1SQVH

Crystal structure analysis of bovine bc1 with uhdbt
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
67
structure length
67
Chain Sequence
ELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome c reductase complex core protein I, mit
total genus 16
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1sqvH00
3H1JH 3TGUH 4U3FH 4PD4F 1KYOF 2BCCH 1NTMH 3L71H 3L70H 1PPJH 3H1KH 1SQXH 1BE3H 1SQPH 1SQQH 2FYUH 1NTKH 1L0LH 3H1HH 1EZVH 5KLVH 1BCCH 1P84F 3CXHF 1KB9F 3L72H 1NTZH 2A06H 2IBZH 3L75H 1PP9H 3H1IH 3H1LH 3CWBH 3L73H 3CX5F 1SQVH 4D6TH 3L74H 3BCCH 1SQBH 1L0NH 1BGYH 1NU1H
chains in the Genus database with same CATH superfamily
4Z2WA 4YY3O 2ZNIA 1XMQB 5LHGA 2M7WA 5LXTA 3HPLC 2QKAA 1FYJA 4PDRA 3SPJA 4DUYB 3WG7C 4IYIA 3G6BA 3ZMVA 3RYHB 4R6ZA 1YITV 2XASA 1KD1W 4MVZA 1XQ8A 1EN5A 3G71V 4UCVA 3C90A 4BW5A 3ZEDA 3ASOC 1VIBA 1IBMO 2EIJC 1JA8A 2ILMA 1Y66A 2XAGA 3PN1A 4BIUA 4NYKA 4GKJO 4B3TB 4MVMA 4K8ZA 5B66Z 2KB1A 4QGPA 1JQ0A 4TV8B 1XILA 1D5NA 1HNXO 3JYCA 2QWNB 3UKMA 4IHJB 1XNRB 1GN6A 3CB2A 4UVBA 4I9QA 1GN2A 4CH5A 1RPOA 3CRCA 3CS5A 2Q0OC 5LHHA 3T2MA 4GCZA 3JARB 4CBCA 3QNEA 2YEVB 5J2TB 2Z0AA 4X20A 3T4DA 1K33A 2EIMC 3RYCA 4WFFA 4LF8B 3LSSA 2WLIB 4EB6A 5BR8B 4K35A 4X62O 1WAZA 5IYCO 1N36B 2IJJA 3CC7V 4LH6A 1ZSPA 3ZN1A 1FXKA 1P49A 3ASNC 1PPJH 4DV1B 4I4TB 2R70A 5BR8O 4XBFA 2WPDG 2P4KA 2CDYA 4JAVA 1R3JC 3CCSV 2H8PC 5L3FA 4JAAA 3CCMV 4NXNB 3KG2A 1W59A 3QO5A 1QVGU 3OTFA 4X1YA 5LOVA 1I5XA 3L71H 4JAUA 4LNUA 4J7ZA 3JAWB 3SJQC 2W6IG 3R66A 5DECA 2Z3YA 3A0BZ 1Q82W 1HR0O 4MSWC 1TAEA 2XAQA 5EIBD 3A2FA 1GKFA 2ZR3A 3TCUA 2LFRA 3ZRWA 3P3PA 4TQDA 1ZUQA 2ZR2A 5KAIZ 1VF6C 2DQ0A 1M4UA 1V55C 1ZX3A 3STLC 2E74B 2A06H 4GX1A 2XAFA 3K06A 4X1IA 1I0HA 1IX9A 2PYJA 1XL4A 1K34A 1J5EB 3D36A 1SF9A 4P9PA 1NR1A 4JI7B 4P2ZA 5EC1C 4DV0B 4J9ZB 1XEQA 1US6A 4XDJA 3OW2U 1EZJA 3DXRA 4YJ2B 1R3IC 5HFMA 5B1NA 4LWSB 4DR5B 2EIMB 1YDXA 3OGCC 5ITZA 4XDLA 3N2GA 2FTKA 2NN4A 1NKDA 4EKWA 1UPGA 4DV5O 3AG4B 4JASA 3OUFA 2QE7G 2BTQB 5CBHA 2PUSA 3L9DA 2YSUB 3U11A 1Q81W 1GM9A 3E22A 1B06A 1SA0A 4BIZA 3AG1B 2GDSA 3UT5B 2UUBB 1JPXA 4OPHA 2HG5C 3JASB 1S5LZ 2WLLA 1GM8A 1GO3F 4FM1A 2WLIA 4EB6B 3ZIAG 4NB5A 1IURA 1OHHG 2WA3A 4B08A 4GKKB 4BIOA 4IL6Z 2Q5ZA 1TUBB 1QLEB 2AZ2A 3WB0A 1MSWD 4FLUA 1OCOB 3F7YC 4U3JB 3JSLA 4ZOLB 4FZ0A 3CEIA 5IWAB 3QO7A 1VP7A 2WAMA 2YIDA 2QA4V 2EJRA 4UCTA 4JZGA 1NQTA 2P4VA 4JV5O 1R3KC 1IDSA 4DV1O 4X1YB 5H2FZ 1VF5B 1Q3EA 2EBOA 4LC1A 4U7OA 5BY1A 1JR9A 1PD3A 4JI3O 1GAXA 3LNMB 3K0GA 1S5HC 4MTXA 4YXWG 3SJBC 1K73W 4FZ1A 4GKKO 4ABMA 1QLEC 3N2KA 4LF4O 2F23A 1CP9A 1GM7A 4ICGA 5KA5A 1BSMA 5H6RA 1FXVA 3ABLB 1NU1H 1IBKO 4LF5O 3R65A 4HBNA 1JFFB 3L70H 2Y48A 3CRMA 4RQFA 2XAHA 1IBMB 1OCZC 5FNVB 3KKYA 4I7ZB 2UXBB 1M9NA 3K0DA 3OTOB 2CE4A 2ZIMA 4WFGA 3P32A 4LFCO 1NBMG 3FB5C 2JJ2G 4FFKA 4UB6Z 3OEEG 4NXMO 1MA1A 4Q6GA 4PD4F 1BL8A 4UFZA 4FLZA 2JEXA 2M6YA 5K1XA 4R7CA 2Q7EA 3W7XA 1YJ9V 2PTMA 3CCQV 1FFXB 2D3OW 3VQXA 3L73H 3N2KB 3ABUA 1K97A 3C3TA 4WCEV 3EVKA 4W4LA 4DV7O 4DUYO 5CA3A 4NKGB 3RYIB 5LP6C 1SQXH 3EFFK 5K1PA 1HNWB 4LP8A 3LDEA 4MVRA 4J80A 2Q0AA 1XHZA 2X0LA 3OR6C 1WB8A 3OM3B 1OCZB 3A8TA 3FYEB 4L87A 5CBFA 3VBBA 2Q67A 4DUZB 1EFRG 2VS0A 4Z1VA 2ZM6B 5KA6A 5FL7G 3W7WA 1G4YB 1RM1B 3ZRSA 2QTOA 3ZJZA 3JALB 4NTYA 1YTFD 4JYAO 3ZMTA 3H1LH 2F43G 4CH6A 2WSSG 3K9AA 4JI1O 4JYYA 1HP8A 2P5OA 4B7EA 1BHAA 4U7NA 4O4HA 2KSDA 1QCEA 1HR0B 1P4RA 1AVMA 1GN3A 1H38A 1NTKH 3RYHA 2XUMA 2ZXWC 4NTWA 3SYPA 2Q8VA 2Y69B 4LFCB 5KHGA 1W0KG 3JATB 3H1IH 1CXZB 2ZINA 5IE9A 4X62B 1MZFA 1IZ3A 4ZI7A 5FLXN 3ML0A 3D8CA 4TV8A 1AJPA 2ZE6A 4EFEA 4ASUG 2UUCB 1FKAO 1A32A 2D2CB 1Y76B 2BTOA 1YHQV 2HR3A 3CYOA 4FLTA 3AG3C 3BY6A 1VQKV 5LGUA 4DR1B 3DC5A 1N36O 1MG1A 3F5WC 3ICXA 2R72A 2L35A 2YEVA 4I55A 1KQSU 3IFXA 3FAVA 4DR4B 1IXBA 1S72V 1QQCA 2UU9O 1MZEA 5JH7B 3DSQA 4FIPC 5IJ9B 1X4TA 3MAQA 1YIJV 3T1CA 2E3CA 5JJNB 2YXLA 1Q6UA 1OCOC 1XDCA 1SQBH 3OD4A 4O2BA 5B1AC 4WFEA 2IU0A 2ZM6O 2WLMA 3CCUV 3K03A 1L1FA 2Y4UA 2UXDO 2VRZA 2VWJA 1VQ5V 5KAFZ 2AW9A 3CRAA 4DR7B 2RQ6A 4UCSA 2ZXWB 2L6LA 4LFBO 1Y76A 4PA6A 1D2DA 5EBLC 2QWQB 3SYQA 3H9VA 3JAWA 4LCUC 1RP3B 2NR5A 5LMUB 4L8JA 2DYRB 2UUAB 2Q69A 3ABMC 1F23A 4ZBMA 3QO8A 4DR5O 2OTLV 4IGGA 1W0JG 5LP6B 3RVYA 4DV2B 5EC2C 1GK9A 1Y6XA 2EIKB 4FFBB 5KHKA 1M56C 4X1KB 5KMGA 3K5LA 3N27A 5EBMC 3OEHG 3BPZA 3M7MX 2OIGA 4X9QA 1KBHA 3RN4A 4DV2O 1SESA 4J7KA 2DYRC 4KXRA 3ZBHA 4O2BB 1HDJA 3VQVA 1JJOA 3EXAA 4HAMA 3RYCB 3ZRVA 2X6BA 1VARA 5C93A 2PI5A 1V54B 1H2GA 1XI1A 1RM1C 1R6TA 4PDMA 3ZHQA 3ZHSA 4NVPA 1M56B 2JEUA 3O65A 4A5UB 4JI2B 4DV6B 4B3MB 4FM0A 3BEHA 4YIOA 3HKBB 2HEPA 4EFBA 3K08A 5EYPB 2JGDA 2DN9A 3LNNA 2QKSA 4DR1O 4D7TA 1AI6A 2A0LA 3FB8C 3OGIB 2JGUA 4LNUB 3T1HB 4UV8A 3B09A 3AK1A 5LP6A 4B3SO 4E4EA 2UXBO 2CGNA 4MVOA 5GTIZ 4JZ2A 1R3LC 3ETDA 1AR1B 2WLLB 3W7SA 3HKCB 1H2KA 2OWOA 2FKXA 4WFAV 4PI0A 3ZRWB 5JH7A 5TISZ 2EIJB 4H0LB 2A3QA 1OJHA 4FM2A 4CS4A 3JAMN 4JI4B 4XDKA 1XUQA 1YI2V 2AXTZ 1J95A 1QU7A 3WG7B 5JCOC 5EYPA 1BHBA 4H44B 3FFQA 5LMNB 2Q6AA 5GTHZ 1RSOB 2IW5A 1N4CA 2P6JA 4MTFA 3KZIZ 4DR3O 3GB7C 4LF7O 3ZHUA 1W2BU 2JS3A 3CCEV 1U97A 1YZBA 1OV9A 2AZ0A 4GX0A 3SPIA 3FB7C 1G8MA 1SQVH 1TVKA 1OZ0A 2ZIOA 4QJFB 3AEIA 1ZAUA 1I94B 1DK1A 4X1KA 1F7YA 3GWOA 2ARHA 1LUWA 1AI4A 1BZKA 2QM8A 4GT1A 2WA4A 3G4SV 5GONB 4TV9B 4DXWA 1YJNV 4DK1A 3SPHA 3AG4C 1XMOO 3BHPA 4WBNA 4J7JA 4LF6O 1GH6A 1PL4A 3JD0A 4H13B 5LHIA 4ZOLA 4DV5B 3AG1C 3K59A 4F6EA 2RMKB 5EBWC 1AB3A 2QTSA 3E83A 1AR4A 3HB3B 5B3SC 3OUSA 3TJTA 4X65O 2YXHA 1NTZH 4IIJB 2IJKA 3AK3A 1XOUA 2JVDA 3K04A 3CJHA 4JI6O 4PELA 5J2UB 3AG3B 5IYBO 5B1AB 2CH7A 1TVKB 5IJ0A 3Q4HB 5IDJA 3QG5A 4OXSA 3ABKC 2YIBD 1P84F 1QHTA 3B2EE 4JI5B 1FAFA 3HKCA 5CB4A 2P06A 1YTFB 3CHXA 4TUYB 4U3FH 4LR3A 3RVZA 2DYSC 2XOKG 3A0HZ 5JWPA 2BSKB 3SYAA 4JI8O 2K9PA 2NLJC 3SPGA 5KHJA 5EIBC 3B8NA 3CE2A 4EEQA 4IHJA 3U0ZA 1SZTA 1N34B 3C3SA 4LF9B 5CA1B 4AI8A 3WFVA 3SJCC 2EJ7A 2QKCA 4DR2B 1WP7A 2YXYA 2LQTA 4ZIBA 1Z5VA 1I08A 1WPBA 3H1HH 4GZRB 1OCRC 1V54C 1ZLZA 4JI3B 1S3JA 1RFYA 5CN0A 1KP3A 5LXTB 1L8DA 3TXQA 4H33A 3DGEA 4AQYO 1Q7YW 2ZDIA 3MD0A 1Q8IA 1DGSA 2QM4A 1JJ2U 2DW4A 3J80N 1AROP 1TA8A 4JTDB 5BZBA 1GMGA 4ZI7B 3KCXA 2R9IA 3FB6C 2LJ2A 4B3RO 2QJ1A 1GRJA 2CAZC 3RYIA 3BVOA 1AILA 2MW2B 4JI6B 4TV9A 2WWWA 1S0VA 3HKEA 4WBNB 3THOA 3AG2C 1K5SA 2OTJV 2B9ZA 1NR7A 4I55B 4O4JA 1JX9A 1D5AA 4O4IB 1PP9H 2GV9A 2Z5UA 1YEWA 2BOBC 1IBLO 1EN6A 2X7RB 2GHYA 2FB5A 4X20B 3K79A 2F4VO 1AP5A 3H1KH 4JYAB 1PNLA 4MT8A 5IJ0B 3OR7C 3IAYA 3K3WA 2OYQA 1U96A 2F1MA 4JF3A 1BQZA 4IT5A 1HW7A 4CC5A 1BS3A 2PF4E 4DRXB 4ZHQB 1I94O 5CBGA 2QGNA 5DN6G 2PI4A 5IYZA 3UQ8A 4P30A 3GVMA 3RBZA 1ZL8A 1Q90D 1SZXA 3VQYA 3ZHTA 3RFRA 4AILC 1HNZB 2DWEC 2EINC 5GW7A 4FFBA 3OE7G 3CPWU 3STZC 1M90W 1R73A 5C8YB 3TGUH 4HYOA 1R6KA 1JVMA 1YF2A 4PHZA 4I5SA 4TQFA 2YUAA 2KG7B 3UT5A 4X8AA 3K9SA 3B4SA 1KUQA 2F95B 1SKVA 5LYJB 1AP6A 2JIZG 3LSUA 3LDDA 3S3XA 4LF4B 4DRXA 5JJJB 1RPRA 2RNBA 2CTPA 2FL4A 1NTMH 5KX5B 1QBZA 5JCOA 4U3JA 2ZQMA 3NR7A 4LFAB 1Q6HA 5J9PC 3CX5F 3ZHRA 1XNQO 1H8HG 1PM9A 1M93A 1AR5A 1BGYH 3CMEV 4LF5B 2EILC 2JGDB 1KC8W 3DXRB 2AHZA 4JI4O 1Y74A 1K92A 1H2MA 3GWKC 5C8YA 1HNXB 1SQQH 4X66B 5LGNA 3K5MA 3E89A 2PZSA 3KCYA 2PYLA 2EZOA 3D3IA 2N74A 1Z5WA 1Q5OA 3ZRXA 3ZCCA 3OMIB 4O4IA 1PNMA 1THZA 2QWPB 4X88A 2Q9LA 1AJNA 1DF5A 1VEWA 3JD1A 4KFMA 4DV7B 4I4TA 3NXSA 3CCVV 2CGOA 3JSNA 1ENVA 1YXBA 2GUZB 1ZWIC 4CH4A 2GTSA 2N04A 2CTRA 1NS1A 3S3WA 2N05A 2F4VB 1VQ7V 4OGQB 3F5TA 4Z1MG 4G27B 1IBLB 4PI2A 3EHBB 1WB7A 3E35A 4D7SA 1XNRO 1KP2A 2DQ3A 4PJ0Z 4F6RB 1ZL8B 5AG2A 4K0KB 3JD2A 1OCCB 4UB8Z 3H1JH 5JVDB 3SJAC 5LMUO 4W4KA 1KYOF 2OCCB 4RUEA 4K3AA 1QLNA 3ASNB 4X64B 1DF4A 1R6NA 2V7QG 1V55B 1XMQO 4YY3B 1R1BA 5L3DA 2F93B 3CP1A 3ZMZA 2KG7A 5L3EA 2ADQB 5A9GA 5BXZA 1H2NA 4J10A 1N32B 4FLYA 2ADPA 1SRYA 3A0RA 5GONA 2JRIA 4OX9O 1PKXA 2DYSB 5JQGA 4PDVA 1L0LH 5D5PA 1BCCH 5KX5A 4BR6A 1X59A 4J11A 4YJ2A 1IVSA 4NXNO 1OCCC 2OT5A 4O2AB 1S5JA 4LWSA 1VMGA 1CPYA 3MDSA 4KP4A 4B3RB 1VQMV 1FJGB 4F6RA 1J5EO 4H37A 1Y67A 5ITZB 2BCCH 4RWUA 4I50A 1RSOA 4FLWA 2OCCC 1EZVH 3Q4HA 5LMNO 2WLHA 1MMMA 1M57C 1YSCA 3E22B 3ABLC 4R8CA 4QPJA 2AHYA 2YIBA 3DC6A 3UO3A 2VQEB 1XL6A 1VQ8V 5KUMA 2P22C 2CK3G 1ZTEA 1K5QA 3OAAG 1H8EG 1WP8A 4LH7A 3FX7A 4CC6A 4TUYA 5H9CA 2E75B 3T4ZA 3CRRA 2ZKOA 1S77D 5CB4B 2P90A 3CC2V 2OCHA 3ZX6A 2EX3A 5BMVA 4D6TH 1F4MA 3WB2A 1FJGO 5HFLA 2RCVA 1KU9A 2XNDG 4DO2A 4QE7A 3SYOA 4QIWF 3OMNB 5CA1A 4B3TO 3X2QC 3F7VC 4FVMA 3AG7A 4PA9A 4JI8B 2LW1A 3JAKB 4PA7A 3JCUZ 5IY5B 4OX9B 4HNAB 1K4DC 4J9YB 3L74H 4R50A 1VQPV 4PV1B 4OPAA 4FJCC 2B1GA 3N2GB 1FFTB 5LL6Y 5IJ9A 4LF6B 1F4NA 4IIJA 4KL1A 2HLDG 2ITCC 4Q20A 4QE9A 4YHHO 2RJZA 2CH7B 4HZ3A 4KHPO 1Z2GA 2YS8A 4AHCA 1N33O 3SR2C 5KUKA 3OT7A 3ETGA 1FD9A 4I0XB 2IH3C 1HNZO 4GLXA 4O4LB 1SQPH 2ZT9B 3UCSC 2HHHB 4YJ3A 4BWAA 3IC7A 3CCJV 1UFIA 4GKJB 3W7UA 2BSKA 3VQWA 4RAIA 4DV6O 4JI2O 4G28B 5B1OA 3UO2A 2DOSA 3CSXA 1I7FA 1G6UA 4NXMB 1QR8A 3APQA 4X89A 3I5DA 2RN9A 3QF7A 1WJZA 5B1BC 1XBLA 3CXCU 4JTCB 5D5QA 5L3BA 1P7GA 2LP7A 1F51A 2Y0IA 5L3GA 2YDEA 4DV0O 4TT3G 3E8GA 3RYFB 1MNGA 4FK5C 1AJQA 2CTWA 4NTXA 3DTUB 4WFBV 3BAAA 3X2QB 3T1YB 2HJDA 2EULA 3WU2Z 3K58A 1WPXA 2FYUH 2JK5C 5H6QA 4X66O 3CCLV 2VWKA 4B7KA 4ZHQA 2JS5A 4FPPA 3CD6V 1FPOA 4LF9O 2VQEO 1SETA 2IJHA 5LGTA 2HVKC 5B1BB 1WA8A 1FS0G 1KKDA 4UVCA 3D3QA 1FXKC 2H94A 2ZE8A 2UXCO 1NVPB 2PY5A 4UXNA 3UM7A 2OIEA 1N34O 3E8BA 1VF7A 3JALA 1COWG 1OCRB 2YI8A 2CUGA 1VQ4V 3MHHC 4CH3A 4KUMA 3W7TA 1NI8A 4DV4O 1LR1A 3RGBA 2QWOB 2EIKC 2ATKC 2UUCO 3I56V 3E8HA 2X6AA 5EK0A 2G38A 3RYFA 4DR4O 4ZKIA 1ROPA 1O9HA 5LBQA 5KMGB 1QNMA 2YICA 2E5LB 1M5IA 1FXKB 1SS3A 2CTQA 1E1QG 3SGIA 5FPOA 3SPCA 4J41A 3FKSG 4PA3A 3PJSK 1HWYA 2WLNA 2HJFC 3M99B 3T1HO 1JCHA 1V9PA 1H2LA 2WLKA 3SYCA 3D36C 2B1IA 1PV0A 2Y0PA 5IYZB 4I0XA 3B8MA 1SC5B 1SERA 1K8AW 4WFHA 4YJ3B 1LNQA 5LOVB 2HHHO 3TK1A 1Q6IA 2ZD9A 1DLBA 1MSDA 2UUAO 5CA0B 4MW8A 4RUFA 4JI0B 4DR6O 4PA4A 1S76D 3JD4A 4QNHB 4NR1A 3IJ4A 4CZZA 4DW1A 2UUBO 4JI7O 2Y69C 4JI1B 2VQFO 5E1AC 1HNWO 4GUNA 3ZMUA 4RQEA 2XHBA 2UXDB 2WLJA 2QDOA 5IY5C 4DR6B 4JI0O 4TOIA 1NH2D 2LGWA 2BOCC 4DV3B 2DE0X 2A9HA 2XTAA 5LYJA 1SQGA 3ASOB 2ETNA 4K0KO 3TXSA 1QVFU 3HKDB 1JOYA 2LW7A 2Q68A 4YHHB 3L75H 5IT9N 2UXNA 1TUEB 2E5LO 2B5UA 4UV9A 1EN4A 1WLEA 2HP8A 2GTAA 5EZYB 4DV4B 2EINB 1BMFG 3P3NA 5KHIA 3CCRV 1Y74B 2FMLA 5CA0A 3QTCA 3IGAC 4GX5A 4DR3B 4I9WA 3LDCA 3CJHB 1MOFA 4DR2O 1K7DA 5JVDA 3BABA 4LF7B 2IBZH 4BAYA 4DYLA 2ZCEA 5KHHA 2F66C 3BA8A 2QM7A 2ZE5A 2ITDC 4JGSA 2BTQA 1E1RG 1KMIZ 1K9MW 1K3EA 4K8XA 2Q4PA 5B3SB 2R9RB 4UCUA 1IBKB 1NH2B 1VQNV 1Q43A 1QR9A 1Y4MA 2R9AA 1KB9F 2MK3A 3FAVB 5CMUA 3JCZA 4C7UA 2LFSA 1AI5A 3ZS8C 4LBEC 3HKDA 3ETQA 3OTOO 4JI5O 1CEZA 5JQGB 4X1IB 1KKCA 4O2AA 3M8AA 4WF9V 4JYCA 1NZ6A 4TSFG 1FXHA 4MVQA 1P7BA 4CS3A 4MS2A 1XHXA 2IJIA 2O57A 3HKBA 1I5YA 2GUZA 3CXHF 1BQ0A 3QVNA 3CRQA 3E8FA 5B5EZ 3RW0A 1H2SB 2IH1C 3JD3A 4UVAA 5F2VO 2GBOA 3E86A 3G80A 4P9OA 3K5OA 2K1EA 3E2EA 5J2UA 1BT8A 1NJIW 1SA0B 1VQOV 4JYBA 3B77A 1N0NA 1XMOB 4X64O 2GSMB 3ZHVA 3LSQA 5DEDA 4UCOA 5JJEB 3HR0A 3BA9A 1PNKA 3JASA 1G1XB 3FYIB 3BRCA 3TETA 2YC0A 1M57B 4JV5B 1DTOA 3RT3C 2W0XA 4DK0A 4FMTA 1JFFA 1MABG 4BW9A 3MHSC 1TUBA 4N23A 4FLVA 2VQFB 4HNAA 3APOA 1NVPD 2X6CA 2Q73A 2H3OA 5FNVA 2A79B 1B6QA 4MTOA 2HKOA 4O4JB 3OMAB 2V1DA 3ABKB 1Q86W 5EZYA 5KLVH 1O9GA 1GN4A 1T5EA 1N33B 3ABTA 5LA6A 3SDLA 3ZMSA 2ZNJA 4DV3O 3CC4V 3CWBH 2KQXA 3G6EV 1SQFA 4N21A 1VQLV 4I50B 4TWKA 2Q7GA 2UU9B 4DR7O 3AG2B 3B40A 5L3CA 3I55V 2QEXV 1FFXA 2P7TC 3BFRA 5E79Z 2ZE7A 1XREA 2BE3A 4UCRA 4IYHA 3CMAV 3L72H 1K4CC 1IXMA 3AK2A 4MW3A 4MVSA 2DJVA 3K57A 4AQYB 3P30A 1GTOA 4KHPB 1WN7A 4QPKA 5FPRA 4O4LA 2A7WA 5BMVB 5A2QN 1VQ6V 3U10A 2LGQA 1M1KW 4LFBB 5IYDO 1XNQB 2XT9A 4LFAO 3J81N 1E79G 1URFA 1UJWB 3LUTB 4RO2A 3J7AU 3HKEB 3JAKA 4G2KA 4B3SB 1B3QA 4YIPA 1AI7A 1B04A 1VQ9V 5LA6B 4MVUA 2QR4A 2LO1A 1N8RW 3JARA 2RDCA 5J2TA 2P67A 2UXCB 2HVJC 2W6JG 4UUJC 1LUVA 2HFEC 3IC9A 2JJ1G 1PL0A 2QSAA 1KECA 3K5NA 4GX2A 5H5NA 4E2LA 2IU3A 5DM6V 4O4HB 4B3MO 3H01A 2W0FC 4GYCB 1EBOA 4F4LA 4PDLA 3OFNG 3WB1A 1BE3H 2C2AA 2AGAA 4JPRA 3JATA 3T1YO 2IM9A 4DW0A 1YJWV 2JDIG 5IWAO 2QWRB 2V4DA 1N0JA 2NNUA 2ZDIC 4LF8O 2DMXA 1YCIA 1TGOA 2YI9A 2Q7HA 1L0NH 2E76B 2XAJA 1NT2B 1WA8B 3ZN0A 3FD9A 2YIAA 4CS2A 2EILB 2KKWA 1EM1A 2UXXA 1VF6A 4X65B 3O9OA 4JTAB 1WNSA 2DWDC 3ETEA 1N32O 2Y4TA 1ORQC 1YVWA 3G67A 3VOUA 4DUZO 3RWRD 2ODMA 3ABMB 2PGGA 4FLXA 3BCCH 1JMKC 4MTGA 2EZPA 4J42A
chains in the Genus database with same CATH topology
3H1JH 3TGUH 4U3FH 4PD4F 1KYOF 2BCCH 1NTMH 3L71H 3L70H 1PPJH 3H1KH 1SQXH 1BE3H 1SQPH 1SQQH 2FYUH 1NTKH 1L0LH 3H1HH 1EZVH 5KLVH 1BCCH 1P84F 3CXHF 1KB9F 3L72H 1NTZH 2A06H 2IBZH 3L75H 1PP9H 3H1IH 3H1LH 3CWBH 3L73H 3CX5F 1SQVH 4D6TH 3L74H 3BCCH 1SQBH 1L0NH 1BGYH 1NU1H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H1J H;  3TGU H;  4U3F H;  4PD4 F;  1KYO F;  2BCC H;  1NTM H;  3L71 H;  3L70 H;  1PPJ H;  3H1K H;  1SQX H;  1BE3 H;  1SQP H;  1SQQ H;  2FYU H;  1NTK H;  1L0L H;  3H1H H;  1EZV H;  5KLV H;  1BCC H;  1P84 F;  3CXH F;  1KB9 F;  3L72 H;  1NTZ H;  2A06 H;  2IBZ H;  3L75 H;  1PP9 H;  3H1I H;  3H1L H;  3CWB H;  3L73 H;  3CX5 F;  1SQV H;  4D6T H;  3L74 H;  3BCC H;  1SQB H;  1L0N H;  1BGY H;  1NU1 H; 
#chains in the Genus database with same CATH topology
 4Z2W A;  4YY3 O;  2ZNI A;  1XMQ B;  5LHG A;  2M7W A;  5LXT A;  3HPL C;  2QKA A;  1FYJ A;  4PDR A;  3SPJ A;  4DUY B;  3WG7 C;  4IYI A;  3G6B A;  3ZMV A;  3RYH B;  4R6Z A;  1YIT V;  2XAS A;  1KD1 W;  4MVZ A;  1XQ8 A;  1EN5 A;  3G71 V;  4UCV A;  3C90 A;  4BW5 A;  3ZED A;  3ASO C;  1VIB A;  1IBM O;  2EIJ C;  1JA8 A;  2ILM A;  1Y66 A;  2XAG A;  3PN1 A;  4BIU A;  4NYK A;  4GKJ O;  4B3T B;  4MVM A;  4K8Z A;  5B66 Z;  2KB1 A;  4QGP A;  1JQ0 A;  4TV8 B;  1XIL A;  1D5N A;  1HNX O;  3JYC A;  2QWN B;  3UKM A;  4IHJ B;  1XNR B;  1GN6 A;  3CB2 A;  4UVB A;  4I9Q A;  1GN2 A;  4CH5 A;  1RPO A;  3CRC A;  3CS5 A;  2Q0O C;  5LHH A;  3T2M A;  4GCZ A;  3JAR B;  4CBC A;  3QNE A;  2YEV B;  5J2T B;  2Z0A A;  4X20 A;  3T4D A;  1K33 A;  2EIM C;  3RYC A;  4WFF A;  4LF8 B;  3LSS A;  2WLI B;  4EB6 A;  5BR8 B;  4K35 A;  4X62 O;  1WAZ A;  5IYC O;  1N36 B;  2IJJ A;  3CC7 V;  4LH6 A;  1ZSP A;  3ZN1 A;  1FXK A;  1P49 A;  3ASN C;  1PPJ H;  4DV1 B;  4I4T B;  2R70 A;  5BR8 O;  4XBF A;  2WPD G;  2P4K A;  2CDY A;  4JAV A;  1R3J C;  3CCS V;  2H8P C;  5L3F A;  4JAA A;  3CCM V;  4NXN B;  3KG2 A;  1W59 A;  3QO5 A;  1QVG U;  3OTF A;  4X1Y A;  5LOV A;  1I5X A;  3L71 H;  4JAU A;  4LNU A;  4J7Z A;  3JAW B;  3SJQ C;  2W6I G;  3R66 A;  5DEC A;  2Z3Y A;  3A0B Z;  1Q82 W;  1HR0 O;  4MSW C;  1TAE A;  2XAQ A;  5EIB D;  3A2F A;  1GKF A;  2ZR3 A;  3TCU A;  2LFR A;  3ZRW A;  3P3P A;  4TQD A;  1ZUQ A;  2ZR2 A;  5KAI Z;  1VF6 C;  2DQ0 A;  1M4U A;  1V55 C;  1ZX3 A;  3STL C;  2E74 B;  2A06 H;  4GX1 A;  2XAF A;  3K06 A;  4X1I A;  1I0H A;  1IX9 A;  2PYJ A;  1XL4 A;  1K34 A;  1J5E B;  3D36 A;  1SF9 A;  4P9P A;  1NR1 A;  4JI7 B;  4P2Z A;  5EC1 C;  4DV0 B;  4J9Z B;  1XEQ A;  1US6 A;  4XDJ A;  3OW2 U;  1EZJ A;  3DXR A;  4YJ2 B;  1R3I C;  5HFM A;  5B1N A;  4LWS B;  4DR5 B;  2EIM B;  1YDX A;  3OGC C;  5ITZ A;  4XDL A;  3N2G A;  2FTK A;  2NN4 A;  1NKD A;  4EKW A;  1UPG A;  4DV5 O;  3AG4 B;  4JAS A;  3OUF A;  2QE7 G;  2BTQ B;  5CBH A;  2PUS A;  3L9D A;  2YSU B;  3U11 A;  1Q81 W;  1GM9 A;  3E22 A;  1B06 A;  1SA0 A;  4BIZ A;  3AG1 B;  2GDS A;  3UT5 B;  2UUB B;  1JPX A;  4OPH A;  2HG5 C;  3JAS B;  1S5L Z;  2WLL A;  1GM8 A;  1GO3 F;  4FM1 A;  2WLI A;  4EB6 B;  3ZIA G;  4NB5 A;  1IUR A;  1OHH G;  2WA3 A;  4B08 A;  4GKK B;  4BIO A;  4IL6 Z;  2Q5Z A;  1TUB B;  1QLE B;  2AZ2 A;  3WB0 A;  1MSW D;  4FLU A;  1OCO B;  3F7Y C;  4U3J B;  3JSL A;  4ZOL B;  4FZ0 A;  3CEI A;  5IWA B;  3QO7 A;  1VP7 A;  2WAM A;  2YID A;  2QA4 V;  2EJR A;  4UCT A;  4JZG A;  1NQT A;  2P4V A;  4JV5 O;  1R3K C;  1IDS A;  4DV1 O;  4X1Y B;  5H2F Z;  1VF5 B;  1Q3E A;  2EBO A;  4LC1 A;  4U7O A;  5BY1 A;  1JR9 A;  1PD3 A;  4JI3 O;  1GAX A;  3LNM B;  3K0G A;  1S5H C;  4MTX A;  4YXW G;  3SJB C;  1K73 W;  4FZ1 A;  4GKK O;  4ABM A;  1QLE C;  3N2K A;  4LF4 O;  2F23 A;  1CP9 A;  1GM7 A;  4ICG A;  5KA5 A;  1BSM A;  5H6R A;  1FXV A;  3ABL B;  1NU1 H;  1IBK O;  4LF5 O;  3R65 A;  4HBN A;  1JFF B;  3L70 H;  2Y48 A;  3CRM A;  4RQF A;  2XAH A;  1IBM B;  1OCZ C;  5FNV B;  3KKY A;  4I7Z B;  2UXB B;  1M9N A;  3K0D A;  3OTO B;  2CE4 A;  2ZIM A;  4WFG A;  3P32 A;  4LFC O;  1NBM G;  3FB5 C;  2JJ2 G;  4FFK A;  4UB6 Z;  3OEE G;  4NXM O;  1MA1 A;  4Q6G A;  4PD4 F;  1BL8 A;  4UFZ A;  4FLZ A;  2JEX A;  2M6Y A;  5K1X A;  4R7C A;  2Q7E A;  3W7X A;  1YJ9 V;  2PTM A;  3CCQ V;  1FFX B;  2D3O W;  3VQX A;  3L73 H;  3N2K B;  3ABU A;  1K97 A;  3C3T A;  4WCE V;  3EVK A;  4W4L A;  4DV7 O;  4DUY O;  5CA3 A;  4NKG B;  3RYI B;  5LP6 C;  1SQX H;  3EFF K;  5K1P A;  1HNW B;  4LP8 A;  3LDE A;  4MVR A;  4J80 A;  2Q0A A;  1XHZ A;  2X0L A;  3OR6 C;  1WB8 A;  3OM3 B;  1OCZ B;  3A8T A;  3FYE B;  4L87 A;  5CBF A;  3VBB A;  2Q67 A;  4DUZ B;  1EFR G;  2VS0 A;  4Z1V A;  2ZM6 B;  5KA6 A;  5FL7 G;  3W7W A;  1G4Y B;  1RM1 B;  3ZRS A;  2QTO A;  3ZJZ A;  3JAL B;  4NTY A;  1YTF D;  4JYA O;  3ZMT A;  3H1L H;  2F43 G;  4CH6 A;  2WSS G;  3K9A A;  4JI1 O;  4JYY A;  1HP8 A;  2P5O A;  4B7E A;  1BHA A;  4U7N A;  4O4H A;  2KSD A;  1QCE A;  1HR0 B;  1P4R A;  1AVM A;  1GN3 A;  1H38 A;  1NTK H;  3RYH A;  2XUM A;  2ZXW C;  4NTW A;  3SYP A;  2Q8V A;  2Y69 B;  4LFC B;  5KHG A;  1W0K G;  3JAT B;  3H1I H;  1CXZ B;  2ZIN A;  5IE9 A;  4X62 B;  1MZF A;  1IZ3 A;  4ZI7 A;  5FLX N;  3ML0 A;  3D8C A;  4TV8 A;  1AJP A;  2ZE6 A;  4EFE A;  4ASU G;  2UUC B;  1FKA O;  1A32 A;  2D2C B;  1Y76 B;  2BTO A;  1YHQ V;  2HR3 A;  3CYO A;  4FLT A;  3AG3 C;  3BY6 A;  1VQK V;  5LGU A;  4DR1 B;  3DC5 A;  1N36 O;  1MG1 A;  3F5W C;  3ICX A;  2R72 A;  2L35 A;  2YEV A;  4I55 A;  1KQS U;  3IFX A;  3FAV A;  4DR4 B;  1IXB A;  1S72 V;  1QQC A;  2UU9 O;  1MZE A;  5JH7 B;  3DSQ A;  4FIP C;  5IJ9 B;  1X4T A;  3MAQ A;  1YIJ V;  3T1C A;  2E3C A;  5JJN B;  2YXL A;  1Q6U A;  1OCO C;  1XDC A;  1SQB H;  3OD4 A;  4O2B A;  5B1A C;  4WFE A;  2IU0 A;  2ZM6 O;  2WLM A;  3CCU V;  3K03 A;  1L1F A;  2Y4U A;  2UXD O;  2VRZ A;  2VWJ A;  1VQ5 V;  5KAF Z;  2AW9 A;  3CRA A;  4DR7 B;  2RQ6 A;  4UCS A;  2ZXW B;  2L6L A;  4LFB O;  1Y76 A;  4PA6 A;  1D2D A;  5EBL C;  2QWQ B;  3SYQ A;  3H9V A;  3JAW A;  4LCU C;  1RP3 B;  2NR5 A;  5LMU B;  4L8J A;  2DYR B;  2UUA B;  2Q69 A;  3ABM C;  1F23 A;  4ZBM A;  3QO8 A;  4DR5 O;  2OTL V;  4IGG A;  1W0J G;  5LP6 B;  3RVY A;  4DV2 B;  5EC2 C;  1GK9 A;  1Y6X A;  2EIK B;  4FFB B;  5KHK A;  1M56 C;  4X1K B;  5KMG A;  3K5L A;  3N27 A;  5EBM C;  3OEH G;  3BPZ A;  3M7M X;  2OIG A;  4X9Q A;  1KBH A;  3RN4 A;  4DV2 O;  1SES A;  4J7K A;  2DYR C;  4KXR A;  3ZBH A;  4O2B B;  1HDJ A;  3VQV A;  1JJO A;  3EXA A;  4HAM A;  3RYC B;  3ZRV A;  2X6B A;  1VAR A;  5C93 A;  2PI5 A;  1V54 B;  1H2G A;  1XI1 A;  1RM1 C;  1R6T A;  4PDM A;  3ZHQ A;  3ZHS A;  4NVP A;  1M56 B;  2JEU A;  3O65 A;  4A5U B;  4JI2 B;  4DV6 B;  4B3M B;  4FM0 A;  3BEH A;  4YIO A;  3HKB B;  2HEP A;  4EFB A;  3K08 A;  5EYP B;  2JGD A;  2DN9 A;  3LNN A;  2QKS A;  4DR1 O;  4D7T A;  1AI6 A;  2A0L A;  3FB8 C;  3OGI B;  2JGU A;  4LNU B;  3T1H B;  4UV8 A;  3B09 A;  3AK1 A;  5LP6 A;  4B3S O;  4E4E A;  2UXB O;  2CGN A;  4MVO A;  5GTI Z;  4JZ2 A;  1R3L C;  3ETD A;  1AR1 B;  2WLL B;  3W7S A;  3HKC B;  1H2K A;  2OWO A;  2FKX A;  4WFA V;  4PI0 A;  3ZRW B;  5JH7 A;  5TIS Z;  2EIJ B;  4H0L B;  2A3Q A;  1OJH A;  4FM2 A;  4CS4 A;  3JAM N;  4JI4 B;  4XDK A;  1XUQ A;  1YI2 V;  2AXT Z;  1J95 A;  1QU7 A;  3WG7 B;  5JCO C;  5EYP A;  1BHB A;  4H44 B;  3FFQ A;  5LMN B;  2Q6A A;  5GTH Z;  1RSO B;  2IW5 A;  1N4C A;  2P6J A;  4MTF A;  3KZI Z;  4DR3 O;  3GB7 C;  4LF7 O;  3ZHU A;  1W2B U;  2JS3 A;  3CCE V;  1U97 A;  1YZB A;  1OV9 A;  2AZ0 A;  4GX0 A;  3SPI A;  3FB7 C;  1G8M A;  1SQV H;  1TVK A;  1OZ0 A;  2ZIO A;  4QJF B;  3AEI A;  1ZAU A;  1I94 B;  1DK1 A;  4X1K A;  1F7Y A;  3GWO A;  2ARH A;  1LUW A;  1AI4 A;  1BZK A;  2QM8 A;  4GT1 A;  2WA4 A;  3G4S V;  5GON B;  4TV9 B;  4DXW A;  1YJN V;  4DK1 A;  3SPH A;  3AG4 C;  1XMO O;  3BHP A;  4WBN A;  4J7J A;  4LF6 O;  1GH6 A;  1PL4 A;  3JD0 A;  4H13 B;  5LHI A;  4ZOL A;  4DV5 B;  3AG1 C;  3K59 A;  4F6E A;  2RMK B;  5EBW C;  1AB3 A;  2QTS A;  3E83 A;  1AR4 A;  3HB3 B;  5B3S C;  3OUS A;  3TJT A;  4X65 O;  2YXH A;  1NTZ H;  4IIJ B;  2IJK A;  3AK3 A;  1XOU A;  2JVD A;  3K04 A;  3CJH A;  4JI6 O;  4PEL A;  5J2U B;  3AG3 B;  5IYB O;  5B1A B;  2CH7 A;  1TVK B;  5IJ0 A;  3Q4H B;  5IDJ A;  3QG5 A;  4OXS A;  3ABK C;  2YIB D;  1P84 F;  1QHT A;  3B2E E;  4JI5 B;  1FAF A;  3HKC A;  5CB4 A;  2P06 A;  1YTF B;  3CHX A;  4TUY B;  4U3F H;  4LR3 A;  3RVZ A;  2DYS C;  2XOK G;  3A0H Z;  5JWP A;  2BSK B;  3SYA A;  4JI8 O;  2K9P A;  2NLJ C;  3SPG A;  5KHJ A;  5EIB C;  3B8N A;  3CE2 A;  4EEQ A;  4IHJ A;  3U0Z A;  1SZT A;  1N34 B;  3C3S A;  4LF9 B;  5CA1 B;  4AI8 A;  3WFV A;  3SJC C;  2EJ7 A;  2QKC A;  4DR2 B;  1WP7 A;  2YXY A;  2LQT A;  4ZIB A;  1Z5V A;  1I08 A;  1WPB A;  3H1H H;  4GZR B;  1OCR C;  1V54 C;  1ZLZ A;  4JI3 B;  1S3J A;  1RFY A;  5CN0 A;  1KP3 A;  5LXT B;  1L8D A;  3TXQ A;  4H33 A;  3DGE A;  4AQY O;  1Q7Y W;  2ZDI A;  3MD0 A;  1Q8I A;  1DGS A;  2QM4 A;  1JJ2 U;  2DW4 A;  3J80 N;  1ARO P;  1TA8 A;  4JTD B;  5BZB A;  1GMG A;  4ZI7 B;  3KCX A;  2R9I A;  3FB6 C;  2LJ2 A;  4B3R O;  2QJ1 A;  1GRJ A;  2CAZ C;  3RYI A;  3BVO A;  1AIL A;  2MW2 B;  4JI6 B;  4TV9 A;  2WWW A;  1S0V A;  3HKE A;  4WBN B;  3THO A;  3AG2 C;  1K5S A;  2OTJ V;  2B9Z A;  1NR7 A;  4I55 B;  4O4J A;  1JX9 A;  1D5A A;  4O4I B;  1PP9 H;  2GV9 A;  2Z5U A;  1YEW A;  2BOB C;  1IBL O;  1EN6 A;  2X7R B;  2GHY A;  2FB5 A;  4X20 B;  3K79 A;  2F4V O;  1AP5 A;  3H1K H;  4JYA B;  1PNL A;  4MT8 A;  5IJ0 B;  3OR7 C;  3IAY A;  3K3W A;  2OYQ A;  1U96 A;  2F1M A;  4JF3 A;  1BQZ A;  4IT5 A;  1HW7 A;  4CC5 A;  1BS3 A;  2PF4 E;  4DRX B;  4ZHQ B;  1I94 O;  5CBG A;  2QGN A;  5DN6 G;  2PI4 A;  5IYZ A;  3UQ8 A;  4P30 A;  3GVM A;  3RBZ A;  1ZL8 A;  1Q90 D;  1SZX A;  3VQY A;  3ZHT A;  3RFR A;  4AIL C;  1HNZ B;  2DWE C;  2EIN C;  5GW7 A;  4FFB A;  3OE7 G;  3CPW U;  3STZ C;  1M90 W;  1R73 A;  5C8Y B;  3TGU H;  4HYO A;  1R6K A;  1JVM A;  1YF2 A;  4PHZ A;  4I5S A;  4TQF A;  2YUA A;  2KG7 B;  3UT5 A;  4X8A A;  3K9S A;  3B4S A;  1KUQ A;  2F95 B;  1SKV A;  5LYJ B;  1AP6 A;  2JIZ G;  3LSU A;  3LDD A;  3S3X A;  4LF4 B;  4DRX A;  5JJJ B;  1RPR A;  2RNB A;  2CTP A;  2FL4 A;  1NTM H;  5KX5 B;  1QBZ A;  5JCO A;  4U3J A;  2ZQM A;  3NR7 A;  4LFA B;  1Q6H A;  5J9P C;  3CX5 F;  3ZHR A;  1XNQ O;  1H8H G;  1PM9 A;  1M93 A;  1AR5 A;  1BGY H;  3CME V;  4LF5 B;  2EIL C;  2JGD B;  1KC8 W;  3DXR B;  2AHZ A;  4JI4 O;  1Y74 A;  1K92 A;  1H2M A;  3GWK C;  5C8Y A;  1HNX B;  1SQQ H;  4X66 B;  5LGN A;  3K5M A;  3E89 A;  2PZS A;  3KCY A;  2PYL A;  2EZO A;  3D3I A;  2N74 A;  1Z5W A;  1Q5O A;  3ZRX A;  3ZCC A;  3OMI B;  4O4I A;  1PNM A;  1THZ A;  2QWP B;  4X88 A;  2Q9L A;  1AJN A;  1DF5 A;  1VEW A;  3JD1 A;  4KFM A;  4DV7 B;  4I4T A;  3NXS A;  3CCV V;  2CGO A;  3JSN A;  1ENV A;  1YXB A;  2GUZ B;  1ZWI C;  4CH4 A;  2GTS A;  2N04 A;  2CTR A;  1NS1 A;  3S3W A;  2N05 A;  2F4V B;  1VQ7 V;  4OGQ B;  3F5T A;  4Z1M G;  4G27 B;  1IBL B;  4PI2 A;  3EHB B;  1WB7 A;  3E35 A;  4D7S A;  1XNR O;  1KP2 A;  2DQ3 A;  4PJ0 Z;  4F6R B;  1ZL8 B;  5AG2 A;  4K0K B;  3JD2 A;  1OCC B;  4UB8 Z;  3H1J H;  5JVD B;  3SJA C;  5LMU O;  4W4K A;  1KYO F;  2OCC B;  4RUE A;  4K3A A;  1QLN A;  3ASN B;  4X64 B;  1DF4 A;  1R6N A;  2V7Q G;  1V55 B;  1XMQ O;  4YY3 B;  1R1B A;  5L3D A;  2F93 B;  3CP1 A;  3ZMZ A;  2KG7 A;  5L3E A;  2ADQ B;  5A9G A;  5BXZ A;  1H2N A;  4J10 A;  1N32 B;  4FLY A;  2ADP A;  1SRY A;  3A0R A;  5GON A;  2JRI A;  4OX9 O;  1PKX A;  2DYS B;  5JQG A;  4PDV A;  1L0L H;  5D5P A;  1BCC H;  5KX5 A;  4BR6 A;  1X59 A;  4J11 A;  4YJ2 A;  1IVS A;  4NXN O;  1OCC C;  2OT5 A;  4O2A B;  1S5J A;  4LWS A;  1VMG A;  1CPY A;  3MDS A;  4KP4 A;  4B3R B;  1VQM V;  1FJG B;  4F6R A;  1J5E O;  4H37 A;  1Y67 A;  5ITZ B;  2BCC H;  4RWU A;  4I50 A;  1RSO A;  4FLW A;  2OCC C;  1EZV H;  3Q4H A;  5LMN O;  2WLH A;  1MMM A;  1M57 C;  1YSC A;  3E22 B;  3ABL C;  4R8C A;  4QPJ A;  2AHY A;  2YIB A;  3DC6 A;  3UO3 A;  2VQE B;  1XL6 A;  1VQ8 V;  5KUM A;  2P22 C;  2CK3 G;  1ZTE A;  1K5Q A;  3OAA G;  1H8E G;  1WP8 A;  4LH7 A;  3FX7 A;  4CC6 A;  4TUY A;  5H9C A;  2E75 B;  3T4Z A;  3CRR A;  2ZKO A;  1S77 D;  5CB4 B;  2P90 A;  3CC2 V;  2OCH A;  3ZX6 A;  2EX3 A;  5BMV A;  4D6T H;  1F4M A;  3WB2 A;  1FJG O;  5HFL A;  2RCV A;  1KU9 A;  2XND G;  4DO2 A;  4QE7 A;  3SYO A;  4QIW F;  3OMN B;  5CA1 A;  4B3T O;  3X2Q C;  3F7V C;  4FVM A;  3AG7 A;  4PA9 A;  4JI8 B;  2LW1 A;  3JAK B;  4PA7 A;  3JCU Z;  5IY5 B;  4OX9 B;  4HNA B;  1K4D C;  4J9Y B;  3L74 H;  4R50 A;  1VQP V;  4PV1 B;  4OPA A;  4FJC C;  2B1G A;  3N2G B;  1FFT B;  5LL6 Y;  5IJ9 A;  4LF6 B;  1F4N A;  4IIJ A;  4KL1 A;  2HLD G;  2ITC C;  4Q20 A;  4QE9 A;  4YHH O;  2RJZ A;  2CH7 B;  4HZ3 A;  4KHP O;  1Z2G A;  2YS8 A;  4AHC A;  1N33 O;  3SR2 C;  5KUK A;  3OT7 A;  3ETG A;  1FD9 A;  4I0X B;  2IH3 C;  1HNZ O;  4GLX A;  4O4L B;  1SQP H;  2ZT9 B;  3UCS C;  2HHH B;  4YJ3 A;  4BWA A;  3IC7 A;  3CCJ V;  1UFI A;  4GKJ B;  3W7U A;  2BSK A;  3VQW A;  4RAI A;  4DV6 O;  4JI2 O;  4G28 B;  5B1O A;  3UO2 A;  2DOS A;  3CSX A;  1I7F A;  1G6U A;  4NXM B;  1QR8 A;  3APQ A;  4X89 A;  3I5D A;  2RN9 A;  3QF7 A;  1WJZ A;  5B1B C;  1XBL A;  3CXC U;  4JTC B;  5D5Q A;  5L3B A;  1P7G A;  2LP7 A;  1F51 A;  2Y0I A;  5L3G A;  2YDE A;  4DV0 O;  4TT3 G;  3E8G A;  3RYF B;  1MNG A;  4FK5 C;  1AJQ A;  2CTW A;  4NTX A;  3DTU B;  4WFB V;  3BAA A;  3X2Q B;  3T1Y B;  2HJD A;  2EUL A;  3WU2 Z;  3K58 A;  1WPX A;  2FYU H;  2JK5 C;  5H6Q A;  4X66 O;  3CCL V;  2VWK A;  4B7K A;  4ZHQ A;  2JS5 A;  4FPP A;  3CD6 V;  1FPO A;  4LF9 O;  2VQE O;  1SET A;  2IJH A;  5LGT A;  2HVK C;  5B1B B;  1WA8 A;  1FS0 G;  1KKD A;  4UVC A;  3D3Q A;  1FXK C;  2H94 A;  2ZE8 A;  2UXC O;  1NVP B;  2PY5 A;  4UXN A;  3UM7 A;  2OIE A;  1N34 O;  3E8B A;  1VF7 A;  3JAL A;  1COW G;  1OCR B;  2YI8 A;  2CUG A;  1VQ4 V;  3MHH C;  4CH3 A;  4KUM A;  3W7T A;  1NI8 A;  4DV4 O;  1LR1 A;  3RGB A;  2QWO B;  2EIK C;  2ATK C;  2UUC O;  3I56 V;  3E8H A;  2X6A A;  5EK0 A;  2G38 A;  3RYF A;  4DR4 O;  4ZKI A;  1ROP A;  1O9H A;  5LBQ A;  5KMG B;  1QNM A;  2YIC A;  2E5L B;  1M5I A;  1FXK B;  1SS3 A;  2CTQ A;  1E1Q G;  3SGI A;  5FPO A;  3SPC A;  4J41 A;  3FKS G;  4PA3 A;  3PJS K;  1HWY A;  2WLN A;  2HJF C;  3M99 B;  3T1H O;  1JCH A;  1V9P A;  1H2L A;  2WLK A;  3SYC A;  3D36 C;  2B1I A;  1PV0 A;  2Y0P A;  5IYZ B;  4I0X A;  3B8M A;  1SC5 B;  1SER A;  1K8A W;  4WFH A;  4YJ3 B;  1LNQ A;  5LOV B;  2HHH O;  3TK1 A;  1Q6I A;  2ZD9 A;  1DLB A;  1MSD A;  2UUA O;  5CA0 B;  4MW8 A;  4RUF A;  4JI0 B;  4DR6 O;  4PA4 A;  1S76 D;  3JD4 A;  4QNH B;  4NR1 A;  3IJ4 A;  4CZZ A;  4DW1 A;  2UUB O;  4JI7 O;  2Y69 C;  4JI1 B;  2VQF O;  5E1A C;  1HNW O;  4GUN A;  3ZMU A;  4RQE A;  2XHB A;  2UXD B;  2WLJ A;  2QDO A;  5IY5 C;  4DR6 B;  4JI0 O;  4TOI A;  1NH2 D;  2LGW A;  2BOC C;  4DV3 B;  2DE0 X;  2A9H A;  2XTA A;  5LYJ A;  1SQG A;  3ASO B;  2ETN A;  4K0K O;  3TXS A;  1QVF U;  3HKD B;  1JOY A;  2LW7 A;  2Q68 A;  4YHH B;  3L75 H;  5IT9 N;  2UXN A;  1TUE B;  2E5L O;  2B5U A;  4UV9 A;  1EN4 A;  1WLE A;  2HP8 A;  2GTA A;  5EZY B;  4DV4 B;  2EIN B;  1BMF G;  3P3N A;  5KHI A;  3CCR V;  1Y74 B;  2FML A;  5CA0 A;  3QTC A;  3IGA C;  4GX5 A;  4DR3 B;  4I9W A;  3LDC A;  3CJH B;  1MOF A;  4DR2 O;  1K7D A;  5JVD A;  3BAB A;  4LF7 B;  2IBZ H;  4BAY A;  4DYL A;  2ZCE A;  5KHH A;  2F66 C;  3BA8 A;  2QM7 A;  2ZE5 A;  2ITD C;  4JGS A;  2BTQ A;  1E1R G;  1KMI Z;  1K9M W;  1K3E A;  4K8X A;  2Q4P A;  5B3S B;  2R9R B;  4UCU A;  1IBK B;  1NH2 B;  1VQN V;  1Q43 A;  1QR9 A;  1Y4M A;  2R9A A;  1KB9 F;  2MK3 A;  3FAV B;  5CMU A;  3JCZ A;  4C7U A;  2LFS A;  1AI5 A;  3ZS8 C;  4LBE C;  3HKD A;  3ETQ A;  3OTO O;  4JI5 O;  1CEZ A;  5JQG B;  4X1I B;  1KKC A;  4O2A A;  3M8A A;  4WF9 V;  4JYC A;  1NZ6 A;  4TSF G;  1FXH A;  4MVQ A;  1P7B A;  4CS3 A;  4MS2 A;  1XHX A;  2IJI A;  2O57 A;  3HKB A;  1I5Y A;  2GUZ A;  3CXH F;  1BQ0 A;  3QVN A;  3CRQ A;  3E8F A;  5B5E Z;  3RW0 A;  1H2S B;  2IH1 C;  3JD3 A;  4UVA A;  5F2V O;  2GBO A;  3E86 A;  3G80 A;  4P9O A;  3K5O A;  2K1E A;  3E2E A;  5J2U A;  1BT8 A;  1NJI W;  1SA0 B;  1VQO V;  4JYB A;  3B77 A;  1N0N A;  1XMO B;  4X64 O;  2GSM B;  3ZHV A;  3LSQ A;  5DED A;  4UCO A;  5JJE B;  3HR0 A;  3BA9 A;  1PNK A;  3JAS A;  1G1X B;  3FYI B;  3BRC A;  3TET A;  2YC0 A;  1M57 B;  4JV5 B;  1DTO A;  3RT3 C;  2W0X A;  4DK0 A;  4FMT A;  1JFF A;  1MAB G;  4BW9 A;  3MHS C;  1TUB A;  4N23 A;  4FLV A;  2VQF B;  4HNA A;  3APO A;  1NVP D;  2X6C A;  2Q73 A;  2H3O A;  5FNV A;  2A79 B;  1B6Q A;  4MTO A;  2HKO A;  4O4J B;  3OMA B;  2V1D A;  3ABK B;  1Q86 W;  5EZY A;  5KLV H;  1O9G A;  1GN4 A;  1T5E A;  1N33 B;  3ABT A;  5LA6 A;  3SDL A;  3ZMS A;  2ZNJ A;  4DV3 O;  3CC4 V;  3CWB H;  2KQX A;  3G6E V;  1SQF A;  4N21 A;  1VQL V;  4I50 B;  4TWK A;  2Q7G A;  2UU9 B;  4DR7 O;  3AG2 B;  3B40 A;  5L3C A;  3I55 V;  2QEX V;  1FFX A;  2P7T C;  3BFR A;  5E79 Z;  2ZE7 A;  1XRE A;  2BE3 A;  4UCR A;  4IYH A;  3CMA V;  3L72 H;  1K4C C;  1IXM A;  3AK2 A;  4MW3 A;  4MVS A;  2DJV A;  3K57 A;  4AQY B;  3P30 A;  1GTO A;  4KHP B;  1WN7 A;  4QPK A;  5FPR A;  4O4L A;  2A7W A;  5BMV B;  5A2Q N;  1VQ6 V;  3U10 A;  2LGQ A;  1M1K W;  4LFB B;  5IYD O;  1XNQ B;  2XT9 A;  4LFA O;  3J81 N;  1E79 G;  1URF A;  1UJW B;  3LUT B;  4RO2 A;  3J7A U;  3HKE B;  3JAK A;  4G2K A;  4B3S B;  1B3Q A;  4YIP A;  1AI7 A;  1B04 A;  1VQ9 V;  5LA6 B;  4MVU A;  2QR4 A;  2LO1 A;  1N8R W;  3JAR A;  2RDC A;  5J2T A;  2P67 A;  2UXC B;  2HVJ C;  2W6J G;  4UUJ C;  1LUV A;  2HFE C;  3IC9 A;  2JJ1 G;  1PL0 A;  2QSA A;  1KEC A;  3K5N A;  4GX2 A;  5H5N A;  4E2L A;  2IU3 A;  5DM6 V;  4O4H B;  4B3M O;  3H01 A;  2W0F C;  4GYC B;  1EBO A;  4F4L A;  4PDL A;  3OFN G;  3WB1 A;  1BE3 H;  2C2A A;  2AGA A;  4JPR A;  3JAT A;  3T1Y O;  2IM9 A;  4DW0 A;  1YJW V;  2JDI G;  5IWA O;  2QWR B;  2V4D A;  1N0J A;  2NNU A;  2ZDI C;  4LF8 O;  2DMX A;  1YCI A;  1TGO A;  2YI9 A;  2Q7H A;  1L0N H;  2E76 B;  2XAJ A;  1NT2 B;  1WA8 B;  3ZN0 A;  3FD9 A;  2YIA A;  4CS2 A;  2EIL B;  2KKW A;  1EM1 A;  2UXX A;  1VF6 A;  4X65 B;  3O9O A;  4JTA B;  1WNS A;  2DWD C;  3ETE A;  1N32 O;  2Y4T A;  1ORQ C;  1YVW A;  3G67 A;  3VOU A;  4DUZ O;  3RWR D;  2ODM A;  3ABM B;  2PGG A;  4FLX A;  3BCC H;  1JMK C;  4MTG A;  2EZP A;  4J42 A; 
#chains in the Genus database with same CATH homology
 3H1J H;  3TGU H;  4U3F H;  4PD4 F;  1KYO F;  2BCC H;  1NTM H;  3L71 H;  3L70 H;  1PPJ H;  3H1K H;  1SQX H;  1BE3 H;  1SQP H;  1SQQ H;  2FYU H;  1NTK H;  1L0L H;  3H1H H;  1EZV H;  5KLV H;  1BCC H;  1P84 F;  3CXH F;  1KB9 F;  3L72 H;  1NTZ H;  2A06 H;  2IBZ H;  3L75 H;  1PP9 H;  3H1I H;  3H1L H;  3CWB H;  3L73 H;  3CX5 F;  1SQV H;  4D6T H;  3L74 H;  3BCC H;  1SQB H;  1L0N H;  1BGY H;  1NU1 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...