1SQVH

Crystal structure analysis of bovine bc1 with uhdbt
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
67
structure length
67
Chain Sequence
ELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome c reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 16
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1sqvH00
1PPJH 3CWBH 1PP9H 3H1IH 5KLVH 1BE3H 3BCCH 3H1LH 4PD4F 1BCCH 4U3FH 2A06H 4D6TH 1SQQH 3L73H 3L72H 1NU1H 3TGUH 1KYOF 1L0LH 3L71H 3H1HH 1SQXH 1NTMH 2FYUH 2IBZH 1L0NH 1KB9F 3H1KH 3L74H 1BGYH 3CXHF 3H1JH 1SQPH 1NTKH 1P84F 3L75H 2BCCH 3CX5F 1NTZH 1SQBH 1SQVH 3L70H 1EZVH
chains in the Genus database with same CATH superfamily
3CEIA 2QKSA 3RFRA 1BQ0A 1BCCH 2ZDIA 3OT7A 2F23A 3VQVA 3JALB 2IJHA 5B3SC 4ZBMA 5GTHZ 4Z1MG 2YDEA 2ZT9B 2JDIG 3DGEA 1H2MA 2Y69B 1W0KG 2V7QG 1TAEA 5L3BA 3JAKA 1QVGU 5H6QA 4DR7O 3ETGA 2WA3A 2E5LO 4X20A 5LMNB 3FYIB 2X0LA 2UUBB 1Q3EA 4JYCA 1SQBH 3LDDA 1GMGA 2F1MA 1EBOA 4PA4A 2ZM6B 5HFLA 4O2AB 1H2LA 2X6AA 1NVPD 2PI5A 4X1YB 1VF5B 3G4SV 3T1HO 1PNLA 2IJJA 4X88A 1P4RA 2R72A 2XTAA 3JSNA 4ICGA 2GHYA 5LMUB 2F4VO 3RYCB 3RN4A 2XNDG 4YY3B 1NQTA 1VQ7V 4B7EA 1XL4A 5EYPB 3CMEV 1VQ6V 2KB1A 5CA1B 1G8MA 5B1OA 2ZDIC 4PJ0Z 1BMFG 1L0LH 4P9OA 4OGQB 1SQXH 4LCUC 4NB5A 4FLUA 2RJZA 2BTQA 5LL6Y 1YTFD 1IBKO 1SERA 1J95A 5IJ0A 1EN4A 3UT5B 3T1YO 3CCRV 2XOKG 4JV5O 4ZHQA 2EIKB 1CP9A 4I55B 5CN0A 3AG1C 2UU9O 3FAVB 5KUMA 5FLXN 5IJ9B 1OCOB 2RDCA 1BSMA 1AR1B 4YHHO 1XHZA 5IYZA 3CPWU 2KG7A 2A0LA 1WJZA 1FD9A 1IBLB 4PDRA 1PM9A 4PI2A 2A9HA 2K9PA 3OMAB 4PDLA 1XHXA 2HJFC 5KAFZ 1NR7A 3RWRD 1Z2GA 2AGAA 2N74A 2UXCB 4K8ZA 3Q4HB 3DC5A 1RPRA 2G38A 1XMQB 1NTMH 3B8NA 1US6A 3BRCA 4JTAB 2EZOA 4LWSA 3CXHF 3GB7C 4IGGA 1LNQA 3NR7A 1WAZA 3CCUV 1F7YA 2Z5UA 4YJ2B 4UCRA 2XHBA 1AR5A 4PA9A 1UFIA 3QO8A 5GTIZ 4BIOA 4F4LA 3D3QA 3AG3B 2XAJA 5IWAB 2OIGA 4LF4O 2PYJA 2JS5A 3HKDB 3OM3B 3ABMC 4B7KA 1IDSA 3LSQA 1JR9A 5EK0A 2WLNA 2ZE8A 1I08A 3L9DA 3CS5A 1XNRO 3BA8A 4WBNA 2JEUA 2IU0A 2OTJV 3UKMA 1N0JA 5JJJB 1N36B 4CS4A 2YI9A 4DR3O 5JVDA 1E1RG 3N2GA 3RBZA 3ZX6A 1I5XA 3K0DA 1DTOA 3ZHQA 3JARB 2HR3A 1KD1W 3E35A 3FB8C 3RYIA 3E2EA 1WA8B 1IBMB 3WG7C 2ZKOA 3WB1A 4G2KA 2E5LB 1M56C 4B08A 4OPAA 3JASB 3GVMA 2VQFO 1FXKB 2WPDG 1NH2D 3HR0A 4U3FH 4AQYO 1NT2B 3VQXA 2DW4A 4QNHB 4DR6O 3J81N 4FLXA 2UXNA 4X62O 4O4LA 2HG5C 1K4CC 1NR1A 4O2BB 3VQWA 1DF5A 2ZE6A 2F4VB 4CS2A 1TUEB 5KA6A 3CYOA 1YJWV 3I55V 4NXNB 1XUQA 3LDCA 3K08A 2ETNA 4DR2B 5DN6G 4TUYA 3CB2A 2XAHA 3SYAA 4TT3G 2QTSA 3ASNC 5BMVB 2WLKA 1W2BU 4GUNA 4GT1A 3CD6V 1GKFA 1IBKB 4ZOLB 3ZHUA 1BZKA 4NVPA 4X89A 1Q6UA 2F43G 3T4DA 3AG7A 3G6BA 4DXWA 1VIBA 1VQKV 4JZ2A 3UO3A 2QWOB 1GO3F 4TQDA 2P4VA 3KZIZ 3U11A 2WLIB 1PNMA 1KBHA 5KHGA 4JI4B 2L6LA 2YIAA 1FS0G 2YSUB 5JJEB 3OUSA 3QO5A 4K8XA 3IFXA 1K33A 3ZRSA 3SYCA 5IYBO 4I7ZB 3CRRA 1RM1C 1AROP 2PY5A 1Y74B 4DV4O 3RYFA 1AILA 4K3AA 3KCYA 1HNZO 4B3TO 3F5TA 4MVUA 4DV0O 1P84F 1A32A 3K5NA 2BCCH 1SZXA 1Q6IA 4AI8A 2CTWA 2ATKC 4TV9B 4DR1B 1HNWO 3FKSG 4OPHA 4I0XA 1N0NA 5GONB 1U96A 1M93A 1S72V 3CCJV 3RYHB 1W0JG 3DXRB 3K58A 1WPXA 2QWNB 4X65O 4B3MB 1XQ8A 2RN9A 1V55B 1SZTA 3JATA 4A5UB 5A2QN 2XAFA 1HWYA 1H2KA 2LW1A 3ASOC 2OTLV 2B1IA 3P3NA 4MVSA 3TXSA 1NU1H 1XNRB 1FXHA 1V54B 2YUAA 1JCHA 2FYUH 1J5EB 4I9QA 4I50B 3BHPA 2EIJB 3JALA 2ZR3A 4DV1B 4FZ1A 1SESA 1X59A 2QM4A 2GUZB 3NXSA 4QE7A 5EZYB 3AK3A 3RW0A 4J41A 1S77D 1SA0B 2R70A 1BT8A 5JH7B 1M57B 1GN3A 2Z3YA 4FM1A 4DV6O 1Q7YW 1XILA 1L1FA 4LF5O 2VQEB 3CCVV 4DK1A 1AI7A 5JWPA 4OXSA 5L3CA 4DV2O 3CC7V 1AJNA 4FLWA 2CTRA 2UXDO 1NJIW 2JK5C 2Q6AA 3J7AU 3L73H 3W7WA 4O2AA 1WPBA 3FFQA 4DR6B 1IZ3A 5L3GA 5IT9N 2KQXA 4X1YA 2P06A 5ITZB 4DW1A 4OX9B 4GX5A 3IGAC 1B04A 2CK3G 2NN4A 4MVMA 2HP8A 3RYCA 4MTOA 2CDYA 2ZE5A 1V55C 2QM7A 4MVRA 2HEPA 4U7OA 1RFYA 5EYPA 4DV7B 2NNUA 4LNUB 3K5LA 5CA1A 1B06A 2PGGA 1NTKH 3E89A 3TXQA 4PA7A 4DUYO 3OAAG 4I4TB 1R6TA 1VQMV 4MVZA 4X8AA 3STZC 2Y69C 3UT5A 5LYJB 5KAIZ 4FZ0A 3B77A 2IW5A 3ABKB 2LW7A 4R50A 4I55A 1OV9A 3FAVA 5LOVB 5IJ9A 2IH3C 5LHHA 4LFBO 1FJGB 1OCZB 5FPOA 1OHHG 1GN6A 3WB2A 1WB7A 1KMIZ 2QKCA 1G4YB 3TGUH 4BWAA 2HFEC 3S3WA 3TCUA 2Y4UA 4D7SA 4JPRA 1HNZB 4JI7O 4FLTA 2JGDA 3Q4HA 3JD1A 4DV0B 1RSOB 5KA5A 3L72H 4FMTA 2DQ0A 3H9VA 3HKEB 3STLC 5GW7A 1XMOO 1PKXA 1COWG 1AJQA 3HKCB 4GX2A 4YJ2A 2P6JA 3MHSC 1M9NA 4CBCA 4DR4B 2VWKA 4FLVA 1H2GA 2IJKA 2LO1A 1Z5WA 1IURA 2DYRB 3JD3A 5IY5B 4GX0A 3H1IH 4BW5A 3C90A 3HKDA 1VQ9V 2N05A 4PELA 1R3IC 1Q6HA 2WWWA 2Q0AA 3PN1A 4IL6Z 3K59A 5IDJA 2EIKC 3B2EE 3CCSV 2VWJA 3APQA 2GSMB 2QGNA 1OCOC 2A7WA 3CX5F 4QGPA 3I56V 5KUKA 2C2AA 2OYQA 4BR6A 2LP7A 5BZBA 1QR9A 2CTPA 4NYKA 1VQ8V 4JTDB 4MTXA 4O4HA 4J9YB 3JARA 4TV8B 4MSWC 4TQFA 1VEWA 4J7KA 1WA8A 4LF7B 4DR5O 4UB8Z 4BAYA 4DV6B 1ZUQA 1QBZA 4YJ3B 2O57A 2CGOA 2QWQB 4KXRA 2V1DA 5JCOA 1HNXO 3K03A 4UCOA 4DYLA 1YJNV 4DV2B 1GM7A 2UXDB 5LA6B 3AK1A 1QNMA 2DMXA 3AG2B 3IJ4A 3U0ZA 3JASA 4J80A 3OEEG 1PNKA 1KKCA 4PV1B 4LF8B 3CJHB 1FXKA 1S5LZ 4Z2WA 1URFA 1PV0A 3CRCA 1L8DA 3D8CA 1XDCA 1K9MW 2UXXA 1R6NA 4P30A 3AG3C 4GKKB 3ZN0A 4O2BA 1FFXB 1XEQA 2L35A 4UVCA 2A79B 4MW8A 4DV3B 4X1KB 3EHBB 4MVQA 5LGUA 4UV9A 1I0HA 2ZINA 4EFBA 1YZBA 3SJQC 3QO7A 3E8BA 2JRIA 4U3JB 3IC7A 3LUTB 4N21A 2AXTZ 3WB0A 4BIUA 1E1QG 2IH1C 1Q81W 3CE2A 3FD9A 1I94O 2QE7G 1HW7A 1U97A 4DW0A 4N23A 4TSFG 5EC2C 5B1AB 1YITV 1PP9H 2QDOA 5BMVA 4GLXA 2P90A 4ZOLA 3SJAC 4DUZB 2CAZC 1JQ0A 1AI4A 2R9RB 2UXBB 3ZRWB 2GV9A 1GTOA 3ZEDA 1S3JA 2LGQA 1K3EA 1N33B 4RUFA 4RWUA 5J2UB 4LFBB 2H94A 4LF6O 5JCOC 1IX9A 4PD4F 1DLBA 3ABLB 1MZFA 4PI0A 4JI1B 1IXBA 3H1HH 2DWEC 1FXKC 3KG2A 2QKAA 2UUCO 5K1XA 3WFVA 4JI8B 5KX5B 3OTOB 1FFTB 1EZVH 1JPXA 3BPZA 3JAMN 2QEXV 1WNSA 4UCSA 4GYCB 2Y48A 3UCSC 5D5PA 3BCCH 2UUAO 4TV9A 5JQGB 1LR1A 2AZ0A 3ZRXA 2R9AA 1XMOB 1HR0B 5JJNB 5L3FA 1N32O 2GDSA 4WFFA 2EBOA 4NR1A 3TK1A 3A2FA 5GONA 2HJDA 5H9CA 4LF9O 3OR6C 3PJSK 3W7UA 3ZS8C 4ASUG 4PA6A 2FMLA 1ZTEA 4DV5O 1OCCB 4K0KO 1SQQH 2CE4A 3KCXA 5BY1A 4FLYA 4JI6O 4GKJO 3EFFK 1OCRB 1P49A 2HHHO 4HBNA 2DQ3A 3HKBB 3E86A 4LFCO 4L8JA 4I50A 1R73A 1DF4A 4MT8A 3E83A 3FB5C 2GUZA 4FPPA 4LP8A 5LHIA 5EZYA 3ZMVA 2YS8A 4IT5A 1WN7A 5CBGA 2Z0AA 4DR7B 5LGNA 1SETA 3HPLC 1E79G 2ITCC 2VS0A 4JYBA 4BIZA 4QE9A 4DR5B 2CGNA 5HFMA 4B3RO 1Y76A 1AP6A 4TWKA 2QJ1A 1IVSA 4DRXB 3CC4V 3SYQA 1YSCA 3K5OA 3M7MX 1YVWA 5F2VO 3R65A 4X1IB 2BOBC 4X20B 4UV8A 2HVJC 4R7CA 3IAYA 3K9SA 5DECA 2R9IA 3CCEV 1N34O 1Q43A 3T1HB 2JJ2G 2AZ2A 3ZIAG 3SPJA 1VQPV 1SQVH 2QWPB 3OGCC 2M6YA 5ITZA 1T5EA 1P7GA 4JYAO 4W4LA 2DN9A 2ZCEA 4PA3A 3AEIA 4PDVA 3BY6A 5KHKA 2N04A 4J7JA 5FPRA 1FAFA 3CRQA 2FB5A 4F6RB 1V54C 4LNUA 1NKDA 2EIJC 3T1YB 4ZI7B 4JV5B 3ZHSA 2A06H 1G6UA 4I4TA 1M1KW 2UU9B 2DJVA 3VOUA 2FTKA 2FKXA 4YHHB 4J7ZA 5LYJA 4UVBA 3RGBA 1MNGA 1QLEB 1M57C 5LBQA 3ETDA 3OMIB 4LF6B 4MTFA 2RQ6A 3I5DA 2ODMA 2GTSA 5IYZB 1H38A 3D36A 2F66C 1PL4A 3UO2A 3APOA 2FL4A 2YXHA 1TVKB 1VQOV 1QLNA 2YI8A 3J80N 2Q69A 3K04A 2P4KA 1QR8A 3JCUZ 3CHXA 2DYSB 4CC5A 1KP2A 4CH4A 4UB6Z 1R6KA 2Q8VA 2YEVB 1P7BA 1AJPA 2LFSA 1JVMA 1RSOA 3RVZA 3F5WC 4D7TA 2UUAB 2W6JG 4JTCB 3HKEA 2Y0PA 3JAWB 4LH7A 3VBBA 3K0GA 3O65A 1LUVA 4QPJA 1VQ4V 3HKCA 4WFHA 1F23A 3LDEA 1MG1A 1SC5B 4JGSA 4LF4B 1JFFB 2LJ2A 3A0BZ 3CWBH 3BVOA 3AK2A 1VF7A 4EKWA 4X66O 4J42A 1XREA 1WB8A 3AG4B 4JI6B 3SPCA 4U7NA 4CH5A 3OR7C 1VMGA 3ABKC 3OTFA 2JEXA 3C3SA 4DR3B 1FXVA 3UQ8A 4HNAB 4IHJB 3OGIB 2W0FC 4FVMA 4R8CA 3OE7G 4FM0A 3D36C 5IYDO 3C3TA 5CB4B 1OCZC 2EULA 1HP8A 4TV8A 2IBZH 5CBHA 1JJOA 3SYPA 3MD0A 1XBLA 5LP6B 1OJHA 1Y6XA 1ZAUA 3ML0A 4YJ3A 4EEQA 1R1BA 5BR8O 2RCVA 4KP4A 4LBEC 2VQFB 3H1LH 3OUFA 3T1CA 2ADQB 1RP3B 1UJWB 1K5QA 3ZMUA 4AQYB 2ILMA 5LA6A 3L71H 3ZBHA 5LMNO 3ZHRA 1N34B 2UUBO 4X62B 3MDSA 3CJHA 4O4IB 2Q5ZA 1F51A 4JAAA 3ETEA 1Q82W 2ZM6O 2M7WA 2PZSA 2Q7GA 1GK9A 3QG5A 1R3KC 2DYRC 1FFXA 1CXZB 1R3LC 3ABUA 4MVOA 5IY5C 2QA4V 1R3JC 4X1KA 3QTCA 4C7UA 4JZGA 3LNNA 3W7XA 4U3JA 1EN5A 2BE3A 4BW9A 4YY3O 1B3QA 2X6CA 1W59A 3E22B 3TJTA 1H2NA 3E8FA 4WFEA 2IM9A 4O4JB 2ARHA 1ORQC 3SR2C 5IE9A 3LNMB 2WAMA 4QIWF 5KHHA 2ZIOA 4H13B 3ZHTA 5KMGB 3OEHG 2WLLB 5J2TB 3ZRWA 4TOIA 1SQFA 4H37A 4JI5O 4CC6A 5J2UA 5DM6V 4FFBB 1BHBA 5K1PA 5CBFA 4ABMA 4DV4B 4NTYA 4UUJC 3UM7A 2XT9A 3AG2C 4B3TB 2D2CB 2ZXWB 5CA0B 1NI8A 5AG2A 2Q0OC 3N2KB 3G67A 2HLDG 2RMKB 1WP7A 2UXCO 1HNWB 5KX5A 2ADPA 3SJCC 3A0RA 4LH6A 5B1NA 1S76D 2Y0IA 1ZWIC 1JMKC 1XMQO 1YDXA 2BTOA 4UCVA 2OCCB 5JQGA 1S0VA 4MS2A 4X65B 4WFGA 2ITDC 3K06A 1YIJV 3P32A 1MA1A 5EBMC 1BHAA 3LSUA 2YIDA 2P7TC 5FL7G 4RAIA 1AR4A 2AHZA 1KYOF 4P9PA 3JCZA 2ZQMA 3BFRA 5B1AC 1NH2B 5IWAO 1CEZA 1KU9A 2B9ZA 2WLHA 5C93A 5B1BB 1Y66A 1FKAO 3ABTA 3P30A 3HKBA 2EILB 3ZMSA 4Z1VA 3CXCU 2LGWA 2F93B 4IYIA 1N36O 1QU7A 3ABLC 4I9WA 1M90W 1YCIA 4LF5B 1Q86W 2CH7B 2YC0A 2Y4TA 5LXTB 2P5OA 4JI2O 3CP1A 2E75B 4Q20A 1ROPA 4QJFB 5BR8B 1EM1A 2PI4A 4DRXA 1SS3A 1SQGA 2DWDC 1IBMO 4X1IA 2V4DA 3O9OA 1L0NH 1TUBB 1MSWD 1WLEA 2Q68A 2P67A 3W7TA 3JD4A 3DTUB 3EXAA 1K34A 5L3EA 3HB3B 1F4NA 2EINB 5EC1C 1SF9A 4LC1A 1GM8A 5FNVB 1M4UA 1OCCC 3X2QB 4UXNA 4FK5C 3SJBC 3K3WA 1NZ6A 4YIOA 3DSQA 2BSKB 1OCRC 2H8PC 2WLJA 1Q90D 2MW2B 3N27A 2HVKC 4DUYB 4NXNO 3T2MA 1V9PA 2ZIMA 4F6RA 4GX1A 4DR2O 2AHYA 4IIJB 2EIMB 2ZR2A 1SKVA 4ZI7A 4EB6B 2EZPA 3QVNA 1AP5A 1S5HC 5C8YB 3SPGA 2WA4A 1MZEA 1MOFA 1ZLZA 4CH3A 2Q67A 1B6QA 2WLIA 2CUGA 5B3SB 5KLVH 4H44B 4RUEA 4JI5B 4UCTA 2X6BA 2P22C 4HYOA 5TISZ 3ZHVA 1NBMG 2F95B 3BAAA 4JI4O 2PUSA 4XBFA 3FX7A 1TVKA 1Y74A 4JI7B 1ZL8B 1I5YA 2LQTA 2JIZG 3F7YC 3S3XA 4XDJA 2Q4PA 3IC9A 4FIPC 3E8HA 3A8TA 2H3OA 2MK3A 3H01A 2YEVA 2JGDB 1ENVA 2JVDA 4DK0A 2ZE7A 1BQZA 5A9GA 4H0LB 5EBLC 4GCZA 4LFAO 3B09A 1EZJA 5CMUA 3ICXA 1BGYH 3RYHA 1XNQO 3H1JH 4Q6GA 3DXRA 3E8GA 5CA3A 3JAWA 4DR1O 4B3SO 1XL6A 1S5JA 1K5SA 1JOYA 1WP8A 3OMNB 2X7RB 3CC2V 5BXZA 1JFFA 1SRYA 1K7DA 1RPOA 2YIBD 3CRMA 4WCEV 4B3MO 2EJ7A 1KB9F 2ZD9A 1VF6A 1QQCA 3U10A 1G1XB 1K92A 1PL0A 4F6EA 1MSDA 3OD4A 2BOCC 1PPJH 4UVAA 4X9QA 1VARA 1QLEC 2EJRA 4KUMA 1YJ9V 3JD0A 4WFAV 2PF4E 4HNAA 2QR4A 4IHJA 5D5QA 1J5EO 2XAGA 5EIBC 1SA0A 4JI0O 4DV1O 3LSSA 5JH7A 3L74H 1VQ5V 3JAKB 5CB4A 4PDMA 4O4HB 3AG1B 1KQSU 2B5UA 2OIEA 5KHIA 1GH6A 1HNXB 5LP6A 4JI2B 1KKDA 2DYSC 4EFEA 3SDLA 1CPYA 4RQFA 2QTOA 4MW3A 5DEDA 2VQEO 4JAUA 2A3QA 1VP7A 1QHTA 3B4SA 2JJ1G 1GAXA 3L70H 1N4CA 4O4IA 1BE3H 2KKWA 4JASA 4MTGA 4D6TH 4QPKA 2ZNIA 4NTWA 1GN4A 3SPIA 1AB3A 1TGOA 1Z5VA 3JD2A 4E4EA 3KKYA 1SQPH 2CTQA 1K97A 3L75H 4OX9O 1MABG 2QWRB 3AG4C 3CSXA 3FB6C 3CCLV 1VF6C 1BS3A 1I94B 1MMMA 1EFRG 5IYCO 2XAQA 5L3DA 3G80A 3E22A 4DO2A 4DV7O 1OZ0A 4O4JA 4X64O 2BTQB 2Q73A 3RT3C 4WFBV 3K57A 3CMAV 4XDKA 3ABMB 5IJ0B 4NXMO 2RNBA 1Q5OA 1K73W 2OCHA 1H8HG 3QNEA 4ZHQB 4KFMA 3OFNG 5LOVA 5KMGA 2YIBA 3F7VC 1H2SB 2WLLA 5J2TA 3SGIA 4CZZA 5LP6C 2KG7B 3W7SA 3OW2U 1D5AA 1UPGA 3VQYA 4W4KA 2Q7EA 1YI2V 1YEWA 3K79A 3MHHC 1ZSPA 2DE0X 2LFRA 1THZA 3GWOA 4FFBA 3ZMZA 4E2LA 1QVFU 1KUQA 1YF2A 5B5EZ 1XI1A 2NLJC 4KL1A 1FJGO 4CS3A 4KHPO 1NTZH 2UUCB 4JI3O 4JYYA 2GTAA 3WG7B 1KECA 4NKGB 4JF3A 5CA0A 1GN2A 3N2KA 1EN6A 1Q8IA 1M56B 1D5NA 4LWSB 3BA9A 2XASA 3G6EV 1N32B 3M8AA 4LFAB 1DK1A 1XNQB 3G71V 1JX9A 2DOSA 3ZN1A 4LF9B 4B3SB 2D3OW 2KSDA 3K9AA 1F4MA 2E76B 4DV5B 4AILC 5LHGA 1DGSA 4K0KB 4JAVA 5EBWC 1Y67A 4DR4O 2GBOA 2Q7HA 1NVPB 4GKJB 1JA8A 2HHHB 3ZCCA 3QF7A 3ETQA 1ZX3A 3JSLA 1H8EG 2QSAA 4LFCB 2PTMA 4AHCA 1YXBA 2W6IG 3R66A 2WSSG 4WBNB 2W0XA 1X4TA 4CH6A 5H2FZ 3CCQV 3SPHA 2HKOA 5E79Z 1O9GA 3ASNB 5JVDB 4J10A 3N2GB 4FFKA 2JS3A 4JI0B 4NTXA 4IYHA 3RYIB 4UCUA 4FM2A 4B3RB 2ZNJA 2E3CA 1K8AW 1QCEA 2ZXWC 1YTFB 3THOA 2CH7A 4FLZA 1XOUA 4R6ZA 5LXTA 4H33A 1I7FA 5J9PC 5H6RA 3WU2Z 4LF7O 1Y76B 4XDLA 3TETA 3B8MA 2OWOA 1YHQV 2AW9A 1PD3A 2OT5A 1NS1A 1RM1B 2JGUA 1IXMA 2IJIA 2PYLA 4GZRB 2OCCC 1TUBA 1Y4MA 1K4DC 4I5SA 1D2DA 1AI5A 4G28B 2NR5A 3T4ZA 4JYAB 4LR3A 4O4LB 4LF8O 4WF9V 1FYJA 2YXYA 5LMUO 5FNVA 3DC6A 1HDJA 2K1EA 3RVYA 4L87A 3SYOA 1LUWA 3B40A 4GKKO 2EX3A 2QM8A 4DV3O 2BSKA 3JYCA 4TUYB 5B1BC 3ZJZA 4ZIBA 3MAQA 3FB7C 3K5MA 2EILC 3P3PA 4X64B 4IIJA 1N8RW 4RO2A 1KP3A 3EVKA 3M99B 3ASOB 4NXMB 4EB6A 3CRAA 3BEHA 1FPOA 1VQLV 5C8YA 4J9ZB 4YXWG 5B66Z 4DUZO 3BABA 2UXBO 2VRZA 4UFZA 1GM9A 1AI6A 4J11A 4G27B 1VQNV 1BL8A 3D3IA 1IBLO 1N33O 4P2ZA 4PHZA 5LGTA 2Q9LA 4ZKIA 4KHPB 5KHJA 4RQEA 1KC8W 4JI3B 1ZL8A 4YIPA 3RYFB 5E1AC 3CCMV 1M5IA 4JI1O 2E74B 3ZRVA 4K35A 3H1KH 4JI8O 3ZMTA 3OTOO 2EINC 4FJCC 4I0XB 3X2QC 1GRJA 5H5NA 4HAMA 2IU3A 2XUMA 1HR0O 3GWKC 4X66B 3JATB 4HZ3A 2B1GA 1TA8A 3A0HZ 1JJ2U 3FYEB 1AVMA 2EIMC 5EIBD 1O9HA 2YXLA 2YICA 2WLMA
chains in the Genus database with same CATH topology
1PPJH 3CWBH 1PP9H 3H1IH 5KLVH 1BE3H 3BCCH 3H1LH 4PD4F 1BCCH 4U3FH 2A06H 4D6TH 1SQQH 3L73H 3L72H 1NU1H 3TGUH 1KYOF 1L0LH 3L71H 3H1HH 1SQXH 1NTMH 2FYUH 2IBZH 1L0NH 1KB9F 3H1KH 3L74H 1BGYH 3CXHF 3H1JH 1SQPH 1NTKH 1P84F 3L75H 2BCCH 3CX5F 1NTZH 1SQBH 1SQVH 3L70H 1EZVH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PPJ H;  3CWB H;  1PP9 H;  3H1I H;  5KLV H;  1BE3 H;  3BCC H;  3H1L H;  4PD4 F;  1BCC H;  4U3F H;  2A06 H;  4D6T H;  1SQQ H;  3L73 H;  3L72 H;  1NU1 H;  3TGU H;  1KYO F;  1L0L H;  3L71 H;  3H1H H;  1SQX H;  1NTM H;  2FYU H;  2IBZ H;  1L0N H;  1KB9 F;  3H1K H;  3L74 H;  1BGY H;  3CXH F;  3H1J H;  1SQP H;  1NTK H;  1P84 F;  3L75 H;  2BCC H;  3CX5 F;  1NTZ H;  1SQB H;  1SQV H;  3L70 H;  1EZV H; 
#chains in the Genus database with same CATH topology
 3CEI A;  2QKS A;  3RFR A;  1BQ0 A;  1BCC H;  2ZDI A;  3OT7 A;  2F23 A;  3VQV A;  3JAL B;  2IJH A;  5B3S C;  4ZBM A;  5GTH Z;  4Z1M G;  2YDE A;  2ZT9 B;  2JDI G;  3DGE A;  1H2M A;  2Y69 B;  1W0K G;  2V7Q G;  1TAE A;  5L3B A;  3JAK A;  1QVG U;  5H6Q A;  4DR7 O;  3ETG A;  2WA3 A;  2E5L O;  4X20 A;  5LMN B;  3FYI B;  2X0L A;  2UUB B;  1Q3E A;  4JYC A;  1SQB H;  3LDD A;  1GMG A;  2F1M A;  1EBO A;  4PA4 A;  2ZM6 B;  5HFL A;  4O2A B;  1H2L A;  2X6A A;  1NVP D;  2PI5 A;  4X1Y B;  1VF5 B;  3G4S V;  3T1H O;  1PNL A;  2IJJ A;  4X88 A;  1P4R A;  2R72 A;  2XTA A;  3JSN A;  4ICG A;  2GHY A;  5LMU B;  2F4V O;  3RYC B;  3RN4 A;  2XND G;  4YY3 B;  1NQT A;  1VQ7 V;  4B7E A;  1XL4 A;  5EYP B;  3CME V;  1VQ6 V;  2KB1 A;  5CA1 B;  1G8M A;  5B1O A;  2ZDI C;  4PJ0 Z;  1BMF G;  1L0L H;  4P9O A;  4OGQ B;  1SQX H;  4LCU C;  4NB5 A;  4FLU A;  2RJZ A;  2BTQ A;  5LL6 Y;  1YTF D;  1IBK O;  1SER A;  1J95 A;  5IJ0 A;  1EN4 A;  3UT5 B;  3T1Y O;  3CCR V;  2XOK G;  4JV5 O;  4ZHQ A;  2EIK B;  1CP9 A;  4I55 B;  5CN0 A;  3AG1 C;  2UU9 O;  3FAV B;  5KUM A;  5FLX N;  5IJ9 B;  1OCO B;  2RDC A;  1BSM A;  1AR1 B;  4YHH O;  1XHZ A;  5IYZ A;  3CPW U;  2KG7 A;  2A0L A;  1WJZ A;  1FD9 A;  1IBL B;  4PDR A;  1PM9 A;  4PI2 A;  2A9H A;  2K9P A;  3OMA B;  4PDL A;  1XHX A;  2HJF C;  5KAF Z;  1NR7 A;  3RWR D;  1Z2G A;  2AGA A;  2N74 A;  2UXC B;  4K8Z A;  3Q4H B;  3DC5 A;  1RPR A;  2G38 A;  1XMQ B;  1NTM H;  3B8N A;  1US6 A;  3BRC A;  4JTA B;  2EZO A;  4LWS A;  3CXH F;  3GB7 C;  4IGG A;  1LNQ A;  3NR7 A;  1WAZ A;  3CCU V;  1F7Y A;  2Z5U A;  4YJ2 B;  4UCR A;  2XHB A;  1AR5 A;  4PA9 A;  1UFI A;  3QO8 A;  5GTI Z;  4BIO A;  4F4L A;  3D3Q A;  3AG3 B;  2XAJ A;  5IWA B;  2OIG A;  4LF4 O;  2PYJ A;  2JS5 A;  3HKD B;  3OM3 B;  3ABM C;  4B7K A;  1IDS A;  3LSQ A;  1JR9 A;  5EK0 A;  2WLN A;  2ZE8 A;  1I08 A;  3L9D A;  3CS5 A;  1XNR O;  3BA8 A;  4WBN A;  2JEU A;  2IU0 A;  2OTJ V;  3UKM A;  1N0J A;  5JJJ B;  1N36 B;  4CS4 A;  2YI9 A;  4DR3 O;  5JVD A;  1E1R G;  3N2G A;  3RBZ A;  3ZX6 A;  1I5X A;  3K0D A;  1DTO A;  3ZHQ A;  3JAR B;  2HR3 A;  1KD1 W;  3E35 A;  3FB8 C;  3RYI A;  3E2E A;  1WA8 B;  1IBM B;  3WG7 C;  2ZKO A;  3WB1 A;  4G2K A;  2E5L B;  1M56 C;  4B08 A;  4OPA A;  3JAS B;  3GVM A;  2VQF O;  1FXK B;  2WPD G;  1NH2 D;  3HR0 A;  4U3F H;  4AQY O;  1NT2 B;  3VQX A;  2DW4 A;  4QNH B;  4DR6 O;  3J81 N;  4FLX A;  2UXN A;  4X62 O;  4O4L A;  2HG5 C;  1K4C C;  1NR1 A;  4O2B B;  3VQW A;  1DF5 A;  2ZE6 A;  2F4V B;  4CS2 A;  1TUE B;  5KA6 A;  3CYO A;  1YJW V;  3I55 V;  4NXN B;  1XUQ A;  3LDC A;  3K08 A;  2ETN A;  4DR2 B;  5DN6 G;  4TUY A;  3CB2 A;  2XAH A;  3SYA A;  4TT3 G;  2QTS A;  3ASN C;  5BMV B;  2WLK A;  1W2B U;  4GUN A;  4GT1 A;  3CD6 V;  1GKF A;  1IBK B;  4ZOL B;  3ZHU A;  1BZK A;  4NVP A;  4X89 A;  1Q6U A;  2F43 G;  3T4D A;  3AG7 A;  3G6B A;  4DXW A;  1VIB A;  1VQK V;  4JZ2 A;  3UO3 A;  2QWO B;  1GO3 F;  4TQD A;  2P4V A;  3KZI Z;  3U11 A;  2WLI B;  1PNM A;  1KBH A;  5KHG A;  4JI4 B;  2L6L A;  2YIA A;  1FS0 G;  2YSU B;  5JJE B;  3OUS A;  3QO5 A;  4K8X A;  3IFX A;  1K33 A;  3ZRS A;  3SYC A;  5IYB O;  4I7Z B;  3CRR A;  1RM1 C;  1ARO P;  2PY5 A;  1Y74 B;  4DV4 O;  3RYF A;  1AIL A;  4K3A A;  3KCY A;  1HNZ O;  4B3T O;  3F5T A;  4MVU A;  4DV0 O;  1P84 F;  1A32 A;  3K5N A;  2BCC H;  1SZX A;  1Q6I A;  4AI8 A;  2CTW A;  2ATK C;  4TV9 B;  4DR1 B;  1HNW O;  3FKS G;  4OPH A;  4I0X A;  1N0N A;  5GON B;  1U96 A;  1M93 A;  1S72 V;  3CCJ V;  3RYH B;  1W0J G;  3DXR B;  3K58 A;  1WPX A;  2QWN B;  4X65 O;  4B3M B;  1XQ8 A;  2RN9 A;  1V55 B;  1SZT A;  3JAT A;  4A5U B;  5A2Q N;  2XAF A;  1HWY A;  1H2K A;  2LW1 A;  3ASO C;  2OTL V;  2B1I A;  3P3N A;  4MVS A;  3TXS A;  1NU1 H;  1XNR B;  1FXH A;  1V54 B;  2YUA A;  1JCH A;  2FYU H;  1J5E B;  4I9Q A;  4I50 B;  3BHP A;  2EIJ B;  3JAL A;  2ZR3 A;  4DV1 B;  4FZ1 A;  1SES A;  1X59 A;  2QM4 A;  2GUZ B;  3NXS A;  4QE7 A;  5EZY B;  3AK3 A;  3RW0 A;  4J41 A;  1S77 D;  1SA0 B;  2R70 A;  1BT8 A;  5JH7 B;  1M57 B;  1GN3 A;  2Z3Y A;  4FM1 A;  4DV6 O;  1Q7Y W;  1XIL A;  1L1F A;  4LF5 O;  2VQE B;  3CCV V;  4DK1 A;  1AI7 A;  5JWP A;  4OXS A;  5L3C A;  4DV2 O;  3CC7 V;  1AJN A;  4FLW A;  2CTR A;  2UXD O;  1NJI W;  2JK5 C;  2Q6A A;  3J7A U;  3L73 H;  3W7W A;  4O2A A;  1WPB A;  3FFQ A;  4DR6 B;  1IZ3 A;  5L3G A;  5IT9 N;  2KQX A;  4X1Y A;  2P06 A;  5ITZ B;  4DW1 A;  4OX9 B;  4GX5 A;  3IGA C;  1B04 A;  2CK3 G;  2NN4 A;  4MVM A;  2HP8 A;  3RYC A;  4MTO A;  2CDY A;  2ZE5 A;  1V55 C;  2QM7 A;  4MVR A;  2HEP A;  4U7O A;  1RFY A;  5EYP A;  4DV7 B;  2NNU A;  4LNU B;  3K5L A;  5CA1 A;  1B06 A;  2PGG A;  1NTK H;  3E89 A;  3TXQ A;  4PA7 A;  4DUY O;  3OAA G;  4I4T B;  1R6T A;  1VQM V;  4MVZ A;  4X8A A;  3STZ C;  2Y69 C;  3UT5 A;  5LYJ B;  5KAI Z;  4FZ0 A;  3B77 A;  2IW5 A;  3ABK B;  2LW7 A;  4R50 A;  4I55 A;  1OV9 A;  3FAV A;  5LOV B;  5IJ9 A;  2IH3 C;  5LHH A;  4LFB O;  1FJG B;  1OCZ B;  5FPO A;  1OHH G;  1GN6 A;  3WB2 A;  1WB7 A;  1KMI Z;  2QKC A;  1G4Y B;  3TGU H;  4BWA A;  2HFE C;  3S3W A;  3TCU A;  2Y4U A;  4D7S A;  4JPR A;  1HNZ B;  4JI7 O;  4FLT A;  2JGD A;  3Q4H A;  3JD1 A;  4DV0 B;  1RSO B;  5KA5 A;  3L72 H;  4FMT A;  2DQ0 A;  3H9V A;  3HKE B;  3STL C;  5GW7 A;  1XMO O;  1PKX A;  1COW G;  1AJQ A;  3HKC B;  4GX2 A;  4YJ2 A;  2P6J A;  3MHS C;  1M9N A;  4CBC A;  4DR4 B;  2VWK A;  4FLV A;  1H2G A;  2IJK A;  2LO1 A;  1Z5W A;  1IUR A;  2DYR B;  3JD3 A;  5IY5 B;  4GX0 A;  3H1I H;  4BW5 A;  3C90 A;  3HKD A;  1VQ9 V;  2N05 A;  4PEL A;  1R3I C;  1Q6H A;  2WWW A;  2Q0A A;  3PN1 A;  4IL6 Z;  3K59 A;  5IDJ A;  2EIK C;  3B2E E;  3CCS V;  2VWJ A;  3APQ A;  2GSM B;  2QGN A;  1OCO C;  2A7W A;  3CX5 F;  4QGP A;  3I56 V;  5KUK A;  2C2A A;  2OYQ A;  4BR6 A;  2LP7 A;  5BZB A;  1QR9 A;  2CTP A;  4NYK A;  1VQ8 V;  4JTD B;  4MTX A;  4O4H A;  4J9Y B;  3JAR A;  4TV8 B;  4MSW C;  4TQF A;  1VEW A;  4J7K A;  1WA8 A;  4LF7 B;  4DR5 O;  4UB8 Z;  4BAY A;  4DV6 B;  1ZUQ A;  1QBZ A;  4YJ3 B;  2O57 A;  2CGO A;  2QWQ B;  4KXR A;  2V1D A;  5JCO A;  1HNX O;  3K03 A;  4UCO A;  4DYL A;  1YJN V;  4DV2 B;  1GM7 A;  2UXD B;  5LA6 B;  3AK1 A;  1QNM A;  2DMX A;  3AG2 B;  3IJ4 A;  3U0Z A;  3JAS A;  4J80 A;  3OEE G;  1PNK A;  1KKC A;  4PV1 B;  4LF8 B;  3CJH B;  1FXK A;  1S5L Z;  4Z2W A;  1URF A;  1PV0 A;  3CRC A;  1L8D A;  3D8C A;  1XDC A;  1K9M W;  2UXX A;  1R6N A;  4P30 A;  3AG3 C;  4GKK B;  3ZN0 A;  4O2B A;  1FFX B;  1XEQ A;  2L35 A;  4UVC A;  2A79 B;  4MW8 A;  4DV3 B;  4X1K B;  3EHB B;  4MVQ A;  5LGU A;  4UV9 A;  1I0H A;  2ZIN A;  4EFB A;  1YZB A;  3SJQ C;  3QO7 A;  3E8B A;  2JRI A;  4U3J B;  3IC7 A;  3LUT B;  4N21 A;  2AXT Z;  3WB0 A;  4BIU A;  1E1Q G;  2IH1 C;  1Q81 W;  3CE2 A;  3FD9 A;  1I94 O;  2QE7 G;  1HW7 A;  1U97 A;  4DW0 A;  4N23 A;  4TSF G;  5EC2 C;  5B1A B;  1YIT V;  1PP9 H;  2QDO A;  5BMV A;  4GLX A;  2P90 A;  4ZOL A;  3SJA C;  4DUZ B;  2CAZ C;  1JQ0 A;  1AI4 A;  2R9R B;  2UXB B;  3ZRW B;  2GV9 A;  1GTO A;  3ZED A;  1S3J A;  2LGQ A;  1K3E A;  1N33 B;  4RUF A;  4RWU A;  5J2U B;  4LFB B;  2H94 A;  4LF6 O;  5JCO C;  1IX9 A;  4PD4 F;  1DLB A;  3ABL B;  1MZF A;  4PI0 A;  4JI1 B;  1IXB A;  3H1H H;  2DWE C;  1FXK C;  3KG2 A;  2QKA A;  2UUC O;  5K1X A;  3WFV A;  4JI8 B;  5KX5 B;  3OTO B;  1FFT B;  1EZV H;  1JPX A;  3BPZ A;  3JAM N;  2QEX V;  1WNS A;  4UCS A;  4GYC B;  2Y48 A;  3UCS C;  5D5P A;  3BCC H;  2UUA O;  4TV9 A;  5JQG B;  1LR1 A;  2AZ0 A;  3ZRX A;  2R9A A;  1XMO B;  1HR0 B;  5JJN B;  5L3F A;  1N32 O;  2GDS A;  4WFF A;  2EBO A;  4NR1 A;  3TK1 A;  3A2F A;  5GON A;  2HJD A;  5H9C A;  4LF9 O;  3OR6 C;  3PJS K;  3W7U A;  3ZS8 C;  4ASU G;  4PA6 A;  2FML A;  1ZTE A;  4DV5 O;  1OCC B;  4K0K O;  1SQQ H;  2CE4 A;  3KCX A;  5BY1 A;  4FLY A;  4JI6 O;  4GKJ O;  3EFF K;  1OCR B;  1P49 A;  2HHH O;  4HBN A;  2DQ3 A;  3HKB B;  3E86 A;  4LFC O;  4L8J A;  4I50 A;  1R73 A;  1DF4 A;  4MT8 A;  3E83 A;  3FB5 C;  2GUZ A;  4FPP A;  4LP8 A;  5LHI A;  5EZY A;  3ZMV A;  2YS8 A;  4IT5 A;  1WN7 A;  5CBG A;  2Z0A A;  4DR7 B;  5LGN A;  1SET A;  3HPL C;  1E79 G;  2ITC C;  2VS0 A;  4JYB A;  4BIZ A;  4QE9 A;  4DR5 B;  2CGN A;  5HFM A;  4B3R O;  1Y76 A;  1AP6 A;  4TWK A;  2QJ1 A;  1IVS A;  4DRX B;  3CC4 V;  3SYQ A;  1YSC A;  3K5O A;  3M7M X;  1YVW A;  5F2V O;  3R65 A;  4X1I B;  2BOB C;  4X20 B;  4UV8 A;  2HVJ C;  4R7C A;  3IAY A;  3K9S A;  5DEC A;  2R9I A;  3CCE V;  1N34 O;  1Q43 A;  3T1H B;  2JJ2 G;  2AZ2 A;  3ZIA G;  3SPJ A;  1VQP V;  1SQV H;  2QWP B;  3OGC C;  2M6Y A;  5ITZ A;  1T5E A;  1P7G A;  4JYA O;  4W4L A;  2DN9 A;  2ZCE A;  4PA3 A;  3AEI A;  4PDV A;  3BY6 A;  5KHK A;  2N04 A;  4J7J A;  5FPR A;  1FAF A;  3CRQ A;  2FB5 A;  4F6R B;  1V54 C;  4LNU A;  1NKD A;  2EIJ C;  3T1Y B;  4ZI7 B;  4JV5 B;  3ZHS A;  2A06 H;  1G6U A;  4I4T A;  1M1K W;  2UU9 B;  2DJV A;  3VOU A;  2FTK A;  2FKX A;  4YHH B;  4J7Z A;  5LYJ A;  4UVB A;  3RGB A;  1MNG A;  1QLE B;  1M57 C;  5LBQ A;  3ETD A;  3OMI B;  4LF6 B;  4MTF A;  2RQ6 A;  3I5D A;  2ODM A;  2GTS A;  5IYZ B;  1H38 A;  3D36 A;  2F66 C;  1PL4 A;  3UO2 A;  3APO A;  2FL4 A;  2YXH A;  1TVK B;  1VQO V;  1QLN A;  2YI8 A;  3J80 N;  2Q69 A;  3K04 A;  2P4K A;  1QR8 A;  3JCU Z;  3CHX A;  2DYS B;  4CC5 A;  1KP2 A;  4CH4 A;  4UB6 Z;  1R6K A;  2Q8V A;  2YEV B;  1P7B A;  1AJP A;  2LFS A;  1JVM A;  1RSO A;  3RVZ A;  3F5W C;  4D7T A;  2UUA B;  2W6J G;  4JTC B;  3HKE A;  2Y0P A;  3JAW B;  4LH7 A;  3VBB A;  3K0G A;  3O65 A;  1LUV A;  4QPJ A;  1VQ4 V;  3HKC A;  4WFH A;  1F23 A;  3LDE A;  1MG1 A;  1SC5 B;  4JGS A;  4LF4 B;  1JFF B;  2LJ2 A;  3A0B Z;  3CWB H;  3BVO A;  3AK2 A;  1VF7 A;  4EKW A;  4X66 O;  4J42 A;  1XRE A;  1WB8 A;  3AG4 B;  4JI6 B;  3SPC A;  4U7N A;  4CH5 A;  3OR7 C;  1VMG A;  3ABK C;  3OTF A;  2JEX A;  3C3S A;  4DR3 B;  1FXV A;  3UQ8 A;  4HNA B;  4IHJ B;  3OGI B;  2W0F C;  4FVM A;  4R8C A;  3OE7 G;  4FM0 A;  3D36 C;  5IYD O;  3C3T A;  5CB4 B;  1OCZ C;  2EUL A;  1HP8 A;  4TV8 A;  2IBZ H;  5CBH A;  1JJO A;  3SYP A;  3MD0 A;  1XBL A;  5LP6 B;  1OJH A;  1Y6X A;  1ZAU A;  3ML0 A;  4YJ3 A;  4EEQ A;  1R1B A;  5BR8 O;  2RCV A;  4KP4 A;  4LBE C;  2VQF B;  3H1L H;  3OUF A;  3T1C A;  2ADQ B;  1RP3 B;  1UJW B;  1K5Q A;  3ZMU A;  4AQY B;  2ILM A;  5LA6 A;  3L71 H;  3ZBH A;  5LMN O;  3ZHR A;  1N34 B;  2UUB O;  4X62 B;  3MDS A;  3CJH A;  4O4I B;  2Q5Z A;  1F51 A;  4JAA A;  3ETE A;  1Q82 W;  2ZM6 O;  2M7W A;  2PZS A;  2Q7G A;  1GK9 A;  3QG5 A;  1R3K C;  2DYR C;  1FFX A;  1CXZ B;  1R3L C;  3ABU A;  4MVO A;  5IY5 C;  2QA4 V;  1R3J C;  4X1K A;  3QTC A;  4C7U A;  4JZG A;  3LNN A;  3W7X A;  4U3J A;  1EN5 A;  2BE3 A;  4BW9 A;  4YY3 O;  1B3Q A;  2X6C A;  1W59 A;  3E22 B;  3TJT A;  1H2N A;  3E8F A;  4WFE A;  2IM9 A;  4O4J B;  2ARH A;  1ORQ C;  3SR2 C;  5IE9 A;  3LNM B;  2WAM A;  4QIW F;  5KHH A;  2ZIO A;  4H13 B;  3ZHT A;  5KMG B;  3OEH G;  2WLL B;  5J2T B;  3ZRW A;  4TOI A;  1SQF A;  4H37 A;  4JI5 O;  4CC6 A;  5J2U A;  5DM6 V;  4FFB B;  1BHB A;  5K1P A;  5CBF A;  4ABM A;  4DV4 B;  4NTY A;  4UUJ C;  3UM7 A;  2XT9 A;  3AG2 C;  4B3T B;  2D2C B;  2ZXW B;  5CA0 B;  1NI8 A;  5AG2 A;  2Q0O C;  3N2K B;  3G67 A;  2HLD G;  2RMK B;  1WP7 A;  2UXC O;  1HNW B;  5KX5 A;  2ADP A;  3SJC C;  3A0R A;  4LH6 A;  5B1N A;  1S76 D;  2Y0I A;  1ZWI C;  1JMK C;  1XMQ O;  1YDX A;  2BTO A;  4UCV A;  2OCC B;  5JQG A;  1S0V A;  4MS2 A;  4X65 B;  4WFG A;  2ITD C;  3K06 A;  1YIJ V;  3P32 A;  1MA1 A;  5EBM C;  1BHA A;  3LSU A;  2YID A;  2P7T C;  5FL7 G;  4RAI A;  1AR4 A;  2AHZ A;  1KYO F;  4P9P A;  3JCZ A;  2ZQM A;  3BFR A;  5B1A C;  1NH2 B;  5IWA O;  1CEZ A;  1KU9 A;  2B9Z A;  2WLH A;  5C93 A;  5B1B B;  1Y66 A;  1FKA O;  3ABT A;  3P30 A;  3HKB A;  2EIL B;  3ZMS A;  4Z1V A;  3CXC U;  2LGW A;  2F93 B;  4IYI A;  1N36 O;  1QU7 A;  3ABL C;  4I9W A;  1M90 W;  1YCI A;  4LF5 B;  1Q86 W;  2CH7 B;  2YC0 A;  2Y4T A;  5LXT B;  2P5O A;  4JI2 O;  3CP1 A;  2E75 B;  4Q20 A;  1ROP A;  4QJF B;  5BR8 B;  1EM1 A;  2PI4 A;  4DRX A;  1SS3 A;  1SQG A;  2DWD C;  1IBM O;  4X1I A;  2V4D A;  3O9O A;  1L0N H;  1TUB B;  1MSW D;  1WLE A;  2Q68 A;  2P67 A;  3W7T A;  3JD4 A;  3DTU B;  3EXA A;  1K34 A;  5L3E A;  3HB3 B;  1F4N A;  2EIN B;  5EC1 C;  1SF9 A;  4LC1 A;  1GM8 A;  5FNV B;  1M4U A;  1OCC C;  3X2Q B;  4UXN A;  4FK5 C;  3SJB C;  3K3W A;  1NZ6 A;  4YIO A;  3DSQ A;  2BSK B;  1OCR C;  2H8P C;  2WLJ A;  1Q90 D;  2MW2 B;  3N27 A;  2HVK C;  4DUY B;  4NXN O;  3T2M A;  1V9P A;  2ZIM A;  4F6R A;  4GX1 A;  4DR2 O;  2AHY A;  4IIJ B;  2EIM B;  2ZR2 A;  1SKV A;  4ZI7 A;  4EB6 B;  2EZP A;  3QVN A;  1AP5 A;  1S5H C;  5C8Y B;  3SPG A;  2WA4 A;  1MZE A;  1MOF A;  1ZLZ A;  4CH3 A;  2Q67 A;  1B6Q A;  2WLI A;  2CUG A;  5B3S B;  5KLV H;  4H44 B;  4RUE A;  4JI5 B;  4UCT A;  2X6B A;  2P22 C;  4HYO A;  5TIS Z;  3ZHV A;  1NBM G;  2F95 B;  3BAA A;  4JI4 O;  2PUS A;  4XBF A;  3FX7 A;  1TVK A;  1Y74 A;  4JI7 B;  1ZL8 B;  1I5Y A;  2LQT A;  2JIZ G;  3F7Y C;  3S3X A;  4XDJ A;  2Q4P A;  3IC9 A;  4FIP C;  3E8H A;  3A8T A;  2H3O A;  2MK3 A;  3H01 A;  2YEV A;  2JGD B;  1ENV A;  2JVD A;  4DK0 A;  2ZE7 A;  1BQZ A;  5A9G A;  4H0L B;  5EBL C;  4GCZ A;  4LFA O;  3B09 A;  1EZJ A;  5CMU A;  3ICX A;  1BGY H;  3RYH A;  1XNQ O;  3H1J H;  4Q6G A;  3DXR A;  3E8G A;  5CA3 A;  3JAW A;  4DR1 O;  4B3S O;  1XL6 A;  1S5J A;  1K5S A;  1JOY A;  1WP8 A;  3OMN B;  2X7R B;  3CC2 V;  5BXZ A;  1JFF A;  1SRY A;  1K7D A;  1RPO A;  2YIB D;  3CRM A;  4WCE V;  4B3M O;  2EJ7 A;  1KB9 F;  2ZD9 A;  1VF6 A;  1QQC A;  3U10 A;  1G1X B;  1K92 A;  1PL0 A;  4F6E A;  1MSD A;  3OD4 A;  2BOC C;  1PPJ H;  4UVA A;  4X9Q A;  1VAR A;  1QLE C;  2EJR A;  4KUM A;  1YJ9 V;  3JD0 A;  4WFA V;  2PF4 E;  4HNA A;  2QR4 A;  4IHJ A;  5D5Q A;  1J5E O;  2XAG A;  5EIB C;  1SA0 A;  4JI0 O;  4DV1 O;  3LSS A;  5JH7 A;  3L74 H;  1VQ5 V;  3JAK B;  5CB4 A;  4PDM A;  4O4H B;  3AG1 B;  1KQS U;  2B5U A;  2OIE A;  5KHI A;  1GH6 A;  1HNX B;  5LP6 A;  4JI2 B;  1KKD A;  2DYS C;  4EFE A;  3SDL A;  1CPY A;  4RQF A;  2QTO A;  4MW3 A;  5DED A;  2VQE O;  4JAU A;  2A3Q A;  1VP7 A;  1QHT A;  3B4S A;  2JJ1 G;  1GAX A;  3L70 H;  1N4C A;  4O4I A;  1BE3 H;  2KKW A;  4JAS A;  4MTG A;  4D6T H;  4QPK A;  2ZNI A;  4NTW A;  1GN4 A;  3SPI A;  1AB3 A;  1TGO A;  1Z5V A;  3JD2 A;  4E4E A;  3KKY A;  1SQP H;  2CTQ A;  1K97 A;  3L75 H;  4OX9 O;  1MAB G;  2QWR B;  3AG4 C;  3CSX A;  3FB6 C;  3CCL V;  1VF6 C;  1BS3 A;  1I94 B;  1MMM A;  1EFR G;  5IYC O;  2XAQ A;  5L3D A;  3G80 A;  3E22 A;  4DO2 A;  4DV7 O;  1OZ0 A;  4O4J A;  4X64 O;  2BTQ B;  2Q73 A;  3RT3 C;  4WFB V;  3K57 A;  3CMA V;  4XDK A;  3ABM B;  5IJ0 B;  4NXM O;  2RNB A;  1Q5O A;  1K73 W;  2OCH A;  1H8H G;  3QNE A;  4ZHQ B;  4KFM A;  3OFN G;  5LOV A;  5KMG A;  2YIB A;  3F7V C;  1H2S B;  2WLL A;  5J2T A;  3SGI A;  4CZZ A;  5LP6 C;  2KG7 B;  3W7S A;  3OW2 U;  1D5A A;  1UPG A;  3VQY A;  4W4K A;  2Q7E A;  1YI2 V;  1YEW A;  3K79 A;  3MHH C;  1ZSP A;  2DE0 X;  2LFR A;  1THZ A;  3GWO A;  4FFB A;  3ZMZ A;  4E2L A;  1QVF U;  1KUQ A;  1YF2 A;  5B5E Z;  1XI1 A;  2NLJ C;  4KL1 A;  1FJG O;  4CS3 A;  4KHP O;  1NTZ H;  2UUC B;  4JI3 O;  4JYY A;  2GTA A;  3WG7 B;  1KEC A;  4NKG B;  4JF3 A;  5CA0 A;  1GN2 A;  3N2K A;  1EN6 A;  1Q8I A;  1M56 B;  1D5N A;  4LWS B;  3BA9 A;  2XAS A;  3G6E V;  1N32 B;  3M8A A;  4LFA B;  1DK1 A;  1XNQ B;  3G71 V;  1JX9 A;  2DOS A;  3ZN1 A;  4LF9 B;  4B3S B;  2D3O W;  2KSD A;  3K9A A;  1F4M A;  2E76 B;  4DV5 B;  4AIL C;  5LHG A;  1DGS A;  4K0K B;  4JAV A;  5EBW C;  1Y67 A;  4DR4 O;  2GBO A;  2Q7H A;  1NVP B;  4GKJ B;  1JA8 A;  2HHH B;  3ZCC A;  3QF7 A;  3ETQ A;  1ZX3 A;  3JSL A;  1H8E G;  2QSA A;  4LFC B;  2PTM A;  4AHC A;  1YXB A;  2W6I G;  3R66 A;  2WSS G;  4WBN B;  2W0X A;  1X4T A;  4CH6 A;  5H2F Z;  3CCQ V;  3SPH A;  2HKO A;  5E79 Z;  1O9G A;  3ASN B;  5JVD B;  4J10 A;  3N2G B;  4FFK A;  2JS3 A;  4JI0 B;  4NTX A;  4IYH A;  3RYI B;  4UCU A;  4FM2 A;  4B3R B;  2ZNJ A;  2E3C A;  1K8A W;  1QCE A;  2ZXW C;  1YTF B;  3THO A;  2CH7 A;  4FLZ A;  1XOU A;  4R6Z A;  5LXT A;  4H33 A;  1I7F A;  5J9P C;  5H6R A;  3WU2 Z;  4LF7 O;  1Y76 B;  4XDL A;  3TET A;  3B8M A;  2OWO A;  1YHQ V;  2AW9 A;  1PD3 A;  2OT5 A;  1NS1 A;  1RM1 B;  2JGU A;  1IXM A;  2IJI A;  2PYL A;  4GZR B;  2OCC C;  1TUB A;  1Y4M A;  1K4D C;  4I5S A;  1D2D A;  1AI5 A;  4G28 B;  2NR5 A;  3T4Z A;  4JYA B;  4LR3 A;  4O4L B;  4LF8 O;  4WF9 V;  1FYJ A;  2YXY A;  5LMU O;  5FNV A;  3DC6 A;  1HDJ A;  2K1E A;  3RVY A;  4L87 A;  3SYO A;  1LUW A;  3B40 A;  4GKK O;  2EX3 A;  2QM8 A;  4DV3 O;  2BSK A;  3JYC A;  4TUY B;  5B1B C;  3ZJZ A;  4ZIB A;  3MAQ A;  3FB7 C;  3K5M A;  2EIL C;  3P3P A;  4X64 B;  4IIJ A;  1N8R W;  4RO2 A;  1KP3 A;  3EVK A;  3M99 B;  3ASO B;  4NXM B;  4EB6 A;  3CRA A;  3BEH A;  1FPO A;  1VQL V;  5C8Y A;  4J9Z B;  4YXW G;  5B66 Z;  4DUZ O;  3BAB A;  2UXB O;  2VRZ A;  4UFZ A;  1GM9 A;  1AI6 A;  4J11 A;  4G27 B;  1VQN V;  1BL8 A;  3D3I A;  1IBL O;  1N33 O;  4P2Z A;  4PHZ A;  5LGT A;  2Q9L A;  4ZKI A;  4KHP B;  5KHJ A;  4RQE A;  1KC8 W;  4JI3 B;  1ZL8 A;  4YIP A;  3RYF B;  5E1A C;  3CCM V;  1M5I A;  4JI1 O;  2E74 B;  3ZRV A;  4K35 A;  3H1K H;  4JI8 O;  3ZMT A;  3OTO O;  2EIN C;  4FJC C;  4I0X B;  3X2Q C;  1GRJ A;  5H5N A;  4HAM A;  2IU3 A;  2XUM A;  1HR0 O;  3GWK C;  4X66 B;  3JAT B;  4HZ3 A;  2B1G A;  1TA8 A;  3A0H Z;  1JJ2 U;  3FYE B;  1AVM A;  2EIM C;  5EIB D;  1O9H A;  2YXL A;  2YIC A;  2WLM A; 
#chains in the Genus database with same CATH homology
 1PPJ H;  3CWB H;  1PP9 H;  3H1I H;  5KLV H;  1BE3 H;  3BCC H;  3H1L H;  4PD4 F;  1BCC H;  4U3F H;  2A06 H;  4D6T H;  1SQQ H;  3L73 H;  3L72 H;  1NU1 H;  3TGU H;  1KYO F;  1L0L H;  3L71 H;  3H1H H;  1SQX H;  1NTM H;  2FYU H;  2IBZ H;  1L0N H;  1KB9 F;  3H1K H;  3L74 H;  1BGY H;  3CXH F;  3H1J H;  1SQP H;  1NTK H;  1P84 F;  3L75 H;  2BCC H;  3CX5 F;  1NTZ H;  1SQB H;  1SQV H;  3L70 H;  1EZV H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...