1SQVE

Crystal structure analysis of bovine bc1 with uhdbt
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome c reductase complex core protein I, mit
total genus 39
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1sqvE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1sqvE02
2A06E 3VCAA 5KKZC 1SQXE 3VCPA 4H44D 2BMOA 4HM2A 2HMMA 2YIUC 4AIVA 2IBZE 3VMGD 3VMHD 2BCCE 1BE3E 3H1HE 4HM8A 2E4QA 1BCCE 4EMJB 3L75E 1G8KB 4NBHD 4QDCA 2QPZA 5HL4A 2I7FA 1FQTA 4HM1A 2B24A 1ULJA 2DE7D 4NBBD 2E74D 4PD4E 4H13D 2DE5D 1SQQE 4H0LD 3GTSA 3DQYA 2HMNA 3CXHE 2JO6A 2YFIA 2NVGA 5CXMA 2JZAA 2NWFA 1UUWA 2BMRA 2Q3WA 2DE6D 1O7NA 3L74E 4QURA 4NBED 3GKEA 4QDDA 2XSOA 3GCEA 2E4PA 5AEUA 4PV1D 2FYUE 1O7PA 4NBGD 1Q90C 2BMQA 2QJPC 3FOUA 2E75D 2NUMA 4P1CH 2GBXA 3GL0A 2CKFA 4QUPA 5BOKA 1EG9A 3BCCE 2NVEA 3GTEA 2ZYLA 1O7MA 2HMOA 2HMKA 3C0DA 1O7WA 3CX5E 2YFJA 2ZT9D 3EQQA 3H1IE 1WQLA 4NB8D 4HM0A 4P1BH 1KB9E 1ZRTE 3GL2A 1VCKA 4QDFB 1O7HA 4AAYB 1NU1E 1RIEA 4HM3A 3L73E 4QUQA 1VF5D 1JM1A 3H1LE 1NDOA 4HKVA 3L70E 3L71E 2QJKC 2YFLA 3CWBE 2XR8A 4HM6A 1ULIA 4HM4A 1SQVE 4OGQD 1SQPE 4QCKA 3EN1A 1BGYE 1NTZE 5KLVE 3TGUE 2E76D 4NBDD 1PP9E 3L72E 1NYKA 1EZVE 1VM9A 1KYOE 2YVJB 4NBCD 2NUKA 3GZXA 1NTME 3GOBA 4NBAD 1L0LE 2FYNC 3GZYA 5AEWA 4HJLA 3N0QA 4HM7A 2XSHA 1P84E 2B1XA 3VMID 3GB4A 3D89A 2GBWA 1PPJE 2NVFA 2HMJA 4D6TE 4NBFD 1NTKE 3AZCA 1RFSA 2HMLA 4NB9D 4U3FE 1SJGA 2XRXA 4HM5A 4QDFA 5KLIC 3H1KE 1UUVA 3H1JE 2D2CD 1L0NE 1O7GA 2QJYC 1SQBE 1G8JB
chains in the Genus database with same CATH superfamily
1ZN5A 1LTBC 1VQ6P 2YIUC 3RBZA 2N1TD 3V4WA 2GM4A 3M0DC 3TDKA 5HL4A 1SQBJ 1RE3A 2PAJA 2HMNA 3S4RA 3V6IA 3V2QA 1JCDA 1T2KC 4RJTA 5CCGD 1URQD 2JZAA 2DE6D 4QURA 1EQ7A 2KZIA 1Q90C 2YKOA 3MGNA 1NTKG 3GTEA 1LP1B 2ZYLA 5AVXB 5AW9B 3M91A 1IK9A 3C0DA 1FZFA 1DD4A 4OVNF 1G2CB 1KB9I 1NU1E 3L73E 5AVYB 3II6A 2FYZA 3RL0g 2J58A 1ULIA 1IFPA 2WPQA 3AE7C 1VM9A 1NKZB 2BCCG 3CCJP 1NTMK 1SP4A 1SVFA 1U7JA 3P32A 1G1IA 3MIWA 3CXHI 4NB9D 2IFMA 2IDBA 3L71D 5APYA 5KAIE 4RKUJ 1KTMA 4LLHA 3BCCJ 4IL6H 2YKPA 1IFIA 4BRYB 4DZOA 5GTHH 1BE3E 1AQ5A 1JY3N 1U57A 2HPCB 4I6MC 3AEFC 3AECC 3RBXA 4HM1A 1ULJA 2DE5D 3DQYA 3H1LG 1NAYA 2XU6A 2WZ7A 3B5NB 2HODA 1S5LH 3G9RA 1SQBG 3EQ2A 1MFTA 2PGDA 4PV1D 1J1DB 2NUMA 1FZAA 1QL2A 1PGQA 1NOHA 2P58A 3OAKA 1UIXA 1KYOI 1GK4A 2K37A 2R3CA 1URQC 4EI2A 3PHLA 4PD4H 3EQQA 2LXBA 2Q9IA 1AA0A 4AAYB 1KQSO 1DH3A 4IFMA 2H7HA 1LNQA 3KYQA 4QMAA 2Q7CA 3EN1A 1JY3P 4HJGH 2GUSA 2FYNB 1EZVE 1NTZG 2FYNC 3KXDA 2FYUD 3HRNA 5KLVK 2FKWB 1NTKK 4JBZA 1YJ9P 2ZVNB 1YYCA 5L8RJ 2ZYAA 3EFGA 3U59A 1ZP0C 1OW6A 4H44C 1LWUA 1X0TA 1PL5A 1N7SA 2JP3A 1OFCX 1KQGB 1BE3D 1M1JB 2POHA 3I56P 2C9LY 2Q1KA 3CLQA 1OX3A 1M57D 4WBAA 2NVGA 5AW6B 2AXCA 2Q3IA 2HFED 3B5NC 2R5BA 2KIKA 2AXTE 2JDIH 2M3BA 1JTHA 1BCCJ 2CK3H 3GCEA 1L0LD 1HGZA 2XKMA 4IOIH 4PJ0E 4P1CH 4N3YB 1EG9A 1NTMD 3SWYA 1GU5A 2OGUA 2HMOA 1PP9D 2YO3A 3PP5A 1J1EB 1IJDB 2Z5HA 2WSEJ 2KK7A 3L70D 3A0HE 1HJ0A 2N1TB 4A7PA 2H8PD 3TSIA 2QG4A 2O01H 1JY2O 3USSA 4OGQC 1NTZE 1QX8A 1SQPJ 2ZJSE 2BEQD 4NBAD 3N0QA 1KILB 3U1AA 3HUSB 2NVFA 2Y0EA 2E74B 3L4FA 3BCCG 1J1EC 1AFOA 1SJGA 2ZXXA 5AVTB 4Y28J 3LIEA 1WT6A 4CPGA 1HWTC 3VMYA 1N73A 1R5SA 3V5BA 5GTIH 5TISE 2FXPA 2Y9YA 1HBWA 1BE3J 1NAFA 2BCCE 2P2UA 1H0TB 1CW5A 1L0ND 1BDCA 5CCGA 2W6BA 2WSFH 2YNYA 3H1KD 4JPZB 1VF5C 2FFDB 2NWFA 3IAOA 1RF0A 3GKEA 1SS1A 2R44A 3Q5PA 1ZLLA 2KOGA 2E75D 2E75B 4C7NB 2KNCA 3L75D 5KAFE 2E5TA 2QJKB 3M9BA 4QDFB 4UB6H 4QUQA 3E1RA 1JM1A 1NKNA 2YFLA 4ZKPA 1LGHB 3VMAA 3TGUE 4GT1A 2E75C 1GTWA 3B5ND 2NUKA 3FWNA 2ZFCA 1EDJA 5AW7B 3G4SP 4PV1B 1FZCC 1ZMEC 1DEBA 1H89A 2WPVB 4H44B 3L37A 2FFDC 2CPBA 1URQB 1SQQD 2FYUG 1M1KQ 2WMMA 2D2CD 2Y0CA 1SFCD 1S4XA 2QJYC 2H89C 3HE5A 3PTZA 3CL3D 3P7KA 2HPCA 5APUA 3I5CA 1YJNP 2WSCJ 3L36A 3W68A 1AV1A 4H0LB 1SQPG 3VP8A 1SQQE 4H0LD 3NTNA 1L0LG 1T2KD 5KLIB 1SQVK 3QH9A 5CXMA 3JCUH 2FYUJ 3A7OA 3FXEA 2XSOA 4GOEA 1PPJD 3VMXA 3CWBG 1EZVD 1YITP 3RL0D 2ITAA 3P8CE 2L5GB 2ZYGA 2KYVA 2BCCJ 3RK3C 3R4YA 3VMZA 1LT9B 4NPDA 1WQLA 4HH2A 3A2AA 1T3JA 3TGUG 3MUDA 1RIEA 2DW3A 1IO4A 4EYYQ 2YKQA 1KB9D 1NO4A 1VQ7P 3W67A 2WWWA 3HD7A 4N78E 3WU2E 4C7NA 3AE4C 3GB4A 2XDJA 4I2LC 1P84H 3L74J 1SQVD 1PP9J 4HM5A 3H1KE 1X9VA 3H25A 2O1KA 2V7QJ 4HM2A 2A45H 3N7NA 1GW4A 3R2PA 1JCCA 3CX5D 1VQ9P 2E4QA 3H32A 1KB9H 3AE5C 5GTHE 3M0DA 1H88A 3UIAA 2QPZA 1IFJA 4NBBD 2W6AA 1KZUB 2WPRA 3CCMP 2K9JA 1E79H 3L74D 5BU5A 2E74C 4WY4D 2R32A 3HUSC 4WY4B 1YTZT 3F89A 3L70J 4H0LC 2N1TA 3TGUD 3SFEC 3CX5E 3L73D 5APWA 3M06A 3H1LE 1YTZI 4YXWH 2XR8A 1SQVE 4QCKA 1HVVA 3IN6A 1SQQK 5CBOA 5B5EH 4OH8B 1OMIA 2NZ2A 1JMMA 2A06G 1EDKA 3V4QA 3OJAB 4HKZH 1NTKE 1BCCG 2FBWC 2J5UA 3M9QA 3H1JE 3IF4A 4DT0A 2K88A 1QVFO 2A45I 1RF0C 1SQXE 3AE6C 1J2JB 2K9JB 1EDLA 2O01J 1JB0J 1KORA 3MTUE 4GIFA 2IBZE 3S9OA 2RH0A 2IBZD 2M5AB 5AW3B 1ZV8A 1M90Q 4JQ0D 4EMJB 4O9BA 2FFDA 2WT7B 5APQA 2B87A 3L75G 3ZDMA 3HE4B 1QEXA 3GMAA 3D71A 3CC7P 1LT9A 3H32B 1PIXA 1FC2C 2UWJE 1XTGB 1S9KD 2OTJP 4GDOA 3TNUB 1W5CE 1LT9C 2KSEA 1IFNA 2AEJA 3B71A 3KHUA 1FZEA 5AVRB 1P84I 1BSNA 3VN0A 2HG5D 3E7KA 1GDTA 1SQXG 5AW2B 2VRSA 3H1IE 3Q5RA 4NB8D 1MZ9A 3KDPB 3RGUA 1GL2B 5M1BA 3L72G 1URQA 1NWQA 3ITKA 2ZAEB 2LKMA 1RE3C 2E5YA 3VTPC 4TLFA 3V2RA 4W7ZA 3L75J 3SWKA 3H1JJ 4M3LA 3CI9A 2W6JH 2P10A 4HYTB 1Q90D 2WVRA 1NTMJ 1KQFB 2Y9ZA 1K73Q 3GZYA 4HJLA 1QLED 3L71G 3WUTA 2OYHB 5AVZB 4NPEA 3LW5J 1VL2A 1RE4A 1DIPA 2QEXP 5KKZC 3VCAA 1N86A 3CCVP 2OTKE 4LGDE 3H1LJ 1VQLP 2WSEH 3O8ZA 1LP1A 3WMM0 1EXJA 3H1HE 5DJUB 1M8OB 3MZWB 1G8KB 1U7MA 5BVZA 4QDCA 1WMKA 2I7FA 1FQTA 3BCCD 2B24A 2DE7D 2K1AA 1NU1J 4EOTA 1G2CA 2MKVA 5KAIH 2YFIA 3H1JD 2Q3EA 1NH4A 2KLUA 4NBED 2FXMA 4QDDA 1O7PA 2R3SA 2M3EA 3AE1C 2JKVA 1SQBK 5BOKA 1FS0E 2K3RA 3WUUA 1VDFA 2M5AA 4L75A 1LTJB 3PRJA 1KMIZ 1VQ5P 4P1BH 1ZOYC 1O7HA 2W83C 3A0HH 1TU3F 3ABVC 1L4AC 5AVSB 1AJYA 1W2EA 1FU1A 3CX5H 5GTIE 3CWBE 2HR3A 2E76B 4BRYA 2I1JA 1NTMG 1KILC 2Z4EA 2E76C 2E76D 4NBDD 2A06D 1MUUA 1N73B 4HM7A 5E79E 3BATA 1NTZD 3WU2H 4D6TE 4H13C 3TF5A 4RO0A 2N9YB 1SQXK 4PD4I 5DJTB 3HUSA 3M9HA 4H13D 1AVOA 3L74G 1X8YA 3VCPA 1YHQP 2G3AA 1DD3A 4UB8H 1K04A 3AE9C 1L0NG 1GK6A 2P7JA 2YMYA 3VMHD 1SFCC 1K05A 2PP6A 1NTZJ 3H1KG 3AEAC 1AVYA 2QSIA 4UB8E 1QVGO 3CXHE 3AE3C 1KFNA 4BWNA 3B8EB 4PJ0H 1UUWA 1FBMA 1X22A 1RE4C 5KJ7A 2GBXA 2ZVOB 3H1HG 4QUPA 3CXHH 5AVUB 3L73J 1LTSC 1KYOD 2KSJA 1RF1A 1FDMA 1O7WA 2M0BA 3EFFK 4HM0A 1KB9E 1ZRTE 2IZ1A 3H1JG 3CD6P 1VCKA 3TNUA 2L91A 1HUCA 5APSA 5APVA 4IL6E 1CZQA 4HM4A 3CCRP 1S5LX 1NYKA 3GOBA 1H0TA 1PGPA 1YQ3C 1SQQG 2GBWA 1PPJE 1L0LJ 1BGYD 5KLVD 4D6TD 2QA4P 2HMLA 1FJKA 3NFQA 4L74A 1S9KE 1KQLA 4QDFA 5KLIC 2ZXEB 1KILD 1FOSF 1JTHB 3GHGB 5AW0B 2A06E 3CPWO 3VMGD 1BGYJ 3KPEA 5KLVJ 1VPCA 2KLVA 5KJ7D 2OARA 3GW6A 4PD4E 1L4AB 1IFMA 4Y99C 2V7QH 3OW2O 3CC4P 3D6YA 4ZNCA 4D6TJ 3L74E 1LTGC 1N7SB 1RQVA 2H88C 2AXTH 1WRGA 3GL0A 1SQPD 1NYHA 1VQOP 2OYOA 1MFZA 1GU4A 1AQTA 4LC1A 5H2FH 2OTLP 3CCUP 1RF1B 4ZKUA 2O3JA 3U1CA 1JY3O 3T97A 2NRGA 2HLOA 3GHGA 1RH5B 3AEGC 1HJBA 3Q1MA 2YXRB 1BDDA 5B66H 2O01N 2P1JA 2HMJA 4GODA 1OW7A 1VF5B 3S1KA 4AYCA 4H44D 2FYUK 4UB6E 1FDIA 2XNXA 2WITA 3NMDA 1ZR2A 3SWFA 1VQKP 4NBHD 1MKMA 3P8CD 5CCHD 4WB4A 2JEEA 3KZIE 2J59M 1JUNA 2RN0A 3AEDC 2QM7A 1GL2D 1KN7A 1KILE 4TT3H 2XNDH 4OWFA 1FZCB 1H8AA 1P84D 3H1IG 1R5LA 1XTCC 2FY8A 4NBGD 2QJPC 1YJWP 3HTKB 3T97B 1USEA 2KS1B 3CWBD 3EWKA 1JMBA 3TYYA 1FAVA 3RL0B 2PFXA 3E1IA 1T8ZA 2N1TC 3L35A 2KI7B 1JO5A 2QJKC 3A0BE 3TGUJ 1GD2E 3MHVA 2A45G 4OGQD 2I1KA 1Y8AA 2JR8A 1LWUC 1KYOE 1FZGA 3A3YB 3JC22 2OYIB 1BGYG 5KLVG 2QM8A 3GZXA 4EIJA 2W27A 1NTZK 3HE5B 2V4HA 1W2BO 1HGVA 1T3UA 4U3FE 1ZR4A 3RK3B 2KP8A 2Q5UA 1L0NK 3CXHD 3RK3D 2NPSB 4W80A 3V2PA 1GW3A 2BMOA 4ZMDA 2HMMA 1SQPK 4ASVA 2IBZI 2Z5IA 1SQVJ 3KQGA 3H1LD 3L75E 3WUVA 1PZQA 1BSHA 5EFWB 2JO1A 1JY2N 3C9IA 3GTSA 1OVVA 1N7SC 1GL2C 2KUBA 2SPZA 3B4SA 1FDOA 4GOFA 3G71P 3Q3DA 1QGKB 4IL6X 2Q3WA 4DOJA 2KXPB 1GL2A 3M0AA 1IZNB 4AUWA 1RQUA 2BMQA 3N4XA 1EC5A 5B5EE 4KHXA 1OVUA 1JEKA 3L73G 1FZCA 1CI6B 3PJSK 1O7MA 3F5HA 3O6QA 2ZT9D 2OYIA 2AEMA 2IFNA 3HTKA 3IFMA 3GHGC 5AW1B 2JWAA 2ZT9B 2N9BA 1KILA 3FX0A 1PFIA 4I7ZB 1OWAA 1D7MA 3GF7A 3RK2B 1N7LA 2ZT9C 3CX5I 4C7RA 3V2NA 3RK2D 4H13B 1E5WA 1FJPA 2QIWA 1VQNP 1L4AD 1BGYE 2XV5A 5KLVE 5K5GB 1GZLA 3RK3E 1N73C 4NBCD 3GLMA 2C0WA 2B1XA 2KS1A 2IPPA 1LTIC 1OW8A 3D89A 3TK1A 1IK7A 4NBFD 3CCQP 1RFSA 2QVAA 4HB1A 2XRXA 2QJYB 1A02F 2KZJA 3FXDA 2P67A 2CPSA 4D6TG 1O7GA 2IBZG 2WQYC 3HD7B 3KZIH 2C9NY 5AW4B 4YTPC 1USDA 1JY2P 4KT0J 1Q82Q 1FOSE 1DX7A 1Q2NA 3H1HD 3P8MC 1S72P 2NPSC 1S1CX 1KD1Q 2IYOA 1OVRA 4WWIA 2QRXA 3L71J 2Q6QA 5APXA 3BVHA 2BMRA 4W7YA 2K9YA 4YXDC 3FOUA 1Q81Q 1IFDA 3VP9A 4R4LA 1LJ2A 2PRRA 1L4AA 3HE4A 3A5TA 1KV4A 5CBNA 2HMKA 5AVVB 2YFJA 1HH0A 1QL1A 3H1IJ 3OA7A 3RK2C 1PP9G 4HM3A 1YIJP 3GG2A 3CCEP 3C8VA 1NDOA 3L70E 5TISH 1N2DC 1SQPE 3MUDC 1KFMA 1PP9E 3PLNA 3NXSA 1ZW0A 1VQ8P 1NHLA 1PV3A 2YVJB 2BEZF 1NTME 3IR9A 2QJPB 2XSHA 5E79H 2YO2A 3O6QB 2W90A 1S5LE 4U3FJ 3JCUE 5KJ7C 2WSCH 1A02J 5BU8B 3FWLA 2ZYDA 4IFFA 3CCSP 2IYPA 1YI2P 3I55P 2OYHA 3MD0A 1KC8Q 1NJIQ 5KAFH 3JSVC 1SQXD 1M7LA 3LIDA 4OGQB 1JM0A 4MN4C 2JO6A 1OZHA 5CHXA 1SQQJ 4DJGA 1EZVG 5AVQB 3K5BA 3VYIA 4N78D 1NTKD 2E4PA 1NGMB 5AEUA 4R4MA 2FYUE 5CCHA 1NU1K 1NVOA 3CMEP 2IZ0A 5KTBA 1S3JA 3VOPA 2H43A 3PH0A 3BCCE 4JYBA 1OIPA 4Z1MH 1JOCA 1SLQA 5C39A 3GL2A 1FE6A 3D6ZA 1RHZB 1RF1C 1FZBA 3RL0C 1VF5D 1BCCD 1PPJG 2C0XA 3L71E 2OYHC 4HM6A 2BCCD 1VQPP 2G8YA 3FGAD 1K8AQ 1L0LK 4JF7A 4IFDK 4C46A 1M1JC 1P84E 2QE7H 2D2CB 1SFCB 2NPSA 5B66E 4B86A 2FXOA 1LTJC 2WPSA 4GKGA 4PV1C 4L73A 1Y9BA 1RY3A 2WSSH 3H1KJ 3A0BH 1G8JB 1NU1D 2B9BA 3CC2P 2WTYA 2HYNA 1NTKJ 3AEBC 2B89A 1CI6A 2RKLA 4HM8A 1LTJA 4WY4A 1PGJA 5AW5B 4ASWA 5AVWB 1MV8A 2Y0DA 4KJMA 3G6EP 2W8ZA 2I8DA 5CJ4A 3H6PA 4U3FD 2RMZA 4L76A 2CKFA 1BE3G 5KKZB 2HODB 4U7JA 2NVEA 1K9MQ 2IX7C 4I1LA 3C1LA 1L2PA 3BRTB 1J1DC 4U3FG 3G3ZA 2YXQB 1LT1A 1DEEG 2GA1A 4K35A 5H2FE 2OQQA 2NPSD 1Z56A 3L72J 3LW5H 2KNCB 5AW8B 4NPFX 3CMAP 1SQXJ 3AE8C 1SQVG 1Y47A 1LWUB 1L0NJ 2R5DA 1T6AA 2B88A 2E42A 1NU1G 1UIIA 2WT7A 1JNMA 2M8RA 2B87B 3BRVB 1UUVA 5CJ0A 4I7ZC 1YQ4C 4PD4D 4Y99B 1IC2A 1L0NE 2LR2A 2JWDA 4BXLA 3B5NA 3CCLP 4WVZA 4AIVA 1S2EA 1PGOA 2KB7P 1BCCE 3D70A 1YBKA 4JYCA 5CMZA 5TJHA 1CSBA 4YPCA 3SFDC 2AEFA 2E74D 4WY4C 2BASA 4DCKA 1SQBD 1SFCA 3QWOC 1VQMP 4K3AA 2XZRA 2YMKA 4AQRD 2GUVA 1O7NA 2WSFJ 1LTAC 2D2CC 2YIUB 1EZVI 1HF9A 1KYOH 1ZXGA 1EXIA 2JJLA 1OXZA 5CCHC 1N7SD 1G1JA 4N6JA 3L72D 2LXCB 1M1JA 3CWBJ 3Q5SA 1N8RQ 1LTTC 3MP7B 2O1JA 3Q2YA 4XA4A 1HTLC 1ZRTD 4XE5B 3H1ID 2MJZA 5CCGC 4HKVA 1GMJA 3HD7D 4EDFA 4XFJA 3L72E 2E43A 1VQ4P 2OYIC 3HD7C 1L0LE 5AEWA 3VMID 3L70G 3H1HJ 1M56D 1Q86Q 3SSUA 3AZCA 3BASA 4RESB 1EDIA 3AE2C 1Q7YQ 3AEEC 3GF3A 1R8EA 1X79B 5APTA 1SQBE
chains in the Genus database with same CATH topology
2A06E 3VCAA 5KKZC 1SQXE 3VCPA 4H44D 2BMOA 4HM2A 2HMMA 2YIUC 4AIVA 2IBZE 3VMGD 3VMHD 2BCCE 1BE3E 3H1HE 4HM8A 2E4QA 1BCCE 4EMJB 3L75E 1G8KB 4NBHD 4QDCA 2QPZA 5HL4A 2I7FA 1FQTA 4HM1A 2B24A 1ULJA 2DE7D 4NBBD 2E74D 4PD4E 4H13D 2DE5D 1SQQE 4H0LD 3GTSA 3DQYA 2HMNA 3CXHE 2JO6A 2YFIA 2NVGA 5CXMA 2JZAA 2NWFA 1UUWA 2BMRA 2Q3WA 2DE6D 1O7NA 3L74E 4QURA 4NBED 3GKEA 4QDDA 2XSOA 3GCEA 2E4PA 5AEUA 4PV1D 2FYUE 1O7PA 4NBGD 1Q90C 2BMQA 2QJPC 3FOUA 2E75D 2NUMA 4P1CH 2GBXA 3GL0A 2CKFA 4QUPA 5BOKA 1EG9A 3BCCE 2NVEA 3GTEA 2ZYLA 1O7MA 2HMOA 2HMKA 3C0DA 1O7WA 3CX5E 2YFJA 2ZT9D 3EQQA 3H1IE 1WQLA 4NB8D 4HM0A 4P1BH 1KB9E 1ZRTE 3GL2A 1VCKA 4QDFB 1O7HA 4AAYB 1NU1E 1RIEA 4HM3A 3L73E 4QUQA 1VF5D 1JM1A 3H1LE 1NDOA 4HKVA 3L70E 3L71E 2QJKC 2YFLA 3CWBE 2XR8A 4HM6A 1ULIA 4HM4A 1SQVE 4OGQD 1SQPE 4QCKA 3EN1A 1BGYE 1NTZE 5KLVE 3TGUE 2E76D 4NBDD 1PP9E 3L72E 1NYKA 1EZVE 1VM9A 1KYOE 2YVJB 4NBCD 2NUKA 3GZXA 1NTME 3GOBA 4NBAD 1L0LE 2FYNC 3GZYA 5AEWA 4HJLA 3N0QA 4HM7A 2XSHA 1P84E 2B1XA 3VMID 3GB4A 3D89A 2GBWA 1PPJE 2NVFA 2HMJA 4D6TE 4NBFD 1NTKE 3AZCA 1RFSA 2HMLA 4NB9D 4U3FE 1SJGA 2XRXA 4HM5A 4QDFA 5KLIC 3H1KE 1UUVA 3H1JE 2D2CD 1L0NE 1O7GA 2QJYC 1SQBE 1G8JB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A06 E;  3VCA A;  5KKZ C;  1SQX E;  3VCP A;  4H44 D;  2BMO A;  4HM2 A;  2HMM A;  2YIU C;  4AIV A;  2IBZ E;  3VMG D;  3VMH D;  2BCC E;  1BE3 E;  3H1H E;  4HM8 A;  2E4Q A;  1BCC E;  4EMJ B;  3L75 E;  1G8K B;  4NBH D;  4QDC A;  2QPZ A;  5HL4 A;  2I7F A;  1FQT A;  4HM1 A;  2B24 A;  1ULJ A;  2DE7 D;  4NBB D;  2E74 D;  4PD4 E;  4H13 D;  2DE5 D;  1SQQ E;  4H0L D;  3GTS A;  3DQY A;  2HMN A;  3CXH E;  2JO6 A;  2YFI A;  2NVG A;  5CXM A;  2JZA A;  2NWF A;  1UUW A;  2BMR A;  2Q3W A;  2DE6 D;  1O7N A;  3L74 E;  4QUR A;  4NBE D;  3GKE A;  4QDD A;  2XSO A;  3GCE A;  2E4P A;  5AEU A;  4PV1 D;  2FYU E;  1O7P A;  4NBG D;  1Q90 C;  2BMQ A;  2QJP C;  3FOU A;  2E75 D;  2NUM A;  4P1C H;  2GBX A;  3GL0 A;  2CKF A;  4QUP A;  5BOK A;  1EG9 A;  3BCC E;  2NVE A;  3GTE A;  2ZYL A;  1O7M A;  2HMO A;  2HMK A;  3C0D A;  1O7W A;  3CX5 E;  2YFJ A;  2ZT9 D;  3EQQ A;  3H1I E;  1WQL A;  4NB8 D;  4HM0 A;  4P1B H;  1KB9 E;  1ZRT E;  3GL2 A;  1VCK A;  4QDF B;  1O7H A;  4AAY B;  1NU1 E;  1RIE A;  4HM3 A;  3L73 E;  4QUQ A;  1VF5 D;  1JM1 A;  3H1L E;  1NDO A;  4HKV A;  3L70 E;  3L71 E;  2QJK C;  2YFL A;  3CWB E;  2XR8 A;  4HM6 A;  1ULI A;  4HM4 A;  1SQV E;  4OGQ D;  1SQP E;  4QCK A;  3EN1 A;  1BGY E;  1NTZ E;  5KLV E;  3TGU E;  2E76 D;  4NBD D;  1PP9 E;  3L72 E;  1NYK A;  1EZV E;  1VM9 A;  1KYO E;  2YVJ B;  4NBC D;  2NUK A;  3GZX A;  1NTM E;  3GOB A;  4NBA D;  1L0L E;  2FYN C;  3GZY A;  5AEW A;  4HJL A;  3N0Q A;  4HM7 A;  2XSH A;  1P84 E;  2B1X A;  3VMI D;  3GB4 A;  3D89 A;  2GBW A;  1PPJ E;  2NVF A;  2HMJ A;  4D6T E;  4NBF D;  1NTK E;  3AZC A;  1RFS A;  2HML A;  4NB9 D;  4U3F E;  1SJG A;  2XRX A;  4HM5 A;  4QDF A;  5KLI C;  3H1K E;  1UUV A;  3H1J E;  2D2C D;  1L0N E;  1O7G A;  2QJY C;  1SQB E;  1G8J B; 
#chains in the Genus database with same CATH topology
 1ZN5 A;  1LTB C;  1VQ6 P;  2YIU C;  3RBZ A;  2N1T D;  3V4W A;  2GM4 A;  3M0D C;  3TDK A;  5HL4 A;  1SQB J;  1RE3 A;  2PAJ A;  2HMN A;  3S4R A;  3V6I A;  3V2Q A;  1JCD A;  1T2K C;  4RJT A;  5CCG D;  1URQ D;  2JZA A;  2DE6 D;  4QUR A;  1EQ7 A;  2KZI A;  1Q90 C;  2YKO A;  3MGN A;  1NTK G;  3GTE A;  1LP1 B;  2ZYL A;  5AVX B;  5AW9 B;  3M91 A;  1IK9 A;  3C0D A;  1FZF A;  1DD4 A;  4OVN F;  1G2C B;  1KB9 I;  1NU1 E;  3L73 E;  5AVY B;  3II6 A;  2FYZ A;  3RL0 g;  2J58 A;  1ULI A;  1IFP A;  2WPQ A;  3AE7 C;  1VM9 A;  1NKZ B;  2BCC G;  3CCJ P;  1NTM K;  1SP4 A;  1SVF A;  1U7J A;  3P32 A;  1G1I A;  3MIW A;  3CXH I;  4NB9 D;  2IFM A;  2IDB A;  3L71 D;  5APY A;  5KAI E;  4RKU J;  1KTM A;  4LLH A;  3BCC J;  4IL6 H;  2YKP A;  1IFI A;  4BRY B;  4DZO A;  5GTH H;  1BE3 E;  1AQ5 A;  1JY3 N;  1U57 A;  2HPC B;  4I6M C;  3AEF C;  3AEC C;  3RBX A;  4HM1 A;  1ULJ A;  2DE5 D;  3DQY A;  3H1L G;  1NAY A;  2XU6 A;  2WZ7 A;  3B5N B;  2HOD A;  1S5L H;  3G9R A;  1SQB G;  3EQ2 A;  1MFT A;  2PGD A;  4PV1 D;  1J1D B;  2NUM A;  1FZA A;  1QL2 A;  1PGQ A;  1NOH A;  2P58 A;  3OAK A;  1UIX A;  1KYO I;  1GK4 A;  2K37 A;  2R3C A;  1URQ C;  4EI2 A;  3PHL A;  4PD4 H;  3EQQ A;  2LXB A;  2Q9I A;  1AA0 A;  4AAY B;  1KQS O;  1DH3 A;  4IFM A;  2H7H A;  1LNQ A;  3KYQ A;  4QMA A;  2Q7C A;  3EN1 A;  1JY3 P;  4HJG H;  2GUS A;  2FYN B;  1EZV E;  1NTZ G;  2FYN C;  3KXD A;  2FYU D;  3HRN A;  5KLV K;  2FKW B;  1NTK K;  4JBZ A;  1YJ9 P;  2ZVN B;  1YYC A;  5L8R J;  2ZYA A;  3EFG A;  3U59 A;  1ZP0 C;  1OW6 A;  4H44 C;  1LWU A;  1X0T A;  1PL5 A;  1N7S A;  2JP3 A;  1OFC X;  1KQG B;  1BE3 D;  1M1J B;  2POH A;  3I56 P;  2C9L Y;  2Q1K A;  3CLQ A;  1OX3 A;  1M57 D;  4WBA A;  2NVG A;  5AW6 B;  2AXC A;  2Q3I A;  2HFE D;  3B5N C;  2R5B A;  2KIK A;  2AXT E;  2JDI H;  2M3B A;  1JTH A;  1BCC J;  2CK3 H;  3GCE A;  1L0L D;  1HGZ A;  2XKM A;  4IOI H;  4PJ0 E;  4P1C H;  4N3Y B;  1EG9 A;  1NTM D;  3SWY A;  1GU5 A;  2OGU A;  2HMO A;  1PP9 D;  2YO3 A;  3PP5 A;  1J1E B;  1IJD B;  2Z5H A;  2WSE J;  2KK7 A;  3L70 D;  3A0H E;  1HJ0 A;  2N1T B;  4A7P A;  2H8P D;  3TSI A;  2QG4 A;  2O01 H;  1JY2 O;  3USS A;  4OGQ C;  1NTZ E;  1QX8 A;  1SQP J;  2ZJS E;  2BEQ D;  4NBA D;  3N0Q A;  1KIL B;  3U1A A;  3HUS B;  2NVF A;  2Y0E A;  2E74 B;  3L4F A;  3BCC G;  1J1E C;  1AFO A;  1SJG A;  2ZXX A;  5AVT B;  4Y28 J;  3LIE A;  1WT6 A;  4CPG A;  1HWT C;  3VMY A;  1N73 A;  1R5S A;  3V5B A;  5GTI H;  5TIS E;  2FXP A;  2Y9Y A;  1HBW A;  1BE3 J;  1NAF A;  2BCC E;  2P2U A;  1H0T B;  1CW5 A;  1L0N D;  1BDC A;  5CCG A;  2W6B A;  2WSF H;  2YNY A;  3H1K D;  4JPZ B;  1VF5 C;  2FFD B;  2NWF A;  3IAO A;  1RF0 A;  3GKE A;  1SS1 A;  2R44 A;  3Q5P A;  1ZLL A;  2KOG A;  2E75 D;  2E75 B;  4C7N B;  2KNC A;  3L75 D;  5KAF E;  2E5T A;  2QJK B;  3M9B A;  4QDF B;  4UB6 H;  4QUQ A;  3E1R A;  1JM1 A;  1NKN A;  2YFL A;  4ZKP A;  1LGH B;  3VMA A;  3TGU E;  4GT1 A;  2E75 C;  1GTW A;  3B5N D;  2NUK A;  3FWN A;  2ZFC A;  1EDJ A;  5AW7 B;  3G4S P;  4PV1 B;  1FZC C;  1ZME C;  1DEB A;  1H89 A;  2WPV B;  4H44 B;  3L37 A;  2FFD C;  2CPB A;  1URQ B;  1SQQ D;  2FYU G;  1M1K Q;  2WMM A;  2D2C D;  2Y0C A;  1SFC D;  1S4X A;  2QJY C;  2H89 C;  3HE5 A;  3PTZ A;  3CL3 D;  3P7K A;  2HPC A;  5APU A;  3I5C A;  1YJN P;  2WSC J;  3L36 A;  3W68 A;  1AV1 A;  4H0L B;  1SQP G;  3VP8 A;  1SQQ E;  4H0L D;  3NTN A;  1L0L G;  1T2K D;  5KLI B;  1SQV K;  3QH9 A;  5CXM A;  3JCU H;  2FYU J;  3A7O A;  3FXE A;  2XSO A;  4GOE A;  1PPJ D;  3VMX A;  3CWB G;  1EZV D;  1YIT P;  3RL0 D;  2ITA A;  3P8C E;  2L5G B;  2ZYG A;  2KYV A;  2BCC J;  3RK3 C;  3R4Y A;  3VMZ A;  1LT9 B;  4NPD A;  1WQL A;  4HH2 A;  3A2A A;  1T3J A;  3TGU G;  3MUD A;  1RIE A;  2DW3 A;  1IO4 A;  4EYY Q;  2YKQ A;  1KB9 D;  1NO4 A;  1VQ7 P;  3W67 A;  2WWW A;  3HD7 A;  4N78 E;  3WU2 E;  4C7N A;  3AE4 C;  3GB4 A;  2XDJ A;  4I2L C;  1P84 H;  3L74 J;  1SQV D;  1PP9 J;  4HM5 A;  3H1K E;  1X9V A;  3H25 A;  2O1K A;  2V7Q J;  4HM2 A;  2A45 H;  3N7N A;  1GW4 A;  3R2P A;  1JCC A;  3CX5 D;  1VQ9 P;  2E4Q A;  3H32 A;  1KB9 H;  3AE5 C;  5GTH E;  3M0D A;  1H88 A;  3UIA A;  2QPZ A;  1IFJ A;  4NBB D;  2W6A A;  1KZU B;  2WPR A;  3CCM P;  2K9J A;  1E79 H;  3L74 D;  5BU5 A;  2E74 C;  4WY4 D;  2R32 A;  3HUS C;  4WY4 B;  1YTZ T;  3F89 A;  3L70 J;  4H0L C;  2N1T A;  3TGU D;  3SFE C;  3CX5 E;  3L73 D;  5APW A;  3M06 A;  3H1L E;  1YTZ I;  4YXW H;  2XR8 A;  1SQV E;  4QCK A;  1HVV A;  3IN6 A;  1SQQ K;  5CBO A;  5B5E H;  4OH8 B;  1OMI A;  2NZ2 A;  1JMM A;  2A06 G;  1EDK A;  3V4Q A;  3OJA B;  4HKZ H;  1NTK E;  1BCC G;  2FBW C;  2J5U A;  3M9Q A;  3H1J E;  3IF4 A;  4DT0 A;  2K88 A;  1QVF O;  2A45 I;  1RF0 C;  1SQX E;  3AE6 C;  1J2J B;  2K9J B;  1EDL A;  2O01 J;  1JB0 J;  1KOR A;  3MTU E;  4GIF A;  2IBZ E;  3S9O A;  2RH0 A;  2IBZ D;  2M5A B;  5AW3 B;  1ZV8 A;  1M90 Q;  4JQ0 D;  4EMJ B;  4O9B A;  2FFD A;  2WT7 B;  5APQ A;  2B87 A;  3L75 G;  3ZDM A;  3HE4 B;  1QEX A;  3GMA A;  3D71 A;  3CC7 P;  1LT9 A;  3H32 B;  1PIX A;  1FC2 C;  2UWJ E;  1XTG B;  1S9K D;  2OTJ P;  4GDO A;  3TNU B;  1W5C E;  1LT9 C;  2KSE A;  1IFN A;  2AEJ A;  3B71 A;  3KHU A;  1FZE A;  5AVR B;  1P84 I;  1BSN A;  3VN0 A;  2HG5 D;  3E7K A;  1GDT A;  1SQX G;  5AW2 B;  2VRS A;  3H1I E;  3Q5R A;  4NB8 D;  1MZ9 A;  3KDP B;  3RGU A;  1GL2 B;  5M1B A;  3L72 G;  1URQ A;  1NWQ A;  3ITK A;  2ZAE B;  2LKM A;  1RE3 C;  2E5Y A;  3VTP C;  4TLF A;  3V2R A;  4W7Z A;  3L75 J;  3SWK A;  3H1J J;  4M3L A;  3CI9 A;  2W6J H;  2P10 A;  4HYT B;  1Q90 D;  2WVR A;  1NTM J;  1KQF B;  2Y9Z A;  1K73 Q;  3GZY A;  4HJL A;  1QLE D;  3L71 G;  3WUT A;  2OYH B;  5AVZ B;  4NPE A;  3LW5 J;  1VL2 A;  1RE4 A;  1DIP A;  2QEX P;  5KKZ C;  3VCA A;  1N86 A;  3CCV P;  2OTK E;  4LGD E;  3H1L J;  1VQL P;  2WSE H;  3O8Z A;  1LP1 A;  3WMM 0;  1EXJ A;  3H1H E;  5DJU B;  1M8O B;  3MZW B;  1G8K B;  1U7M A;  5BVZ A;  4QDC A;  1WMK A;  2I7F A;  1FQT A;  3BCC D;  2B24 A;  2DE7 D;  2K1A A;  1NU1 J;  4EOT A;  1G2C A;  2MKV A;  5KAI H;  2YFI A;  3H1J D;  2Q3E A;  1NH4 A;  2KLU A;  4NBE D;  2FXM A;  4QDD A;  1O7P A;  2R3S A;  2M3E A;  3AE1 C;  2JKV A;  1SQB K;  5BOK A;  1FS0 E;  2K3R A;  3WUU A;  1VDF A;  2M5A A;  4L75 A;  1LTJ B;  3PRJ A;  1KMI Z;  1VQ5 P;  4P1B H;  1ZOY C;  1O7H A;  2W83 C;  3A0H H;  1TU3 F;  3ABV C;  1L4A C;  5AVS B;  1AJY A;  1W2E A;  1FU1 A;  3CX5 H;  5GTI E;  3CWB E;  2HR3 A;  2E76 B;  4BRY A;  2I1J A;  1NTM G;  1KIL C;  2Z4E A;  2E76 C;  2E76 D;  4NBD D;  2A06 D;  1MUU A;  1N73 B;  4HM7 A;  5E79 E;  3BAT A;  1NTZ D;  3WU2 H;  4D6T E;  4H13 C;  3TF5 A;  4RO0 A;  2N9Y B;  1SQX K;  4PD4 I;  5DJT B;  3HUS A;  3M9H A;  4H13 D;  1AVO A;  3L74 G;  1X8Y A;  3VCP A;  1YHQ P;  2G3A A;  1DD3 A;  4UB8 H;  1K04 A;  3AE9 C;  1L0N G;  1GK6 A;  2P7J A;  2YMY A;  3VMH D;  1SFC C;  1K05 A;  2PP6 A;  1NTZ J;  3H1K G;  3AEA C;  1AVY A;  2QSI A;  4UB8 E;  1QVG O;  3CXH E;  3AE3 C;  1KFN A;  4BWN A;  3B8E B;  4PJ0 H;  1UUW A;  1FBM A;  1X22 A;  1RE4 C;  5KJ7 A;  2GBX A;  2ZVO B;  3H1H G;  4QUP A;  3CXH H;  5AVU B;  3L73 J;  1LTS C;  1KYO D;  2KSJ A;  1RF1 A;  1FDM A;  1O7W A;  2M0B A;  3EFF K;  4HM0 A;  1KB9 E;  1ZRT E;  2IZ1 A;  3H1J G;  3CD6 P;  1VCK A;  3TNU A;  2L91 A;  1HUC A;  5APS A;  5APV A;  4IL6 E;  1CZQ A;  4HM4 A;  3CCR P;  1S5L X;  1NYK A;  3GOB A;  1H0T A;  1PGP A;  1YQ3 C;  1SQQ G;  2GBW A;  1PPJ E;  1L0L J;  1BGY D;  5KLV D;  4D6T D;  2QA4 P;  2HML A;  1FJK A;  3NFQ A;  4L74 A;  1S9K E;  1KQL A;  4QDF A;  5KLI C;  2ZXE B;  1KIL D;  1FOS F;  1JTH B;  3GHG B;  5AW0 B;  2A06 E;  3CPW O;  3VMG D;  1BGY J;  3KPE A;  5KLV J;  1VPC A;  2KLV A;  5KJ7 D;  2OAR A;  3GW6 A;  4PD4 E;  1L4A B;  1IFM A;  4Y99 C;  2V7Q H;  3OW2 O;  3CC4 P;  3D6Y A;  4ZNC A;  4D6T J;  3L74 E;  1LTG C;  1N7S B;  1RQV A;  2H88 C;  2AXT H;  1WRG A;  3GL0 A;  1SQP D;  1NYH A;  1VQO P;  2OYO A;  1MFZ A;  1GU4 A;  1AQT A;  4LC1 A;  5H2F H;  2OTL P;  3CCU P;  1RF1 B;  4ZKU A;  2O3J A;  3U1C A;  1JY3 O;  3T97 A;  2NRG A;  2HLO A;  3GHG A;  1RH5 B;  3AEG C;  1HJB A;  3Q1M A;  2YXR B;  1BDD A;  5B66 H;  2O01 N;  2P1J A;  2HMJ A;  4GOD A;  1OW7 A;  1VF5 B;  3S1K A;  4AYC A;  4H44 D;  2FYU K;  4UB6 E;  1FDI A;  2XNX A;  2WIT A;  3NMD A;  1ZR2 A;  3SWF A;  1VQK P;  4NBH D;  1MKM A;  3P8C D;  5CCH D;  4WB4 A;  2JEE A;  3KZI E;  2J59 M;  1JUN A;  2RN0 A;  3AED C;  2QM7 A;  1GL2 D;  1KN7 A;  1KIL E;  4TT3 H;  2XND H;  4OWF A;  1FZC B;  1H8A A;  1P84 D;  3H1I G;  1R5L A;  1XTC C;  2FY8 A;  4NBG D;  2QJP C;  1YJW P;  3HTK B;  3T97 B;  1USE A;  2KS1 B;  3CWB D;  3EWK A;  1JMB A;  3TYY A;  1FAV A;  3RL0 B;  2PFX A;  3E1I A;  1T8Z A;  2N1T C;  3L35 A;  2KI7 B;  1JO5 A;  2QJK C;  3A0B E;  3TGU J;  1GD2 E;  3MHV A;  2A45 G;  4OGQ D;  2I1K A;  1Y8A A;  2JR8 A;  1LWU C;  1KYO E;  1FZG A;  3A3Y B;  3JC2 2;  2OYI B;  1BGY G;  5KLV G;  2QM8 A;  3GZX A;  4EIJ A;  2W27 A;  1NTZ K;  3HE5 B;  2V4H A;  1W2B O;  1HGV A;  1T3U A;  4U3F E;  1ZR4 A;  3RK3 B;  2KP8 A;  2Q5U A;  1L0N K;  3CXH D;  3RK3 D;  2NPS B;  4W80 A;  3V2P A;  1GW3 A;  2BMO A;  4ZMD A;  2HMM A;  1SQP K;  4ASV A;  2IBZ I;  2Z5I A;  1SQV J;  3KQG A;  3H1L D;  3L75 E;  3WUV A;  1PZQ A;  1BSH A;  5EFW B;  2JO1 A;  1JY2 N;  3C9I A;  3GTS A;  1OVV A;  1N7S C;  1GL2 C;  2KUB A;  2SPZ A;  3B4S A;  1FDO A;  4GOF A;  3G71 P;  3Q3D A;  1QGK B;  4IL6 X;  2Q3W A;  4DOJ A;  2KXP B;  1GL2 A;  3M0A A;  1IZN B;  4AUW A;  1RQU A;  2BMQ A;  3N4X A;  1EC5 A;  5B5E E;  4KHX A;  1OVU A;  1JEK A;  3L73 G;  1FZC A;  1CI6 B;  3PJS K;  1O7M A;  3F5H A;  3O6Q A;  2ZT9 D;  2OYI A;  2AEM A;  2IFN A;  3HTK A;  3IFM A;  3GHG C;  5AW1 B;  2JWA A;  2ZT9 B;  2N9B A;  1KIL A;  3FX0 A;  1PFI A;  4I7Z B;  1OWA A;  1D7M A;  3GF7 A;  3RK2 B;  1N7L A;  2ZT9 C;  3CX5 I;  4C7R A;  3V2N A;  3RK2 D;  4H13 B;  1E5W A;  1FJP A;  2QIW A;  1VQN P;  1L4A D;  1BGY E;  2XV5 A;  5KLV E;  5K5G B;  1GZL A;  3RK3 E;  1N73 C;  4NBC D;  3GLM A;  2C0W A;  2B1X A;  2KS1 A;  2IPP A;  1LTI C;  1OW8 A;  3D89 A;  3TK1 A;  1IK7 A;  4NBF D;  3CCQ P;  1RFS A;  2QVA A;  4HB1 A;  2XRX A;  2QJY B;  1A02 F;  2KZJ A;  3FXD A;  2P67 A;  2CPS A;  4D6T G;  1O7G A;  2IBZ G;  2WQY C;  3HD7 B;  3KZI H;  2C9N Y;  5AW4 B;  4YTP C;  1USD A;  1JY2 P;  4KT0 J;  1Q82 Q;  1FOS E;  1DX7 A;  1Q2N A;  3H1H D;  3P8M C;  1S72 P;  2NPS C;  1S1C X;  1KD1 Q;  2IYO A;  1OVR A;  4WWI A;  2QRX A;  3L71 J;  2Q6Q A;  5APX A;  3BVH A;  2BMR A;  4W7Y A;  2K9Y A;  4YXD C;  3FOU A;  1Q81 Q;  1IFD A;  3VP9 A;  4R4L A;  1LJ2 A;  2PRR A;  1L4A A;  3HE4 A;  3A5T A;  1KV4 A;  5CBN A;  2HMK A;  5AVV B;  2YFJ A;  1HH0 A;  1QL1 A;  3H1I J;  3OA7 A;  3RK2 C;  1PP9 G;  4HM3 A;  1YIJ P;  3GG2 A;  3CCE P;  3C8V A;  1NDO A;  3L70 E;  5TIS H;  1N2D C;  1SQP E;  3MUD C;  1KFM A;  1PP9 E;  3PLN A;  3NXS A;  1ZW0 A;  1VQ8 P;  1NHL A;  1PV3 A;  2YVJ B;  2BEZ F;  1NTM E;  3IR9 A;  2QJP B;  2XSH A;  5E79 H;  2YO2 A;  3O6Q B;  2W90 A;  1S5L E;  4U3F J;  3JCU E;  5KJ7 C;  2WSC H;  1A02 J;  5BU8 B;  3FWL A;  2ZYD A;  4IFF A;  3CCS P;  2IYP A;  1YI2 P;  3I55 P;  2OYH A;  3MD0 A;  1KC8 Q;  1NJI Q;  5KAF H;  3JSV C;  1SQX D;  1M7L A;  3LID A;  4OGQ B;  1JM0 A;  4MN4 C;  2JO6 A;  1OZH A;  5CHX A;  1SQQ J;  4DJG A;  1EZV G;  5AVQ B;  3K5B A;  3VYI A;  4N78 D;  1NTK D;  2E4P A;  1NGM B;  5AEU A;  4R4M A;  2FYU E;  5CCH A;  1NU1 K;  1NVO A;  3CME P;  2IZ0 A;  5KTB A;  1S3J A;  3VOP A;  2H43 A;  3PH0 A;  3BCC E;  4JYB A;  1OIP A;  4Z1M H;  1JOC A;  1SLQ A;  5C39 A;  3GL2 A;  1FE6 A;  3D6Z A;  1RHZ B;  1RF1 C;  1FZB A;  3RL0 C;  1VF5 D;  1BCC D;  1PPJ G;  2C0X A;  3L71 E;  2OYH C;  4HM6 A;  2BCC D;  1VQP P;  2G8Y A;  3FGA D;  1K8A Q;  1L0L K;  4JF7 A;  4IFD K;  4C46 A;  1M1J C;  1P84 E;  2QE7 H;  2D2C B;  1SFC B;  2NPS A;  5B66 E;  4B86 A;  2FXO A;  1LTJ C;  2WPS A;  4GKG A;  4PV1 C;  4L73 A;  1Y9B A;  1RY3 A;  2WSS H;  3H1K J;  3A0B H;  1G8J B;  1NU1 D;  2B9B A;  3CC2 P;  2WTY A;  2HYN A;  1NTK J;  3AEB C;  2B89 A;  1CI6 A;  2RKL A;  4HM8 A;  1LTJ A;  4WY4 A;  1PGJ A;  5AW5 B;  4ASW A;  5AVW B;  1MV8 A;  2Y0D A;  4KJM A;  3G6E P;  2W8Z A;  2I8D A;  5CJ4 A;  3H6P A;  4U3F D;  2RMZ A;  4L76 A;  2CKF A;  1BE3 G;  5KKZ B;  2HOD B;  4U7J A;  2NVE A;  1K9M Q;  2IX7 C;  4I1L A;  3C1L A;  1L2P A;  3BRT B;  1J1D C;  4U3F G;  3G3Z A;  2YXQ B;  1LT1 A;  1DEE G;  2GA1 A;  4K35 A;  5H2F E;  2OQQ A;  2NPS D;  1Z56 A;  3L72 J;  3LW5 H;  2KNC B;  5AW8 B;  4NPF X;  3CMA P;  1SQX J;  3AE8 C;  1SQV G;  1Y47 A;  1LWU B;  1L0N J;  2R5D A;  1T6A A;  2B88 A;  2E42 A;  1NU1 G;  1UII A;  2WT7 A;  1JNM A;  2M8R A;  2B87 B;  3BRV B;  1UUV A;  5CJ0 A;  4I7Z C;  1YQ4 C;  4PD4 D;  4Y99 B;  1IC2 A;  1L0N E;  2LR2 A;  2JWD A;  4BXL A;  3B5N A;  3CCL P;  4WVZ A;  4AIV A;  1S2E A;  1PGO A;  2KB7 P;  1BCC E;  3D70 A;  1YBK A;  4JYC A;  5CMZ A;  5TJH A;  1CSB A;  4YPC A;  3SFD C;  2AEF A;  2E74 D;  4WY4 C;  2BAS A;  4DCK A;  1SQB D;  1SFC A;  3QWO C;  1VQM P;  4K3A A;  2XZR A;  2YMK A;  4AQR D;  2GUV A;  1O7N A;  2WSF J;  1LTA C;  2D2C C;  2YIU B;  1EZV I;  1HF9 A;  1KYO H;  1ZXG A;  1EXI A;  2JJL A;  1OXZ A;  5CCH C;  1N7S D;  1G1J A;  4N6J A;  3L72 D;  2LXC B;  1M1J A;  3CWB J;  3Q5S A;  1N8R Q;  1LTT C;  3MP7 B;  2O1J A;  3Q2Y A;  4XA4 A;  1HTL C;  1ZRT D;  4XE5 B;  3H1I D;  2MJZ A;  5CCG C;  4HKV A;  1GMJ A;  3HD7 D;  4EDF A;  4XFJ A;  3L72 E;  2E43 A;  1VQ4 P;  2OYI C;  3HD7 C;  1L0L E;  5AEW A;  3VMI D;  3L70 G;  3H1H J;  1M56 D;  1Q86 Q;  3SSU A;  3AZC A;  3BAS A;  4RES B;  1EDI A;  3AE2 C;  1Q7Y Q;  3AEE C;  3GF3 A;  1R8E A;  1X79 B;  5APT A;  1SQB E; 
#chains in the Genus database with same CATH homology
 2A06 E;  3VCA A;  5KKZ C;  1SQX E;  3VCP A;  4H44 D;  2BMO A;  4HM2 A;  2HMM A;  2YIU C;  4AIV A;  2IBZ E;  3VMG D;  3VMH D;  2BCC E;  1BE3 E;  3H1H E;  4HM8 A;  2E4Q A;  1BCC E;  4EMJ B;  3L75 E;  1G8K B;  4NBH D;  4QDC A;  2QPZ A;  5HL4 A;  2I7F A;  1FQT A;  4HM1 A;  2B24 A;  1ULJ A;  2DE7 D;  4NBB D;  2E74 D;  4PD4 E;  4H13 D;  2DE5 D;  1SQQ E;  4H0L D;  3GTS A;  3DQY A;  2HMN A;  3CXH E;  2JO6 A;  2YFI A;  2NVG A;  5CXM A;  2JZA A;  2NWF A;  1UUW A;  2BMR A;  2Q3W A;  2DE6 D;  1O7N A;  3L74 E;  4QUR A;  4NBE D;  3GKE A;  4QDD A;  2XSO A;  3GCE A;  2E4P A;  5AEU A;  4PV1 D;  2FYU E;  1O7P A;  4NBG D;  1Q90 C;  2BMQ A;  2QJP C;  3FOU A;  2E75 D;  2NUM A;  4P1C H;  2GBX A;  3GL0 A;  2CKF A;  4QUP A;  5BOK A;  1EG9 A;  3BCC E;  2NVE A;  3GTE A;  2ZYL A;  1O7M A;  2HMO A;  2HMK A;  3C0D A;  1O7W A;  3CX5 E;  2YFJ A;  2ZT9 D;  3EQQ A;  3H1I E;  1WQL A;  4NB8 D;  4HM0 A;  4P1B H;  1KB9 E;  1ZRT E;  3GL2 A;  1VCK A;  4QDF B;  1O7H A;  4AAY B;  1NU1 E;  1RIE A;  4HM3 A;  3L73 E;  4QUQ A;  1VF5 D;  1JM1 A;  3H1L E;  1NDO A;  4HKV A;  3L70 E;  3L71 E;  2QJK C;  2YFL A;  3CWB E;  2XR8 A;  4HM6 A;  1ULI A;  4HM4 A;  1SQV E;  4OGQ D;  1SQP E;  4QCK A;  3EN1 A;  1BGY E;  1NTZ E;  5KLV E;  3TGU E;  2E76 D;  4NBD D;  1PP9 E;  3L72 E;  1NYK A;  1EZV E;  1VM9 A;  1KYO E;  2YVJ B;  4NBC D;  2NUK A;  3GZX A;  1NTM E;  3GOB A;  4NBA D;  1L0L E;  2FYN C;  3GZY A;  5AEW A;  4HJL A;  3N0Q A;  4HM7 A;  2XSH A;  1P84 E;  2B1X A;  3VMI D;  3GB4 A;  3D89 A;  2GBW A;  1PPJ E;  2NVF A;  2HMJ A;  4D6T E;  4NBF D;  1NTK E;  3AZC A;  1RFS A;  2HML A;  4NB9 D;  4U3F E;  1SJG A;  2XRX A;  4HM5 A;  4QDF A;  5KLI C;  3H1K E;  1UUV A;  3H1J E;  2D2C D;  1L0N E;  1O7G A;  2QJY C;  1SQB E;  1G8J B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...