L0L K;  1E79 H;  2WSF H;  3GF7 A;  1USD A;  1KB9 I;  5TJH A;  3HRN A;  1OWA A;  4OGQ B;  2QPZ A;  3BRT B;  2W90 A;  4WY4 B;  4EOT A;  3FXE A;  2HPC B;  2FKW B;  2JZA A;  3H1J G;  2YVJ B;  1O7H A;  2IZ0 A;  2BCC G;  1J1D C;  1JMB A;  1DD3 A;  3USS A;  1LTJ B;  5E79 E;  2A06 G;  1SQQ J;  3IAO A;  3AEA C;  2HOD A;  2SPZ A;  2GBW A;  2BMO A;  1GL2 C;  1R8E A;  3FWL A;  1SP4 A;  4QUP A;  2QJP B;  4NBF D;  2R5B A;  2DE6 D;  1SQQ G;  4YXD C;  3L72 D;  2JWA A;  3F89 A;  3L72 E;  1H8A A;  2A45 I;  3SFD C;  1QVG O;  1OZH A;  1M1J B;  1O7G A;  2KSJ A;  2IBZ I;  1KQG B;  2PAJ A;  2BCC J;  2H7H A;  2UWJ E;  1BE3 E;  5H2F E;  2NPS D;  3D71 A;  3GCE A;  4H13 B;  2YFJ A;  1M1J A;  4NBG D;  2OYI B;  1HJ0 A;  1M90 Q;  5APW A;  4C7N A;  3L73 G;  3K5B A;  3AE6 C;  2Q9I A;  1RFS A;  2E76 B;  3VMZ A;  1KFM A;  2D2C D;  5KLV G;  2YIU B;  3G9R A;  1IFM A;  3H1J D;  2YO2 A;  3GOB A;  1LNQ A;  5AEU A;  1SLQ A;  3H32 B;  2FYU G;  2ZYG A;  3FWN A;  1DIP A;  1Y9B A;  2A06 E;  2HOD B;  1J1D B;  3RK3 E;  5AVZ B;  4P1C H;  2JO1 A;  4HM5 A;  1VQ6 P;  2GBX A;  1NTZ K;  2OAR A;  3GHG B;  1LTJ A;  1L4A C;  3CXH D;  3VMG D;  2ZVO B;  5AVU B;  1NU1 K;  2QM7 A;  1UUW A;  2FXO A;  5APQ A;  1GU5 A;  1RE4 C;  1NJI Q;  2QJY B;  4PJ0 E;  1BGY D;  1RHZ B;  4H13 C;  1NTK G;  5KJ7 D;  2NUM A;  1K73 Q;  3AE9 C;  4U3F J;  3IN6 A;  1L0L G;  1L4A D;  2ZYL A;  3L35 A;  3CC4 P;  1HF9 A;  1HVV A;  4MN4 C;  1L0L E;  1AFO A;  1WT6 A;  3VMH D;  1Q90 C;  1IFN A;  2B88 A;  3D89 A;  3I55 P;  1JCD A;  3TGU J;  1ZME C;  1CI6 B;  3CXH I;  1FOS F;  2P67 A;  2IYP A;  1VQM P;  2C0W A;  3L75 E;  2CPS A;  3TDK A;  4PD4 D;  1M7L A;  2KNC B;  1H88 A;  3L71 J;  1SJG A;  4HH2 A;  2RH0 A;  3A0H H;  2ZAE B;  2OYH C;  1N7S B;  1YJW P;  1BGY E;  3KHU A;  4HJG H;  3I5C A;  2FYN C;  2NWF A;  1XTC C;  1LT9 A;  3M0D C;  3MUD A;  5E79 H;  2YMK A;  1SQQ K;  2OTL P;  4K35 A;  4WB4 A;  2YKP A;  2KK7 A;  3GTE A;  1KB9 H;  3B5N C;  2ZXX A;  3V4W A;  2PGD A;  1JY2 N;  3TK1 A;  2WPQ A;  1ZXG A;  2WWW A;  1HWT C;  1JOC A;  1P84 I;  1YYC A;  1KQF B;  3R2P A;  3CWB E;  3P7K A;  4I1L A;  1IC2 A;  2GUS A;  4ZKP A;  1VQ4 P;  2OQQ A;  1HBW A;  2AEM A;  2W83 C;  2XNX A;  2YNY A;  3RL0 B;  1VF5 D;  1NU1 G;  2DW3 A;  3VP8 A;  4I6M C;  3GHG C;  2Y0C A;  3NFQ A;  4EI2 A;  1ZW0 A;  3JCU H;  2H8P D;  2M5A A;  2FYZ A;  4BWN A;  1VQ7 P;  2E74 C;  1FOS E;  2E4P A;  3CCL P;  2DE5 D;  2NUK A;  2AXC A;  3JC2 2;  2H88 C;  2VRS A;  3L4F A;  3GZX A;  3AE5 C;  1BCC D;  3Q5R A;  1S72 P;  3RK3 B;  2O3J A;  4NPE A;  3D70 A;  1AV1 A;  1SQP J;  4R4L A;  3MHV A;  3IF4 A;  2WT7 B;  3RK2 B;  1KIL C;  3P8C E;  1K05 A;  2V7Q H;  3L75 D;  1L4A B;  3S4R A;  5BU8 B;  3LID A;  2PFX A;  3EN1 A;  1YIT P;  3SWF A;  1OW8 A;  1NO4 A;  2HMN A;  1PFI A;  2NVE A;  1L0L J;  2Q6Q A;  3H6P A;  1RH5 B;  2J5U A;  4GKG A;  1URQ D;  3H1H G;  5APU A;  4U3F E;  4U3F D;  1O7M A;  1NTM D;  3CX5 H;  3AE3 C;  4N78 D;  4PJ0 H;  2KOG A;  3GMA A;  3AE8 C;  3L75 G;  1PP9 J;  1T8Z A;  2O01 N;  1WMK A;  1NU1 E;  1FZA A;  1ZRT E;  3H1L J;  3VTP C;  4HM8 A;  1D7M A;  4CPG A;  2W6J H;  2JJL A;  4QUR A;  1SQB K;  1Q82 Q;  1RF1 A;  1L0N E;  3H1H D;  3G71 P;  1RE3 A;  3SFE C;  1R5L A;  2IZ1 A;  3CWB D;  1HTL C;  2W8Z A;  1SS1 A;  3UIA A;  1PP9 D;  2HYN A;  3A0B E;  3A7O A;  2R3S A;  4WY4 D;  4OH8 B;  1OW7 A;  2E75 D;  2WSE J;  1KC8 Q;  5EFW B;  5CCG C;  1KMI Z;  3BCC E;  3A2A A;  4AUW A;  2NPS A;  1SQV E;  5KLV J;  1NYH A;  3W67 A;  5KLV E;  2B89 A;  2YXQ B;  3BCC J;  2OYO A;  2I8D A;  1JY3 O;  1TU3 F;  3M91 A;  1FQT A;  2N1T C;  1NOH A;  3L73 J;  1X0T A;  3E1R A;  3U1A A;  1QEX A;  3HE4 A;  2QEX P;  1ZRT D;  2M0B A;  1RF0 A;  3BAT A;  3HTK B;  2FFD C;  4IFF A;  2KI7 B;  1OX3 A;  4U3F G;  2B9B A;  1SQP D;  3L70 G;  1L0N D;  3FXD A;  1FC2 C;  1KB9 E;  4QDF B;  2KB7 P;  2ZT9 C;  4NPF X;  1AQT A;  1FDO A;  3HD7 D;  4ZMD A;  2J58 A;  2A45 G;  1KYO H;  3RGU A;  1EZV G;  3LW5 H;  2YMY A;  3R4Y A;  2FXM A;  4GIF A;  3CCE P;  3C8V A;  3CMA P;  4NB8 D;  1OVU A;  1SQQ D;  5KAI E;  4OGQ C;  1LP1 B;  3G3Z A;  2M3B A;  2WIT A;  4TLF A;  4Y28 J;  1LTB C;  3L70 D;  1L2P A;  3H25 A;  2HLO A;  3JCU E;  1FE6 A;  4ASW A;  3CCV P;  4EMJ B;  1EDJ A;  3CLQ A;  1U57 A;  2M8R A;  2R32 A;  2E74 D;  3VCP A;  3VMY A;  2JWD A;  2HMM A;  1NTK K;  2B1X A;  3A5T A;  4JBZ A;  2NVG A;  3ITK A;  4N3Y B;  3C0D A;  1GK4 A;  1JTH B;  1EDL A;  1GL2 B;  4NBE D;  3PH0 A;  3GLM A;  4HJL A;  1NTM K;  4UB8 H;  4PD4 I;  4BRY B;  1G1I A;  4Z1M H;  4HKV A;  1YTZ T;  1UIX A;  5HL4 A;  1ZV8 A;  1VF5 B;  2LXC B;  2YFL A;  1IK9 A;  5AW2 B;  3HD7 A;  1BDC A;  3KPE A;  4P1B H;  5CCH A;  1RY3 A;  2OYH A;  2Y9Z A;  1SQB G;  2CKF A;  4D6T D;  2JDI H;  1KQL A;  4EIJ A;  2O1J A;  1FZC A;  2E5T A;  3O6Q A;  1NU1 D;  1L0N K;  1OVR A;  3L71 G;  1JM1 A;  2ZT9 D;  4DZO A;  5KLV D;  3G6E P;  1K9M Q;  3BCC G;  4GOE A;  2XND H;  2HML A;  3B5N A;  3WUV A;  3CX5 D;  5KLI C;  3L37 A;  2HMJ A;  2IYO A;  5GTI E;  3AE4 C;  3Q5P A;  2P58 A;  3H1K D;  3O6Q B;  2W27 A;  1OIP A;  1R5S A;  3IFM A;  5CXM A;  4PV1 D;  4EDF A;  3CC7 P;  3GF3 A;  3V6I A;  1P84 E;  4AQR D;  3Q1M A;  1KOR A;  4QDD A;  3M06 A;  1HH0 A;  2HG5 D;  3D6Z A;  4GOF A;  1JMM A;  3HE5 A;  1N73 B;  1E5W A;  1OXZ A;  1CSB A;  4IFM A;  3L74 G;  4YXW H;  2BEQ D;  5DJT B;  4WY4 C;  4BRY A;  3V2P A;  1Z56 A;  3TGU E;  2K9J A;  1YBK A;  1NYK A;  3O8Z A;  1JTH A;  2L5G B;  2WSC H;  3CME P;  2YKQ A;  1BCC E;  4DJG A;  4DT0 A;  4L75 A;  5AVR B;  3BVH A;  3RK3 D;  1RE3 C;  3V2Q A;  1QX8 A;  3TNU A;  1IZN B;  1AVY A;  3TGU G;  2Y9Y A;  1BCC J;  3L74 D;  3VP9 A;  2BCC D;  2ZVN B;  5KAI H;  5APV A;  2L91 A;  2FBW C;  1N7S D;  4W7Z A;  5TIS H;  2HMK A;  2K37 A;  1QL1 A;  2ZFC A;  1J1E B;  3QWO C;  2RMZ A;  2Q3E A;  4L73 A;  2FY8 A;  4IL6 H;  1S4X A;  1X79 B;  2E75 B;  3WUT A;  1U7J A;  1SQB J;  3B8E B;  4K3A A;  4QCK A;  5AW1 B;  4HM1 A;  4QDF A;  2KUB A;  2QJY C;  1K8A Q;  1LTI C;  1KIL A;  3CL3 D;  2C9N Y;  3GTS A;  1KIL E;  1GD2 E;  5AVV B;  1MUU A;  1KB9 D;  2IDB A;  3HE4 B;  1ZN5 A;  4PD4 E;  3H1I E;  4HM2 A;  2RN0 A;  1LT9 C;  3PP5 A;  2IX7 C;  1DEB A;  4HM3 A;  3ZDM A;  1KD1 Q;  1KTM A;  1SQV G;  1LTJ C;  1BSN A;  1LWU B;  2E43 A;  3L72 J;  2NPS B;  2Y0E A;  3TSI A;  1Q7Y Q;  1G1J A;  2LR2 A;  1RE4 A;  1PGQ A;  4ZNC A;  1O7P A;  4W80 A;  1YJ9 P;  2ITA A;  5GTH H;  2KIK A;  1RF1 C;  1PIX A;  3VOP A;  1RF1 B;  1KYO I;  2BAS A;  1J1E C;  1SQQ E;  3FX0 A;  1Q86 Q;  4AYC A;  2QG4 A;  3FGA D;  1ZP0 C;  4BXL A;  3KQG A;  1M1J C;  3I56 P;  2BMQ A;  3CCQ P;  4GDO A;  5KLV K;  3CPW O;  4H44 B;  1NTZ J;  1NTK D;  1JB0 J;  2B87 B;  1YI2 P;  1SFC D;  1G8K B;  1EZV I;  3MGN A;  2A06 D;  2G3A A;  5AW6 B;  5AVW B;  2OTK E;  1PGP A;  5AW8 B;  3AEF C;  1NH4 A;  2Q1K A;  2I7F A;  1URQ B;  3KZI E;  3WU2 H;  4ZKU A;  1NTZ E;  1H0T B;  1N7S C;  3CCR P;  2HFE D;  1S2E A;  1L4A A;  3F5H A;  4PV1 B;  2NZ2 A;  1HJB A;  1AQ5 A;  1Q90 D;  3RK3 C;  2Q3W A;  2KS1 A;  1LTS C;  1PP9 G;  5KTB A;  3GZY A;  4LGD E;  2FXP A;  3AE1 C;  1NKN A;  3PHL A;  3H1J J;  1SQP K;  1HGZ A;  4GOD A;  2E76 D;  2LKM A;  5APT A;  5BOK A;  3EWK A;  2IPP A;  2M5A B;  3CCU P;  3VYI A;  1JY3 N;  3H1H J;  1JY3 P;  3T97 B;  2FYU E;  1KZU B;  2IFN A;  5KJ7 C;  4H13 D;  4QDC A;  1UUV A;  3ABV C;  3H1L D;  1AVO A;  2P7J A;  4OVN F;  2O01 H;  4R4M A;  1A02 F;  3LIE A;  5CHX A;  1VL2 A;  2XSO A;  3N4X A;  3H1I J;  2KYV A;  4DCK A;  1DH3 A;  2V4H A;  1NAF A;  1GDT A;  3S9O A;  3VMI D;  2I1J A;  3T97 A;  1KYO D;  3PTZ A;  1KQS O;  1GW3 A;  3D6Y A;  4DOJ A;  1SQP G;  1Q2N A;  1NTZ D;  2D2C C;  1SQB E;  3RK2 D;  3B5N D;  3KYQ A;  2HMO A;  1PPJ E;  5KAF H;  2JO6 A;  2ZXE B;  1LT9 B;  4JQ0 D;  4HYT B;  1SQX K;  1M1K Q;  4YPC A;  2MKV A;  2KS1 B;  4ASV A;  1NU1 J;  2OGU A;  2YKO A;  4HB1 A;  1BSH A;  2K3R A;  1JY2 P;  1JY2 O;  1PP9 E;  5APX A;  3M9B A;  1QGK B;  1M57 D;  1H0T A;  1NTK E;  2IBZ D;  2KNC A;  1SQB D;  2BEZ F;  4UB6 H;  2YFI A;  1URQ A;  4L74 A;  4D6T G;  5CJ4 A;  5B5E E;  2G8Y A;  1YQ3 C;  1RQU A;  4NB9 D;  4KT0 J;  1CI6 A;  4NBH D;  3L74 E;  4HM7 A;  2XDJ A;  1PPJ G;  1UII A;  2B87 A;  5AW4 B;  5BU5 A;  1NDO A;  4D6T E;  5APS A;  1EG9 A;  2RKL A;  1QLE D;  3Q5S A;  1HGV A;  4IFD K;  3A0B H;  1LGH B;  4M3L A;  3H1K E;  2XU6 A;  5CMZ A;  2XZR A;  2QE7 H;  4L76 A;  3L70 E;  5CBN A;  2JKV A;  2NVF A;  3RL0 D;  1S5L H;  1VPC A;  3L71 D;  3GL2 A;  1PPJ D;  3S1K A;  4QMA A;  3GHG A;  3BCC D;  2WSF J;  1LTT C;  3KZI H;  3WU2 E;  1PV3 A;  1FJK A;  3OW2 O;  3RBX A;  1JUN A;  1LWU A;  3V2R A;  2KXP B;  2O01 J;  1FU1 A;  3H32 A;  2WPV B;  3MTU E;  1OFC X;  4RO0 A;  5AVQ B;  3JSV C;  3KDP B;  3CWB J;  3P32 A;  1AJY A;  2XR8 A;  3NTN A;  3HD7 C;  3LW5 J;  3CCS P;  1X8Y A;  3GL0 A;  3N0Q A;  4RES B;  2P2U A;  4C7N B;  2YXR B;  1KIL B;  3AEG C;  1VQL P;  2OYI A;  2POH A;  2ZJS E;  3TGU D;  1T2K D;  2E74 B;  2JEE A;  4JPZ B;  3GG2 A;  3CCJ P;  3GKE A;  3V5B A;  3MD0 A;  3AEE C;  4JF7 A;  4NBA D;  2NRG A;  4OWF A;  2FYU D;  3AEC C;  1YQ4 C;  3MIW A;  1EDK A;  5H2F H;  1VQ9 P;  3NXS A;  2AEF A;  4IL6 X;  1BGY J;  4A7P A;  2PRR A;  1EZV D;  2Z5H A;  1DX7 A;  1AA0 A;  4XA4 A;  3WMM 0;  3BAS A;  3MUD C;  2E5Y A;  3L75 J;  1SQX J;  5DJU B;  2WQY C;  1CZQ A;  1X9V A;  2BMR A;  3H1K J;  1ULJ A;  4HM0 A;  3TNU B;  3TYY A;  1BGY G;  3SWY A;  5KAF E;  4I2L C;  4UB8 E;  1FZG A;  4QUQ A;  3CX5 I;  3DQY A;  1NAY A;  1J2J B;  2WPR A;  1FZF A;  4D6T J;  2HPC A;  1FJP A;  3U59 A;  5KKZ C;  1T6A A;  4WY4 A;  4LLH A;  1MFT A;  1IK7 A;  4KHX A;  2K9J B;  5BVZ A;  4WVZ A;  1M56 D;  3TF5 A;  3GB4 A;  1SQV D;  3RL0 g;  1ZR4 A;  1N73 C;  3CC2 P;  2H43 A;  2IFM A;  4UB6 E;  3HE5 B;  1N73 A;  4Y99 C;  4WWI A;  2A45 H;  1NTK J;  1S9K D;  5AW3 B;  2FYU K;  1SVF A;  3CD6 P;  2HR3 A;  5APY A;  3FOU A;  1JNM A;  1H89 A;  1N7L A;  1Y47 A;  4AAY B;  1MV8 A;  2AXT E;  3AE7 C;  1NWQ A;  3P8C D;  1G8J B;  2CK3 H;  2ZYA A;  3E1I A;  1VDF A;  5GTI H;  3EQ2 A;  3W68 A;  2N9Y B;  2XRX A;  2R3C A;  3L73 E;  3B5N B;  3VMA A;  1NGM B;  3SWK A;  4H0L D;  2QIW A;  3SSU A;  2WMM A;  3L36 A;  1SQX G;  4B86 A;  2LXB A;  1S5L E;  3MP7 B;  3A0H E;  1HUC A;  1SQV J;  1SFC B;  2KLV A;  3OA7 A;  2OTJ P;  1P84 H;  1NKZ B;  2H89 C;  1JM0 A;  1KFN A;  1FAV A;  1FZC B;  3L72 G;  1PZQ A;  2BCC E;  2IBZ G;  1QL2 A;  1LTA C;  5CCH D;  3L73 D;  2R44 A;  5KKZ B;  2OYH B;  3HD7 B;  1OMI A;  2K88 A;  1VF5 C;  2QRX A;  3V4Q A;  1L0N J;  2WVR A;  3QH9 A;  5KJ7 A;  4TT3 H;  3EFF K;  1KN7 A;  3RK2 C;  1IFP A;  1SQX D;  3B4S A;  1MKM A;  3H1L E;  1FZC C;  1W5C E;  2XV5 A;  3WUU A;  2Q5U A;  1VCK A;  2QJK C;  2Y0D A;  1GL2 A;  3HUS C;  2GA1 A;  2WSC J;  1T3J A;  2C9L Y;  1GU4 A;  2KP8 A;  1T3U A;  3HUS A;  5TIS E;  2ZT9 B;  2P10 A;  3M0A A;  3P8M C;  1LJ2 A;  4HM4 A;  1EC5 A;  5K5G B;  1VQK P;  3H1I D;  4W7Y A;  3GW6 A;  4IL6 E;  3IR9 A;  2MJZ A;  4EYY Q;  1IFI A;  2N1T A;  4PV1 C;  1W2E A;  2WTY A;  4NBB D;  1FZB A;  1USE A;  1FS0 E;  1LP1 A;  1SQP E;  2FFD A;  2P1J A;  3CXH E;  3A3Y B;  1MZ9 A;  1S1C X;  1SQX E;  1L0L D;  3NMD A;  2WPS A;  1S3J A;  4H0L B;  2E4Q A;  1GW4 A;  2Z4E A;  5CJ0 A;  1KV4 A;  3E7K A;  2W6B A;  1GK6 A;  1NTM J;  3EQQ A;  4PD4 H;  2OYI C;  1T2K C;  1SFC C;  2QSI A;  3HTK A;  4NBC D;  2JR8 A;  1EXI A;  1YHQ P;  1NHL A;  1ZLL A;  1VM9 A;  4GT1 A;  3Q2Y A;  3G4S P;  2YIU C;  4N6J A;  1GMJ A;  3AZC A;  3H1L G;  2IBZ E;  4NPD A;  3CX5 E;  1GZL A;  1X22 A;  1LWU C;  5CCG D;  2R5D A;  3B71 A;  2E76 C;  5AVY B;  5GTH E;  5AW7 B;  1EXJ A;  2PP6 A;  1WQL A;  5B66 H;  1VQO P;  2XKM A;  2KLU A;  3II6 A;  5CCG A;  3M9Q A;  4I7Z B;  4YTP C;  4I7Z C;  1GL2 D;  2QM8 A;  1G2C B;  1G2C A;  4KJM A;  2AXT H;  2KZI A;  1MFZ A;  1RIE A;  5AVX B;  2C0X A;  1NTZ G;  2Z5I A;  1S5L X;  4U7J A;  3AED C;  1ZOY C;  2YO3 A;  1PL5 A; 
#chains in the Genus database with same CATH homology
 2E74 D;  3VCP A;  3L75 E;  1G8K B;  2DE5 D;  2HMM A;  4H0L D;  1RFS A;  3VMI D;  1SQP E;  2NUK A;  4QCK A;  2B1X A;  3BCC E;  3L70 E;  5CXM A;  1SQV E;  3CXH E;  2NVG A;  2NVF A;  3GZX A;  4PV1 D;  4HM1 A;  4QDF A;  1SQX E;  1SJG A;  2QPZ A;  2D2C D;  5KLV E;  3C0D A;  2QJP C;  1ULI A;  2QJY C;  3L71 E;  3GL2 A;  2BMR A;  1ULJ A;  1P84 E;  4NBE D;  4QDD A;  2E4Q A;  1BGY E;  3GTS A;  4HM0 A;  1SQB E;  3GOB A;  4HJL A;  1FQT A;  5AEU A;  2HMO A;  2I7F A;  1PPJ E;  2BCC E;  2JO6 A;  4QUQ A;  3DQY A;  1NTZ E;  3VCA A;  4HKV A;  3EQQ A;  2FYN C;  2A06 E;  4PD4 E;  2JZA A;  2NWF A;  3EN1 A;  4OGQ D;  4P1C H;  5HL4 A;  4HM5 A;  2YVJ B;  1O7H A;  3H1I E;  4HM2 A;  5KKZ C;  2DE7 D;  3TGU E;  2GBX A;  2HMN A;  2NVE A;  2YFL A;  3VMG D;  4HM3 A;  2Q3W A;  4NBC D;  1NYK A;  4P1B H;  3GB4 A;  4H44 D;  1VM9 A;  1UUW A;  1PP9 E;  2XR8 A;  3GTE A;  3GZY A;  1KB9 E;  1BCC E;  3H1L E;  4QDF B;  4NBD D;  2YIU C;  2CKF A;  1NTK E;  4U3F E;  2GBW A;  3AZC A;  2IBZ E;  2YFI A;  2BMO A;  3GL0 A;  1O7M A;  1VCK A;  3CX5 E;  3H1H E;  3N0Q A;  1O7W A;  2QJK C;  4QUP A;  5AEW A;  4NBF D;  1KYO E;  2NUM A;  2DE6 D;  2B24 A;  2E76 D;  4HM6 A;  1JM1 A;  1O7P A;  5BOK A;  2ZT9 D;  3H1J E;  1O7N A;  3CWB E;  2ZYL A;  4NB9 D;  4NB8 D;  1WQL A;  3FOU A;  2FYU E;  4NBH D;  4QDC A;  4H13 D;  3L72 E;  1UUV A;  3L74 E;  1NU1 E;  1ZRT E;  4HM7 A;  1L0L E;  4AIV A;  4HM8 A;  3GKE A;  3VMH D;  1Q90 C;  2HMK A;  2HML A;  4QUR A;  1SQQ E;  4AAY B;  1NDO A;  3D89 A;  4D6T E;  4HM4 A;  1O7G A;  1L0N E;  4NBA D;  1EG9 A;  1VF5 D;  1G8J B;  1NTM E;  5KLI C;  1RIE A;  2XSO A;  2XSH A;  2HMJ A;  2BMQ A;  1BE3 E;  3GCE A;  4EMJ B;  2YFJ A;  4NBG D;  2XRX A;  2E4P A;  1EZV E;  3H1K E;  3L73 E;  2E75 D;  4NBB D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...