1SQVH

Crystal structure analysis of bovine bc1 with uhdbt
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
67
structure length
67
Chain Sequence
b'ELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome c reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 16
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1sqvH00
1EZVH 3TGUH 1NTKH 3H1HH 4D6TH 1PPJH 1NTZH 3CXHF 3L71H 1L0LH 2FYUH 1KYOF 1NTMH 1KB9F 2IBZH 3L74H 5KLVH 1BE3H 3L75H 3BCCH 1NU1H 3H1IH 4U3FH 1SQPH 1BGYH 1SQVH 3CWBH 1SQQH 1SQXH 2A06H 3H1JH 3H1LH 1P84F 3L72H 1BCCH 3L70H 3L73H 1L0NH 3CX5F 1PP9H 3H1KH 1SQBH 2BCCH 4PD4F
chains in the Genus database with same CATH superfamily
1Y74B 5LMUO 3K58A 1WA8A 4GX5A 3R66A 5KAFZ 4WFFA 5EYPB 1WB8A 1YCIA 1PL4A 5KMGA 5JWPA 1XI1A 1Q6HA 2BSKB 4JI5O 4LF7O 1SS3A 5J2UA 4JGSA 4KP4A 3ML0A 2YIBA 1Q6UA 1RPOA 1CP9A 4W4KA 2Q6AA 2OIEA 3CCJV 4X88A 3LUTB 1NU1H 2ZINA 1JCHA 4L87A 4X62O 2XUMA 1Q6IA 2IJKA 1HNZO 1BCCH 4LR3A 1NJIW 1R3JC 1KU9A 4N23A 5JJNB 3D3QA 5CA1A 5C93A 4NYKA 2PTMA 3QG5A 4JI7B 1VARA 4NTWA 3RBZA 3LNMB 2FMLA 1XMOO 4DV7B 3PN1A 3W7WA 3L72H 4PI0A 2PI5A 2FL4A 1SQGA 4DV1O 4MVZA 5L3EA 3QO5A 5H9CA 1IDSA 4K8XA 1JJOA 4MTFA 1LUVA 2DWEC 2H8PC 1KB9F 3OMAB 4LF5B 2Q0AA 3E2EA 4MVOA 4KHPO 4CH4A 5LBQA 4DR7B 2BOCC 1X59A 5EZYA 3ABLB 1YHQV 4LFCO 3IC9A 1OCRC 3SPCA 2K9PA 5IYZA 1SA0A 1N33O 4CS3A 2IH1C 2UUAO 1OCZC 1HWYA 1Y74A 4HNAB 4I7ZB 2F95B 3DC5A 2Y4UA 2GUZB 2IW5A 5EYPA 3CB2A 1N32B 3QTCA 3EVKA 2BSKA 5JH7B 5LYJB 1ZLZA 3TXQA 2ZE5A 3DTUB 3OEEG 1FFXB 3SJAC 4UCVA 4X66O 1OJHA 2QWRB 1GMGA 4IIJB 4I5SA 4X1KB 3UT5B 2UXCO 1NR7A 5LMNB 3PJSK 3BRCA 3N2GB 2UU9B 4UVBA 4ASUG 1K7DA 2QM4A 3QVNA 1QHTA 2ARHA 5H2FZ 1W2BU 1AI6A 4GX1A 1H2SB 3H01A 1GN6A 3H1KH 4LH6A 2ADPA 1AP5A 3VQYA 4DV0B 4LFAO 1KYOF 3ZHSA 1QQCA 2WLNA 2ZXWC 1DLBA 1N4CA 1OCOB 1SQVH 3CHXA 4FVMA 3RYHB 3IC7A 1B3QA 2HG5C 3IJ4A 3BVOA 1S5JA 2HKOA 1R6KA 4J9YB 1I0HA 3CCQV 1Q90D 1AJQA 1TVKB 1TUEB 2CH7A 2Q7HA 2YI8A 4X64O 3KCYA 5FL7G 1MSDA 3ZMSA 3ZS8C 1F4MA 4ZI7A 1VF5B 3LSSA 2Y69B 3IAYA 5FPRA 4JI1B 1BSMA 2ILMA 2ZNIA 1K34A 1R73A 4JI0O 1AJNA 2K1EA 2GUZA 4J80A 1NTMH 2IBZH 3ABLC 2N74A 1UJWB 3G67A 2VWJA 4OX9O 1IXBA 3RGBA 1PL0A 1KBHA 3CWBH 4X65O 4O4HA 1V9PA 4FFBB 5JH7A 2P7TC 5LYJA 5B1NA 3UCSC 3U11A 4CH3A 2VQEO 1G6UA 3B77A 4TOIA 2PUSA 3G80A 4IIJA 1HNWB 1YTFB 4X1KA 4CC6A 1YTFD 4MT8A 3UT5A 3N2GA 1XMQB 4AHCA 1I94B 3WG7B 3SPJA 2YICA 4CC5A 5B66Z 4FM2A 2YS8A 2YIDA 3ABKB 3BY6A 2UXNA 3K0DA 4LCUC 4I9WA 1NS1A 1JA8A 2LJ2A 1NTZH 2Q8VA 3WU2Z 2E76B 4RUFA 3ZMTA 3JD3A 3STZC 2H3OA 4CZZA 3RYHA 3ABMB 4UCSA 4UB8Z 1RFYA 2GSMB 2G38A 1RSOA 4MVMA 2X7RB 4I50A 1Y6XA 1VQPV 2QEXV 1TVKA 2YDEA 4TUYB 3ZN1A 4GKJO 4WFBV 2UUCO 1M1KW 2WAMA 5CA3A 1AB3A 4BIOA 4MTXA 4DR1B 3HKBB 4YHHB 2A06H 4DUZB 1BMFG 1E1QG 4DR3B 4EFEA 1GAXA 2ZNJA 5J9PC 2WLMA 2CDYA 2F43G 4TSFG 4B3MB 3CCLV 3BAAA 2WLLB 2DYSB 1G1XB 1XHZA 3FB6C 1MZFA 3K06A 2Y69C 3OMNB 4AQYO 2E74B 3E89A 4GZRB 4FFBA 2Q7GA 4C7UA 5FPOA 3KZIZ 4X20B 5H6QA 1AR5A 2P90A 5GONA 5JCOA 4OXSA 5B3SC 4F6EA 2R9IA 3S3XA 3OEHG 1JPXA 3JATB 4B08A 1J5EB 1XEQA 1OHHG 4JI4B 4ABMA 2M6YA 1XBLA 1NVPB 4U7OA 3C90A 4JZGA 1Q81W 1I5XA 2M7WA 2DQ0A 4UV9A 5JJJB 2AGAA 1X4TA 5LXTB 1NH2B 4IT5A 2HP8A 2ZT9B 1FJGB 1KP2A 4MTGA 3WG7C 4X89A 1SZXA 3K03A 4XDKA 4B3TO 1ROPA 4FLWA 3T4ZA 1KKCA 5BY1A 4MVRA 4G28B 1HR0B 3EFFK 1Y4MA 1QLNA 4O4JB 1B06A 2ZIMA 1VQMV 4TUYA 3BFRA 3GB7C 2JK5C 1YJ9V 1HNXO 2EULA 2RDCA 3HKBA 3SPIA 2EBOA 3UQ8A 3E8BA 3JAWA 3UM7A 5IY5B 4P2ZA 3B2EE 1NZ6A 3APQA 4I9QA 3W7UA 4DV5B 4JYBA 4LWSB 1TAEA 1ZAUA 1XNRO 1R6TA 3ZHUA 4J7ZA 3QF7A 4DV4B 3AG3C 5CMUA 2HVJC 2ITCC 3CC7V 4RQFA 3SYQA 4JTCB 2OCCB 1KKDA 4H33A 1MABG 4Q20A 4TQDA 4X20A 5D5QA 1IBLO 1OCCB 2D3OW 3SYPA 2WLHA 4LF8B 1OZ0A 1DF5A 3CRMA 3RN4A 3JATA 2FTKA 2W0XA 3DXRA 2QWPB 4QJFB 4FIPC 4FLXA 1QBZA 3T1YB 2AW9A 1YZBA 1MMMA 1VQ5V 1VQ7V 1FXHA 3ZEDA 4LC1A 1H8EG 4R50A 5TISZ 2ADQB 4GKKB 5BR8O 2PI4A 1AROP 1M56C 2ZQMA 4O4IB 4JTAB 2F23A 5LP6B 5GTHZ 1FPOA 1M4UA 4IYHA 2NN4A 3OAAG 4UFZA 4LF4O 5KAIZ 2YSUB 2YIAA 3ZRVA 4ZKIA 4DV6O 4DK1A 4NR1A 1K92A 3AG2C 2V7QG 2NNUA 4O4JA 5C8YB 1R1BA 5KHKA 3OR6C 2E5LO 2JS3A 2IH3C 5KHGA 3R65A 4P9OA 3KKYA 3N27A 3BA9A 1S76D 3K79A 1PKXA 2OT5A 3I5DA 2JRIA 1KP3A 4JI8B 2QA4V 3FB5C 2E3CA 4PJ0Z 2A0LA 1V54B 4LWSA 4HBNA 4MVQA 4QGPA 3A0RA 4EKWA 4TWKA 3CEIA 1GK9A 4N21A 1K4DC 4O4LB 3AK2A 5LA6A 5IY5C 1GM7A 2L6LA 1YITV 5JQGB 2IU3A 1CPYA 3G6BA 3HKDB 5LHIA 4I0XB 4LFBO 4LP8A 2EIKC 2Z3YA 1SETA 1AILA 3CD6V 1AP6A 2WSSG 5LGTA 1VQLV 5L3CA 2EIMB 3HKEB 4IL6Z 1VF7A 4YY3B 5E1AC 1Q82W 2N04A 2KSDA 2WPDG 3LSUA 4BWAA 4LF6B 1OCCC 2F66C 2BE3A 4JASA 1ZTEA 2ETNA 1SQPH 3D36A 1BQZA 4KUMA 3JCUZ 2X6AA 4W4LA 2PYJA 4J7JA 1I94O 4E4EA 5H5NA 3CJHB 4O4IA 5LP6A 4ZOLB 5LOVB 2OIGA 3ZHQA 3E86A 3CSXA 2QM7A 4FM1A 2Z0AA 4MVUA 3D36C 1H38A 2UXXA 1HP8A 3VBBA 4B7KA 1UFIA 3CRRA 3JYCA 5C8YA 3OTOB 4D7TA 3SPGA 1NQTA 1EN6A 3GWOA 3K9AA 1AI5A 4MS2A 1AR1B 1U97A 2YEVB 4JI6O 2C2AA 2VQFB 4NTYA 1MOFA 4NXMB 3OFNG 2HR3A 4EB6B 1ZWIC 5F2VO 5KHHA 4FLUA 2JGDA 3HB3B 1NI8A 4K0KB 4WCEV 3I55V 3P3PA 2QM8A 2DE0X 3A0HZ 3AG1B 2HHHO 1R6NA 4RAIA 2CGNA 4O4LA 3JCZA 3OGIB 2Q68A 5IWAB 4K8ZA 1XHXA 3HKDA 1BL8A 3JSLA 4I0XA 3CCUV 4IGGA 4DV3O 4X1YB 2GV9A 3KCXA 4CH5A 3K5LA 2CK3G 2JVDA 1N36B 2DMXA 2AZ2A 4DV2B 4YJ3B 4JI2B 1IBKB 1TA8A 2EINB 4LBEC 4YJ2B 3J80N 2JS5A 3S3WA 4JV5B 1P49A 4WF9V 2XAGA 4J41A 5DEDA 1PNMA 1VP7A 2BOBC 3ZHVA 5KA5A 3ZMZA 4CS2A 4E2LA 3ZX6A 4MW3A 2Q9LA 4KFMA 1QR9A 4GX0A 3LNNA 3N2KB 4Q6GA 1L1FA 4JI3B 2RNBA 2JJ2G 3OR7C 1Q5OA 3UKMA 4GLXA 2A7WA 1M93A 2F4VB 3CJHA 1F51A 1BZKA 1VQ6V 3JD4A 1YI2V 2CGOA 3O9OA 2R70A 2P06A 4UCOA 3OMIB 1MG1A 1AVMA 1AI7A 3LDDA 2ZR3A 1N34B 1JFFB 1JVMA 1AR4A 4J42A 1JR9A 4PDMA 4J7KA 2BCCH 5BMVB 1P7GA 4LF9B 4JF3A 4PDRA 4EB6A 1VQKV 4H0LB 4B7EA 5DM6V 3C3SA 3M99B 1L8DA 4B3RB 4PV1B 3WFVA 1BS3A 2YUAA 4DR2B 5K1XA 2RMKB 3G6EV 2GHYA 3ZHRA 2NLJC 2ZM6O 2MK3A 3BPZA 2CAZC 2UUBO 1ORQC 3ASOB 4FJCC 3F5TA 3SYAA 4X1YA 4NXNB 4U3JB 1QU7A 1EM1A 2O57A 4P30A 1NR1A 2A3QA 5A2QN 3RFRA 3CP1A 4YJ3A 3OT7A 4XDJA 1D5AA 4MVSA 2DJVA 1GH6A 4YJ2A 4ICGA 4DXWA 3K5MA 3RYFB 1NBMG 1SF9A 2QJ1A 4B3SB 2P22C 4HNAA 1JOYA 3OGCC 2AXTZ 2LW7A 1SQFA 1QVGU 5GW7A 1IXMA 1LNQA 3N2KA 2EINC 2BTQB 5EC2C 1KMIZ 3A2FA 1XNQO 4DW1A 5E79Z 3T4DA 1A32A 2P67A 4DR4O 2DWDC 3E22B 1FFXA 3J81N 5LGUA 4JYAO 5EBLC 1AI4A 4J10A 3K04A 2VS0A 4Z2WA 2R9AA 2UXBO 3E83A 2EILB 1S5HC 1M9NA 4DR5B 1SC5B 1FFTB 4DUYB 2D2CB 3F5WC 5H6RA 3ABUA 2QSAA 5LMUB 5BMVA 1URFA 3RT3C 1ZL8B 3THOA 2CUGA 2P4KA 5IDJA 4IHJB 3NXSA 1S0VA 4WFGA 5L3DA 4JI5B 4ZIBA 4LF7B 2QTOA 2XAQA 3T1HO 3CPWU 2JEXA 1D5NA 2PF4E 3CCRV 3UO2A 2KG7B 3DGEA 3WB1A 3HR0A 4U3JA 1XILA 2WLIB 4I55B 2EIJB 1OCOC 3CCMV 4X62B 2KQXA 1HNZB 3K59A 3HPLC 2QGNA 3RYFA 3LDCA 2HJFC 3E8FA 2ZDIA 1H2GA 4BIZA 2UXDO 2P5OA 3E8HA 1XMOB 4DR6O 4K35A 1L0LH 1D2DA 4PHZA 2WLKA 2BTQA 1IBMO 4BW9A 3U0ZA 1K33A 1S77D 1BHAA 2ZDIC 1E79G 5KHIA 3E22A 3K5NA 2ZKOA 3L73H 2OYQA 3I56V 4PA4A 4FK5C 1GTOA 1RP3B 4Z1VA 2HEPA 2YXLA 4KHPB 1NTKH 4NTXA 4GUNA 4F6RB 2CTRA 5IJ9B 5LHHA 5FNVB 5AG2A 5CBGA 2FKXA 4LFCB 1NVPD 1TUBB 5JCOC 4A5UB 1N33B 2UUAB 2LP7A 2LQTA 1ZL8A 3JALB 1T5EA 1R3IC 2DYRB 4IHJA 1NH2D 4JYYA 2VQFO 3ASNB 2EILC 1G8MA 4FMTA 2MW2B 3ABKC 1Y67A 5CB4B 2ODMA 1VQNV 5IYDO 4JI7O 5ITZB 4X66B 2KKWA 4DV7O 2KG7A 3FFQA 1XL6A 1VQ4V 2Q7EA 2WLIA 4I55A 3ABMC 3K08A 2UXCB 2YC0A 4QE9A 1FAFA 1VEWA 3RYCB 3ZRWB 1SESA 4UXNA 1XDCA 1MZEA 1QCEA 4LF5O 4FLTA 3ETEA 3BA8A 3JAKB 3W7TA 1TGOA 1DK1A 4RO2A 3X2QB 1CXZB 5CN0A 4DR7O 2Q4PA 4LFAB 2AHZA 3CCVV 5EBWC 3ZBHA 1RPRA 2WLLA 2Y0PA 5GTIZ 3BABA 1I5YA 1BE3H 4YXWG 1BGYH 3CYOA 5DN6G 3K3WA 3P3NA 5A9GA 4JI3O 3APOA 5B1AB 3CMEV 1QVFU 2ZIOA 1WP7A 3OD4A 1N32O 2DYSC 4X64B 3ZIAG 3ETGA 4ZHQB 1F7YA 4F6RA 5IE9A 5IJ9A 2H94A 2R9RB 4CBCA 2AZ0A 1BQ0A 2EJRA 3O65A 1TUBA 4TT3G 3MHHC 3CS5A 2W0FC 3VQVA 2QDOA 3AG7A 5LMNO 1COWG 1JJ2U 1N34O 4QE7A 4JI0B 2UU9O 3JALA 1MSWD 5LXTA 3M8AA 1VQOV 4G2KA 1JQ0A 3BHPA 2KB1A 4OX9B 4X65B 2WWWA 5CB4A 1QLEB 1O9GA 4FZ0A 2QR4A 2VQEB 4DV0O 4UB6Z 4K3AA 4TQFA 3AEIA 1PM9A 4B3RO 5ITZA 1KD1W 1K73W 2XAFA 1YVWA 4ZBMA 2WLJA 3TJTA 3STLC 3CC2V 1I08A 3W7XA 2FYUH 3EXAA 4DRXB 3L74H 3ZRWA 4U3FH 3CCSV 3E35A 2IU0A 5CBHA 2YI9A 3JAKA 3GVMA 4NB5A 4DW0A 1HDJA 3J7AU 1K97A 3OUFA 1Z5WA 3RW0A 1XOUA 4LH7A 2W6JG 3BEHA 4QNHB 1PNKA 1VF6A 2V4DA 4CS4A 1S5LZ 2VWKA 4JI1O 2B9ZA 1M57B 4BR6A 2HFEC 3X2QC 3VQXA 5DECA 2DW4A 5HFMA 4R8CA 1VF6C 4GKJB 2UUCB 4ZHQA 4PA6A 2OCCC 2HJDA 3GWKC 4RUEA 4UUJC 3SPHA 1PD3A 2XOKG 1Y66A 3T1CA 1HNWO 3D8CA 5B1AC 1GKFA 5KHJA 1DGSA 4O2BB 4P9PA 4KL1A 1EN5A 3RVYA 1MA1A 2JGUA 1XMQO 4O2AB 4AQYB 3HKCB 2IJJA 4L8JA 3NR7A 1WPBA 2LW1A 3EHBB 4PA7A 1QR8A 2GDSA 3TK1A 5LP6C 4JYCA 1SRYA 2QWNB 3K57A 1BHBA 5KX5B 5IYBO 1QLEC 1VIBA 5B1OA 2L35A 3Q4HB 4DRXA 1Y76B 1S72V 2XASA 1H2MA 2YXYA 5EK0A 3IGAC 2CTQA 4HZ3A 4DR1O 1N8RW 2ZXWB 4YHHO 4PELA 1FXKB 1K4CC 1WLEA 2QTSA 2Q0OC 2EZPA 1SQBH 4DUZO 4DR3O 1SZTA 4B3TB 5JQGA 1V54C 4EEQA 1SKVA 4B3MO 3B09A 3JD2A 1K5SA 4OPHA 2XAJA 2ZCEA 2V1DA 3OUSA 4BAYA 2B5UA 1LUWA 3TXSA 3HKEA 1HNXB 1OV9A 1M57C 1Q8IA 2PGGA 3CMAV 1YJWV 1M5IA 1XREA 1H2NA 1XUQA 2BTOA 3MAQA 1GM8A 2CH7B 2JIZG 1LR1A 4PA9A 2AHYA 4HAMA 1E1RG 1J5EO 4J11A 1Q3EA 1ENVA 1XNRB 4JI4O 4MW8A 4O2BA 4BIUA 2EIMC 3ETDA 4ZI7B 3F7YC 3CRAA 2OTLV 4ZOLA 2NR5A 4O2AA 3ZHTA 2JEUA 5LOVA 2WA3A 1PP9H 2EX3A 1H8HG 2EZOA 3HKCA 1IBLB 4QPKA 4GX2A 3FB7C 2XNDG 4H37A 5B5EZ 1FJGO 2ATKC 2QWQB 2F1MA 1P4RA 4O4HB 3RWRD 1J95A 1KECA 4YIOA 2YEVA 3F7VC 1K3EA 1L0NH 5KX5A 5D5PA 3Q4HA 1GO3F 1HR0O 5EIBD 4H44B 1Y76A 4KXRA 3QO8A 3FB8C 3L71H 5KLVH 4LNUB 3SGIA 4G27B 3AK3A 4GYCB 1N0JA 5BR8B 5IJ0B 1FXKA 1S3JA 3CRCA 3UO3A 1V55B 3SR2C 4DV5O 3L70H 4YIPA 2Y48A 4LF4B 3KG2A 2PYLA 3AK1A 2XTAA 5K1PA 3CC4V 2CTWA 1F4NA 4D7SA 1K8AW 4DV6B 3P32A 4DV4O 3E8GA 2GBOA 1IVSA 1FXKC 3AG1C 2N05A 3ZMVA 2E5LB 1SQQH 2X6BA 3H1JH 3B4SA 1RSOB 3RYIB 3OW2U 4I50B 2PZSA 4OGQB 3ZN0A 2Q67A 4LF8O 1EZVH 2FB5A 5B1BB 4XBFA 3SYOA 4I4TB 3W7SA 3JAMN 3T1YO 1GRJA 3P30A 1GN2A 4WFAV 1SERA 1Z2GA 3ABTA 1WAZA 5B3SB 1FD9A 4JAVA 3FAVB 4GKKO 3RVZA 4LFBB 1JX9A 4UVCA 2W6IG 4QPJA 2A79B 4R6ZA 2R72A 4UCRA 5BXZA 1JFFA 2Y0IA 2CE4A 2LGWA 2ZE6A 2IJHA 4JZ2A 5GONB 1EZJA 1P7BA 4HYOA 3OE7G 2LFSA 3LSQA 3C3TA 2OCHA 2LO1A 2PY5A 2OWOA 1GN3A 4LNUA 3T2MA 3BCCH 3H1IH 2DN9A 2VRZA 5IJ0A 2E75B 5EIBC 4JI8O 1XL4A 1YEWA 2RCVA 3M7MX 2XT9A 1M90W 2Y4TA 1EBOA 2ZD9A 1H2KA 3ETQA 1THZA 3SYCA 1U96A 1H2LA 1W0JG 3IFXA 2EJ7A 3B40A 5CA0B 5J2TB 2P6JA 1WN7A 1V55C 2LFRA 5CBFA 3RYIA 4JI6B 4PDVA 4MSWC 1DF4A 3ASOC 4RQEA 4R7CA 1HW7A 1RM1B 4PI2A 3QO7A 2HLDG 4WFEA 4I4TA 4AILC 4Z1MG 1DTOA 3AG3B 1EN4A 3VQWA 2RN9A 4YY3O 2P4VA 3K9SA 3JAWB 2HHHB 1G4YB 1W59A 4DV1B 4LF6O 3H1LH 3SDLA 1IURA 2ZE8A 2OTJV 1MNGA 1EFRG 1NT2B 3JARB 4UVAA 5L3BA 5B1BC 4WBNB 5HFLA 4DV3B 3FAVA 2DQ3A 2QKSA 4EFBA 4FZ1A 1WP8A 1CEZA 1N0NA 4DK0A 1WJZA 2F93B 4J9ZB 5IT9N 4QIWF 2Z5UA 4XDLA 4GT1A 3ICXA 5FLXN 4BW5A 2WA4A 4X8AA 3ZRSA 3FX7A 1WPXA 3OTOO 1US6A 2XHBA 5KUMA 2JJ1G 2Q73A 1B6QA 1K9MW 3DXRB 3TGUH 3B8NA 1M56B 3K5OA 2QKCA 2Q69A 5EC1C 3JSNA 4NXMO 5IYCO 5JJEB 1FXVA 4K0KO 3LDEA 3CE2A 1F23A 3ZRXA 3FYEB 1YXBA 2LGQA 3AG2B 4DO2A 3U10A 1ZX3A 4JTDB 4PD4F 3AG4B 5CA0A 3JASB 5J2TA 1R3KC 4FLVA 1KC8W 5IWAO 3K0GA 1SQXH 5LHGA 1FS0G 1QNMA 1W0KG 1N36O 4DV2O 2EIJC 1FKAO 4JI2O 2ZE7A 1WB7A 1IBKO 4DYLA 3ZMUA 1PV0A 1IZ3A 3D3IA 4JV5O 2IM9A 4WFHA 3DSQA 3JD0A 4PDLA 1KUQA 1K5QA 2ZM6B 1FYJA 1JMKC 2UUBB 3CXCU 1Q43A 5JVDB 1RM1C 4X9QA 2QE7G 1Q86W 3ZCCA 3JARA 2YXHA 4WBNA 2EIKB 2F4VO 4TV9B 4UCUA 3H9VA 1VQ8V 4MTOA 2XAHA 5LA6B 4OPAA 5KUKA 4X1IB 5FNVA 2IJIA 4UCTA 3TCUA 2CTPA 4TV8B 5LGNA 3SJCC 2GTSA 2QKAA 4UV8A 4FLYA 2X6CA 3MD0A 1IX9A 4FFKA 5BZBA 3MHSC 1PNLA 3H1HH 3SJQC 1XNQB 2B1GA 1O9HA 3MDSA 4LF9O 1Q7YW 1WA8B 1NKDA 4AI8A 4U7NA 3ZJZA 4DR4B 2A9HA 4JYAB 4H13B 5KMGB 2DYRC 4DR2O 3OM3B 3CX5F 4CH6A 3G71V 1YIJV 5J2UB 3WB0A 3ASNC 4IYIA 2RQ6A 1KQSU 3JASA 2UXBB 2YIBD 1PPJH 4F4LA 2B1IA 3RYCA 2QWOB 3A8TA 3DC6A 1GN4A 3WB2A 1BT8A 4NXNO 4NKGB 4FM0A 3B8MA 1VMGA 3FD9A 5L3FA 2ZR2A 3AG4C 1AJPA 4FPPA 3QNEA 3L9DA 3FKSG 2ITDC 4D6TH 4B3SO 3FYIB 5CA1B 3T1HB 1UPGA 4GCZA 1R3LC 2JGDB 4JAAA 1ZUQA 5JVDA 5L3GA 5LL6Y 3SJBC 4JPRA 3CCEV 2HVKC 1ZSPA 1YF2A 1YDXA 1XQ8A 1GM9A 4TV9A 3A0BZ 2X0LA 2RJZA 4FLZA 3VOUA 3TETA 4X1IA 4RWUA 1OCRB 2JDIG 3CXHF 1I7FA 4NVPA 3G4SV 5EBMC 1OCZB 2GTAA 2DOSA 4TV8A 3L75H 1B04A 5KA6A 2Q5ZA 3CRQA 4PA3A 4JAUA 1YSCA 1P84F 1YJNV 1WNSA 2UXDB 5EZYB 4DR6B 4DR5O 3JD1A 1SA0B 5IYZB 4DUYO 1Z5VA 1IBMB 1VQ9V 3OTFA
chains in the Genus database with same CATH topology
1EZVH 3TGUH 1NTKH 3H1HH 4D6TH 1PPJH 1NTZH 3CXHF 3L71H 1L0LH 2FYUH 1KYOF 1NTMH 1KB9F 2IBZH 3L74H 5KLVH 1BE3H 3L75H 3BCCH 1NU1H 3H1IH 4U3FH 1SQPH 1BGYH 1SQVH 3CWBH 1SQQH 1SQXH 2A06H 3H1JH 3H1LH 1P84F 3L72H 1BCCH 3L70H 3L73H 1L0NH 3CX5F 1PP9H 3H1KH 1SQBH 2BCCH 4PD4F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EZV H;  3TGU H;  1NTK H;  3H1H H;  4D6T H;  1PPJ H;  1NTZ H;  3CXH F;  3L71 H;  1L0L H;  2FYU H;  1KYO F;  1NTM H;  1KB9 F;  2IBZ H;  3L74 H;  5KLV H;  1BE3 H;  3L75 H;  3BCC H;  1NU1 H;  3H1I H;  4U3F H;  1SQP H;  1BGY H;  1SQV H;  3CWB H;  1SQQ H;  1SQX H;  2A06 H;  3H1J H;  3H1L H;  1P84 F;  3L72 H;  1BCC H;  3L70 H;  3L73 H;  1L0N H;  3CX5 F;  1PP9 H;  3H1K H;  1SQB H;  2BCC H;  4PD4 F; 
#chains in the Genus database with same CATH topology
 1Y74 B;  5LMU O;  3K58 A;  1WA8 A;  4GX5 A;  3R66 A;  5KAF Z;  4WFF A;  5EYP B;  1WB8 A;  1YCI A;  1PL4 A;  5KMG A;  5JWP A;  1XI1 A;  1Q6H A;  2BSK B;  4JI5 O;  4LF7 O;  1SS3 A;  5J2U A;  4JGS A;  4KP4 A;  3ML0 A;  2YIB A;  1Q6U A;  1RPO A;  1CP9 A;  4W4K A;  2Q6A A;  2OIE A;  3CCJ V;  4X88 A;  3LUT B;  1NU1 H;  2ZIN A;  1JCH A;  4L87 A;  4X62 O;  2XUM A;  1Q6I A;  2IJK A;  1HNZ O;  1BCC H;  4LR3 A;  1NJI W;  1R3J C;  1KU9 A;  4N23 A;  5JJN B;  3D3Q A;  5CA1 A;  5C93 A;  4NYK A;  2PTM A;  3QG5 A;  4JI7 B;  1VAR A;  4NTW A;  3RBZ A;  3LNM B;  2FML A;  1XMO O;  4DV7 B;  3PN1 A;  3W7W A;  3L72 H;  4PI0 A;  2PI5 A;  2FL4 A;  1SQG A;  4DV1 O;  4MVZ A;  5L3E A;  3QO5 A;  5H9C A;  1IDS A;  4K8X A;  1JJO A;  4MTF A;  1LUV A;  2DWE C;  2H8P C;  1KB9 F;  3OMA B;  4LF5 B;  2Q0A A;  3E2E A;  4MVO A;  4KHP O;  4CH4 A;  5LBQ A;  4DR7 B;  2BOC C;  1X59 A;  5EZY A;  3ABL B;  1YHQ V;  4LFC O;  3IC9 A;  1OCR C;  3SPC A;  2K9P A;  5IYZ A;  1SA0 A;  1N33 O;  4CS3 A;  2IH1 C;  2UUA O;  1OCZ C;  1HWY A;  1Y74 A;  4HNA B;  4I7Z B;  2F95 B;  3DC5 A;  2Y4U A;  2GUZ B;  2IW5 A;  5EYP A;  3CB2 A;  1N32 B;  3QTC A;  3EVK A;  2BSK A;  5JH7 B;  5LYJ B;  1ZLZ A;  3TXQ A;  2ZE5 A;  3DTU B;  3OEE G;  1FFX B;  3SJA C;  4UCV A;  4X66 O;  1OJH A;  2QWR B;  1GMG A;  4IIJ B;  4I5S A;  4X1K B;  3UT5 B;  2UXC O;  1NR7 A;  5LMN B;  3PJS K;  3BRC A;  3N2G B;  2UU9 B;  4UVB A;  4ASU G;  1K7D A;  2QM4 A;  3QVN A;  1QHT A;  2ARH A;  5H2F Z;  1W2B U;  1AI6 A;  4GX1 A;  1H2S B;  3H01 A;  1GN6 A;  3H1K H;  4LH6 A;  2ADP A;  1AP5 A;  3VQY A;  4DV0 B;  4LFA O;  1KYO F;  3ZHS A;  1QQC A;  2WLN A;  2ZXW C;  1DLB A;  1N4C A;  1OCO B;  1SQV H;  3CHX A;  4FVM A;  3RYH B;  3IC7 A;  1B3Q A;  2HG5 C;  3IJ4 A;  3BVO A;  1S5J A;  2HKO A;  1R6K A;  4J9Y B;  1I0H A;  3CCQ V;  1Q90 D;  1AJQ A;  1TVK B;  1TUE B;  2CH7 A;  2Q7H A;  2YI8 A;  4X64 O;  3KCY A;  5FL7 G;  1MSD A;  3ZMS A;  3ZS8 C;  1F4M A;  4ZI7 A;  1VF5 B;  3LSS A;  2Y69 B;  3IAY A;  5FPR A;  4JI1 B;  1BSM A;  2ILM A;  2ZNI A;  1K34 A;  1R73 A;  4JI0 O;  1AJN A;  2K1E A;  2GUZ A;  4J80 A;  1NTM H;  2IBZ H;  3ABL C;  2N74 A;  1UJW B;  3G67 A;  2VWJ A;  4OX9 O;  1IXB A;  3RGB A;  1PL0 A;  1KBH A;  3CWB H;  4X65 O;  4O4H A;  1V9P A;  4FFB B;  5JH7 A;  2P7T C;  5LYJ A;  5B1N A;  3UCS C;  3U11 A;  4CH3 A;  2VQE O;  1G6U A;  3B77 A;  4TOI A;  2PUS A;  3G80 A;  4IIJ A;  1HNW B;  1YTF B;  4X1K A;  4CC6 A;  1YTF D;  4MT8 A;  3UT5 A;  3N2G A;  1XMQ B;  4AHC A;  1I94 B;  3WG7 B;  3SPJ A;  2YIC A;  4CC5 A;  5B66 Z;  4FM2 A;  2YS8 A;  2YID A;  3ABK B;  3BY6 A;  2UXN A;  3K0D A;  4LCU C;  4I9W A;  1NS1 A;  1JA8 A;  2LJ2 A;  1NTZ H;  2Q8V A;  3WU2 Z;  2E76 B;  4RUF A;  3ZMT A;  3JD3 A;  3STZ C;  2H3O A;  4CZZ A;  3RYH A;  3ABM B;  4UCS A;  4UB8 Z;  1RFY A;  2GSM B;  2G38 A;  1RSO A;  4MVM A;  2X7R B;  4I50 A;  1Y6X A;  1VQP V;  2QEX V;  1TVK A;  2YDE A;  4TUY B;  3ZN1 A;  4GKJ O;  4WFB V;  2UUC O;  1M1K W;  2WAM A;  5CA3 A;  1AB3 A;  4BIO A;  4MTX A;  4DR1 B;  3HKB B;  4YHH B;  2A06 H;  4DUZ B;  1BMF G;  1E1Q G;  4DR3 B;  4EFE A;  1GAX A;  2ZNJ A;  5J9P C;  2WLM A;  2CDY A;  2F43 G;  4TSF G;  4B3M B;  3CCL V;  3BAA A;  2WLL B;  2DYS B;  1G1X B;  1XHZ A;  3FB6 C;  1MZF A;  3K06 A;  2Y69 C;  3OMN B;  4AQY O;  2E74 B;  3E89 A;  4GZR B;  4FFB A;  2Q7G A;  4C7U A;  5FPO A;  3KZI Z;  4X20 B;  5H6Q A;  1AR5 A;  2P90 A;  5GON A;  5JCO A;  4OXS A;  5B3S C;  4F6E A;  2R9I A;  3S3X A;  3OEH G;  1JPX A;  3JAT B;  4B08 A;  1J5E B;  1XEQ A;  1OHH G;  4JI4 B;  4ABM A;  2M6Y A;  1XBL A;  1NVP B;  4U7O A;  3C90 A;  4JZG A;  1Q81 W;  1I5X A;  2M7W A;  2DQ0 A;  4UV9 A;  5JJJ B;  2AGA A;  1X4T A;  5LXT B;  1NH2 B;  4IT5 A;  2HP8 A;  2ZT9 B;  1FJG B;  1KP2 A;  4MTG A;  3WG7 C;  4X89 A;  1SZX A;  3K03 A;  4XDK A;  4B3T O;  1ROP A;  4FLW A;  3T4Z A;  1KKC A;  5BY1 A;  4MVR A;  4G28 B;  1HR0 B;  3EFF K;  1Y4M A;  1QLN A;  4O4J B;  1B06 A;  2ZIM A;  1VQM V;  4TUY A;  3BFR A;  3GB7 C;  2JK5 C;  1YJ9 V;  1HNX O;  2EUL A;  2RDC A;  3HKB A;  3SPI A;  2EBO A;  3UQ8 A;  3E8B A;  3JAW A;  3UM7 A;  5IY5 B;  4P2Z A;  3B2E E;  1NZ6 A;  3APQ A;  4I9Q A;  3W7U A;  4DV5 B;  4JYB A;  4LWS B;  1TAE A;  1ZAU A;  1XNR O;  1R6T A;  3ZHU A;  4J7Z A;  3QF7 A;  4DV4 B;  3AG3 C;  5CMU A;  2HVJ C;  2ITC C;  3CC7 V;  4RQF A;  3SYQ A;  4JTC B;  2OCC B;  1KKD A;  4H33 A;  1MAB G;  4Q20 A;  4TQD A;  4X20 A;  5D5Q A;  1IBL O;  1OCC B;  2D3O W;  3SYP A;  2WLH A;  4LF8 B;  1OZ0 A;  1DF5 A;  3CRM A;  3RN4 A;  3JAT A;  2FTK A;  2W0X A;  3DXR A;  2QWP B;  4QJF B;  4FIP C;  4FLX A;  1QBZ A;  3T1Y B;  2AW9 A;  1YZB A;  1MMM A;  1VQ5 V;  1VQ7 V;  1FXH A;  3ZED A;  4LC1 A;  1H8E G;  4R50 A;  5TIS Z;  2ADQ B;  4GKK B;  5BR8 O;  2PI4 A;  1ARO P;  1M56 C;  2ZQM A;  4O4I B;  4JTA B;  2F23 A;  5LP6 B;  5GTH Z;  1FPO A;  1M4U A;  4IYH A;  2NN4 A;  3OAA G;  4UFZ A;  4LF4 O;  5KAI Z;  2YSU B;  2YIA A;  3ZRV A;  4ZKI A;  4DV6 O;  4DK1 A;  4NR1 A;  1K92 A;  3AG2 C;  2V7Q G;  2NNU A;  4O4J A;  5C8Y B;  1R1B A;  5KHK A;  3OR6 C;  2E5L O;  2JS3 A;  2IH3 C;  5KHG A;  3R65 A;  4P9O A;  3KKY A;  3N27 A;  3BA9 A;  1S76 D;  3K79 A;  1PKX A;  2OT5 A;  3I5D A;  2JRI A;  1KP3 A;  4JI8 B;  2QA4 V;  3FB5 C;  2E3C A;  4PJ0 Z;  2A0L A;  1V54 B;  4LWS A;  4HBN A;  4MVQ A;  4QGP A;  3A0R A;  4EKW A;  4TWK A;  3CEI A;  1GK9 A;  4N21 A;  1K4D C;  4O4L B;  3AK2 A;  5LA6 A;  5IY5 C;  1GM7 A;  2L6L A;  1YIT V;  5JQG B;  2IU3 A;  1CPY A;  3G6B A;  3HKD B;  5LHI A;  4I0X B;  4LFB O;  4LP8 A;  2EIK C;  2Z3Y A;  1SET A;  1AIL A;  3CD6 V;  1AP6 A;  2WSS G;  5LGT A;  1VQL V;  5L3C A;  2EIM B;  3HKE B;  4IL6 Z;  1VF7 A;  4YY3 B;  5E1A C;  1Q82 W;  2N04 A;  2KSD A;  2WPD G;  3LSU A;  4BWA A;  4LF6 B;  1OCC C;  2F66 C;  2BE3 A;  4JAS A;  1ZTE A;  2ETN A;  1SQP H;  3D36 A;  1BQZ A;  4KUM A;  3JCU Z;  2X6A A;  4W4L A;  2PYJ A;  4J7J A;  1I94 O;  4E4E A;  5H5N A;  3CJH B;  4O4I A;  5LP6 A;  4ZOL B;  5LOV B;  2OIG A;  3ZHQ A;  3E86 A;  3CSX A;  2QM7 A;  4FM1 A;  2Z0A A;  4MVU A;  3D36 C;  1H38 A;  2UXX A;  1HP8 A;  3VBB A;  4B7K A;  1UFI A;  3CRR A;  3JYC A;  5C8Y A;  3OTO B;  4D7T A;  3SPG A;  1NQT A;  1EN6 A;  3GWO A;  3K9A A;  1AI5 A;  4MS2 A;  1AR1 B;  1U97 A;  2YEV B;  4JI6 O;  2C2A A;  2VQF B;  4NTY A;  1MOF A;  4NXM B;  3OFN G;  2HR3 A;  4EB6 B;  1ZWI C;  5F2V O;  5KHH A;  4FLU A;  2JGD A;  3HB3 B;  1NI8 A;  4K0K B;  4WCE V;  3I55 V;  3P3P A;  2QM8 A;  2DE0 X;  3A0H Z;  3AG1 B;  2HHH O;  1R6N A;  4RAI A;  2CGN A;  4O4L A;  3JCZ A;  3OGI B;  2Q68 A;  5IWA B;  4K8Z A;  1XHX A;  3HKD A;  1BL8 A;  3JSL A;  4I0X A;  3CCU V;  4IGG A;  4DV3 O;  4X1Y B;  2GV9 A;  3KCX A;  4CH5 A;  3K5L A;  2CK3 G;  2JVD A;  1N36 B;  2DMX A;  2AZ2 A;  4DV2 B;  4YJ3 B;  4JI2 B;  1IBK B;  1TA8 A;  2EIN B;  4LBE C;  4YJ2 B;  3J80 N;  2JS5 A;  3S3W A;  4JV5 B;  1P49 A;  4WF9 V;  2XAG A;  4J41 A;  5DED A;  1PNM A;  1VP7 A;  2BOB C;  3ZHV A;  5KA5 A;  3ZMZ A;  4CS2 A;  4E2L A;  3ZX6 A;  4MW3 A;  2Q9L A;  4KFM A;  1QR9 A;  4GX0 A;  3LNN A;  3N2K B;  4Q6G A;  1L1F A;  4JI3 B;  2RNB A;  2JJ2 G;  3OR7 C;  1Q5O A;  3UKM A;  4GLX A;  2A7W A;  1M93 A;  2F4V B;  3CJH A;  1F51 A;  1BZK A;  1VQ6 V;  3JD4 A;  1YI2 V;  2CGO A;  3O9O A;  2R70 A;  2P06 A;  4UCO A;  3OMI B;  1MG1 A;  1AVM A;  1AI7 A;  3LDD A;  2ZR3 A;  1N34 B;  1JFF B;  1JVM A;  1AR4 A;  4J42 A;  1JR9 A;  4PDM A;  4J7K A;  2BCC H;  5BMV B;  1P7G A;  4LF9 B;  4JF3 A;  4PDR A;  4EB6 A;  1VQK V;  4H0L B;  4B7E A;  5DM6 V;  3C3S A;  3M99 B;  1L8D A;  4B3R B;  4PV1 B;  3WFV A;  1BS3 A;  2YUA A;  4DR2 B;  5K1X A;  2RMK B;  3G6E V;  2GHY A;  3ZHR A;  2NLJ C;  2ZM6 O;  2MK3 A;  3BPZ A;  2CAZ C;  2UUB O;  1ORQ C;  3ASO B;  4FJC C;  3F5T A;  3SYA A;  4X1Y A;  4NXN B;  4U3J B;  1QU7 A;  1EM1 A;  2O57 A;  4P30 A;  1NR1 A;  2A3Q A;  5A2Q N;  3RFR A;  3CP1 A;  4YJ3 A;  3OT7 A;  4XDJ A;  1D5A A;  4MVS A;  2DJV A;  1GH6 A;  4YJ2 A;  4ICG A;  4DXW A;  3K5M A;  3RYF B;  1NBM G;  1SF9 A;  2QJ1 A;  4B3S B;  2P22 C;  4HNA A;  1JOY A;  3OGC C;  2AXT Z;  2LW7 A;  1SQF A;  1QVG U;  5GW7 A;  1IXM A;  1LNQ A;  3N2K A;  2EIN C;  2BTQ B;  5EC2 C;  1KMI Z;  3A2F A;  1XNQ O;  4DW1 A;  5E79 Z;  3T4D A;  1A32 A;  2P67 A;  4DR4 O;  2DWD C;  3E22 B;  1FFX A;  3J81 N;  5LGU A;  4JYA O;  5EBL C;  1AI4 A;  4J10 A;  3K04 A;  2VS0 A;  4Z2W A;  2R9A A;  2UXB O;  3E83 A;  2EIL B;  1S5H C;  1M9N A;  4DR5 B;  1SC5 B;  1FFT B;  4DUY B;  2D2C B;  3F5W C;  5H6R A;  3ABU A;  2QSA A;  5LMU B;  5BMV A;  1URF A;  3RT3 C;  1ZL8 B;  3THO A;  2CUG A;  2P4K A;  5IDJ A;  4IHJ B;  3NXS A;  1S0V A;  4WFG A;  5L3D A;  4JI5 B;  4ZIB A;  4LF7 B;  2QTO A;  2XAQ A;  3T1H O;  3CPW U;  2JEX A;  1D5N A;  2PF4 E;  3CCR V;  3UO2 A;  2KG7 B;  3DGE A;  3WB1 A;  3HR0 A;  4U3J A;  1XIL A;  2WLI B;  4I55 B;  2EIJ B;  1OCO C;  3CCM V;  4X62 B;  2KQX A;  1HNZ B;  3K59 A;  3HPL C;  2QGN A;  3RYF A;  3LDC A;  2HJF C;  3E8F A;  2ZDI A;  1H2G A;  4BIZ A;  2UXD O;  2P5O A;  3E8H A;  1XMO B;  4DR6 O;  4K35 A;  1L0L H;  1D2D A;  4PHZ A;  2WLK A;  2BTQ A;  1IBM O;  4BW9 A;  3U0Z A;  1K33 A;  1S77 D;  1BHA A;  2ZDI C;  1E79 G;  5KHI A;  3E22 A;  3K5N A;  2ZKO A;  3L73 H;  2OYQ A;  3I56 V;  4PA4 A;  4FK5 C;  1GTO A;  1RP3 B;  4Z1V A;  2HEP A;  2YXL A;  4KHP B;  1NTK H;  4NTX A;  4GUN A;  4F6R B;  2CTR A;  5IJ9 B;  5LHH A;  5FNV B;  5AG2 A;  5CBG A;  2FKX A;  4LFC B;  1NVP D;  1TUB B;  5JCO C;  4A5U B;  1N33 B;  2UUA B;  2LP7 A;  2LQT A;  1ZL8 A;  3JAL B;  1T5E A;  1R3I C;  2DYR B;  4IHJ A;  1NH2 D;  4JYY A;  2VQF O;  3ASN B;  2EIL C;  1G8M A;  4FMT A;  2MW2 B;  3ABK C;  1Y67 A;  5CB4 B;  2ODM A;  1VQN V;  5IYD O;  4JI7 O;  5ITZ B;  4X66 B;  2KKW A;  4DV7 O;  2KG7 A;  3FFQ A;  1XL6 A;  1VQ4 V;  2Q7E A;  2WLI A;  4I55 A;  3ABM C;  3K08 A;  2UXC B;  2YC0 A;  4QE9 A;  1FAF A;  1VEW A;  3RYC B;  3ZRW B;  1SES A;  4UXN A;  1XDC A;  1MZE A;  1QCE A;  4LF5 O;  4FLT A;  3ETE A;  3BA8 A;  3JAK B;  3W7T A;  1TGO A;  1DK1 A;  4RO2 A;  3X2Q B;  1CXZ B;  5CN0 A;  4DR7 O;  2Q4P A;  4LFA B;  2AHZ A;  3CCV V;  5EBW C;  3ZBH A;  1RPR A;  2WLL A;  2Y0P A;  5GTI Z;  3BAB A;  1I5Y A;  1BE3 H;  4YXW G;  1BGY H;  3CYO A;  5DN6 G;  3K3W A;  3P3N A;  5A9G A;  4JI3 O;  3APO A;  5B1A B;  3CME V;  1QVF U;  2ZIO A;  1WP7 A;  3OD4 A;  1N32 O;  2DYS C;  4X64 B;  3ZIA G;  3ETG A;  4ZHQ B;  1F7Y A;  4F6R A;  5IE9 A;  5IJ9 A;  2H94 A;  2R9R B;  4CBC A;  2AZ0 A;  1BQ0 A;  2EJR A;  3O65 A;  1TUB A;  4TT3 G;  3MHH C;  3CS5 A;  2W0F C;  3VQV A;  2QDO A;  3AG7 A;  5LMN O;  1COW G;  1JJ2 U;  1N34 O;  4QE7 A;  4JI0 B;  2UU9 O;  3JAL A;  1MSW D;  5LXT A;  3M8A A;  1VQO V;  4G2K A;  1JQ0 A;  3BHP A;  2KB1 A;  4OX9 B;  4X65 B;  2WWW A;  5CB4 A;  1QLE B;  1O9G A;  4FZ0 A;  2QR4 A;  2VQE B;  4DV0 O;  4UB6 Z;  4K3A A;  4TQF A;  3AEI A;  1PM9 A;  4B3R O;  5ITZ A;  1KD1 W;  1K73 W;  2XAF A;  1YVW A;  4ZBM A;  2WLJ A;  3TJT A;  3STL C;  3CC2 V;  1I08 A;  3W7X A;  2FYU H;  3EXA A;  4DRX B;  3L74 H;  3ZRW A;  4U3F H;  3CCS V;  3E35 A;  2IU0 A;  5CBH A;  2YI9 A;  3JAK A;  3GVM A;  4NB5 A;  4DW0 A;  1HDJ A;  3J7A U;  1K97 A;  3OUF A;  1Z5W A;  3RW0 A;  1XOU A;  4LH7 A;  2W6J G;  3BEH A;  4QNH B;  1PNK A;  1VF6 A;  2V4D A;  4CS4 A;  1S5L Z;  2VWK A;  4JI1 O;  2B9Z A;  1M57 B;  4BR6 A;  2HFE C;  3X2Q C;  3VQX A;  5DEC A;  2DW4 A;  5HFM A;  4R8C A;  1VF6 C;  4GKJ B;  2UUC B;  4ZHQ A;  4PA6 A;  2OCC C;  2HJD A;  3GWK C;  4RUE A;  4UUJ C;  3SPH A;  1PD3 A;  2XOK G;  1Y66 A;  3T1C A;  1HNW O;  3D8C A;  5B1A C;  1GKF A;  5KHJ A;  1DGS A;  4O2B B;  4P9P A;  4KL1 A;  1EN5 A;  3RVY A;  1MA1 A;  2JGU A;  1XMQ O;  4O2A B;  4AQY B;  3HKC B;  2IJJ A;  4L8J A;  3NR7 A;  1WPB A;  2LW1 A;  3EHB B;  4PA7 A;  1QR8 A;  2GDS A;  3TK1 A;  5LP6 C;  4JYC A;  1SRY A;  2QWN B;  3K57 A;  1BHB A;  5KX5 B;  5IYB O;  1QLE C;  1VIB A;  5B1O A;  2L35 A;  3Q4H B;  4DRX A;  1Y76 B;  1S72 V;  2XAS A;  1H2M A;  2YXY A;  5EK0 A;  3IGA C;  2CTQ A;  4HZ3 A;  4DR1 O;  1N8R W;  2ZXW B;  4YHH O;  4PEL A;  1FXK B;  1K4C C;  1WLE A;  2QTS A;  2Q0O C;  2EZP A;  1SQB H;  4DUZ O;  4DR3 O;  1SZT A;  4B3T B;  5JQG A;  1V54 C;  4EEQ A;  1SKV A;  4B3M O;  3B09 A;  3JD2 A;  1K5S A;  4OPH A;  2XAJ A;  2ZCE A;  2V1D A;  3OUS A;  4BAY A;  2B5U A;  1LUW A;  3TXS A;  3HKE A;  1HNX B;  1OV9 A;  1M57 C;  1Q8I A;  2PGG A;  3CMA V;  1YJW V;  1M5I A;  1XRE A;  1H2N A;  1XUQ A;  2BTO A;  3MAQ A;  1GM8 A;  2CH7 B;  2JIZ G;  1LR1 A;  4PA9 A;  2AHY A;  4HAM A;  1E1R G;  1J5E O;  4J11 A;  1Q3E A;  1ENV A;  1XNR B;  4JI4 O;  4MW8 A;  4O2B A;  4BIU A;  2EIM C;  3ETD A;  4ZI7 B;  3F7Y C;  3CRA A;  2OTL V;  4ZOL A;  2NR5 A;  4O2A A;  3ZHT A;  2JEU A;  5LOV A;  2WA3 A;  1PP9 H;  2EX3 A;  1H8H G;  2EZO A;  3HKC A;  1IBL B;  4QPK A;  4GX2 A;  3FB7 C;  2XND G;  4H37 A;  5B5E Z;  1FJG O;  2ATK C;  2QWQ B;  2F1M A;  1P4R A;  4O4H B;  3RWR D;  1J95 A;  1KEC A;  4YIO A;  2YEV A;  3F7V C;  1K3E A;  1L0N H;  5KX5 A;  5D5P A;  3Q4H A;  1GO3 F;  1HR0 O;  5EIB D;  4H44 B;  1Y76 A;  4KXR A;  3QO8 A;  3FB8 C;  3L71 H;  5KLV H;  4LNU B;  3SGI A;  4G27 B;  3AK3 A;  4GYC B;  1N0J A;  5BR8 B;  5IJ0 B;  1FXK A;  1S3J A;  3CRC A;  3UO3 A;  1V55 B;  3SR2 C;  4DV5 O;  3L70 H;  4YIP A;  2Y48 A;  4LF4 B;  3KG2 A;  2PYL A;  3AK1 A;  2XTA A;  5K1P A;  3CC4 V;  2CTW A;  1F4N A;  4D7S A;  1K8A W;  4DV6 B;  3P32 A;  4DV4 O;  3E8G A;  2GBO A;  1IVS A;  1FXK C;  3AG1 C;  2N05 A;  3ZMV A;  2E5L B;  1SQQ H;  2X6B A;  3H1J H;  3B4S A;  1RSO B;  3RYI B;  3OW2 U;  4I50 B;  2PZS A;  4OGQ B;  3ZN0 A;  2Q67 A;  4LF8 O;  1EZV H;  2FB5 A;  5B1B B;  4XBF A;  3SYO A;  4I4T B;  3W7S A;  3JAM N;  3T1Y O;  1GRJ A;  3P30 A;  1GN2 A;  4WFA V;  1SER A;  1Z2G A;  3ABT A;  1WAZ A;  5B3S B;  1FD9 A;  4JAV A;  3FAV B;  4GKK O;  3RVZ A;  4LFB B;  1JX9 A;  4UVC A;  2W6I G;  4QPJ A;  2A79 B;  4R6Z A;  2R72 A;  4UCR A;  5BXZ A;  1JFF A;  2Y0I A;  2CE4 A;  2LGW A;  2ZE6 A;  2IJH A;  4JZ2 A;  5GON B;  1EZJ A;  1P7B A;  4HYO A;  3OE7 G;  2LFS A;  3LSQ A;  3C3T A;  2OCH A;  2LO1 A;  2PY5 A;  2OWO A;  1GN3 A;  4LNU A;  3T2M A;  3BCC H;  3H1I H;  2DN9 A;  2VRZ A;  5IJ0 A;  2E75 B;  5EIB C;  4JI8 O;  1XL4 A;  1YEW A;  2RCV A;  3M7M X;  2XT9 A;  1M90 W;  2Y4T A;  1EBO A;  2ZD9 A;  1H2K A;  3ETQ A;  1THZ A;  3SYC A;  1U96 A;  1H2L A;  1W0J G;  3IFX A;  2EJ7 A;  3B40 A;  5CA0 B;  5J2T B;  2P6J A;  1WN7 A;  1V55 C;  2LFR A;  5CBF A;  3RYI A;  4JI6 B;  4PDV A;  4MSW C;  1DF4 A;  3ASO C;  4RQE A;  4R7C A;  1HW7 A;  1RM1 B;  4PI2 A;  3QO7 A;  2HLD G;  4WFE A;  4I4T A;  4AIL C;  4Z1M G;  1DTO A;  3AG3 B;  1EN4 A;  3VQW A;  2RN9 A;  4YY3 O;  2P4V A;  3K9S A;  3JAW B;  2HHH B;  1G4Y B;  1W59 A;  4DV1 B;  4LF6 O;  3H1L H;  3SDL A;  1IUR A;  2ZE8 A;  2OTJ V;  1MNG A;  1EFR G;  1NT2 B;  3JAR B;  4UVA A;  5L3B A;  5B1B C;  4WBN B;  5HFL A;  4DV3 B;  3FAV A;  2DQ3 A;  2QKS A;  4EFB A;  4FZ1 A;  1WP8 A;  1CEZ A;  1N0N A;  4DK0 A;  1WJZ A;  2F93 B;  4J9Z B;  5IT9 N;  4QIW F;  2Z5U A;  4XDL A;  4GT1 A;  3ICX A;  5FLX N;  4BW5 A;  2WA4 A;  4X8A A;  3ZRS A;  3FX7 A;  1WPX A;  3OTO O;  1US6 A;  2XHB A;  5KUM A;  2JJ1 G;  2Q73 A;  1B6Q A;  1K9M W;  3DXR B;  3TGU H;  3B8N A;  1M56 B;  3K5O A;  2QKC A;  2Q69 A;  5EC1 C;  3JSN A;  4NXM O;  5IYC O;  5JJE B;  1FXV A;  4K0K O;  3LDE A;  3CE2 A;  1F23 A;  3ZRX A;  3FYE B;  1YXB A;  2LGQ A;  3AG2 B;  4DO2 A;  3U10 A;  1ZX3 A;  4JTD B;  4PD4 F;  3AG4 B;  5CA0 A;  3JAS B;  5J2T A;  1R3K C;  4FLV A;  1KC8 W;  5IWA O;  3K0G A;  1SQX H;  5LHG A;  1FS0 G;  1QNM A;  1W0K G;  1N36 O;  4DV2 O;  2EIJ C;  1FKA O;  4JI2 O;  2ZE7 A;  1WB7 A;  1IBK O;  4DYL A;  3ZMU A;  1PV0 A;  1IZ3 A;  3D3I A;  4JV5 O;  2IM9 A;  4WFH A;  3DSQ A;  3JD0 A;  4PDL A;  1KUQ A;  1K5Q A;  2ZM6 B;  1FYJ A;  1JMK C;  2UUB B;  3CXC U;  1Q43 A;  5JVD B;  1RM1 C;  4X9Q A;  2QE7 G;  1Q86 W;  3ZCC A;  3JAR A;  2YXH A;  4WBN A;  2EIK B;  2F4V O;  4TV9 B;  4UCU A;  3H9V A;  1VQ8 V;  4MTO A;  2XAH A;  5LA6 B;  4OPA A;  5KUK A;  4X1I B;  5FNV A;  2IJI A;  4UCT A;  3TCU A;  2CTP A;  4TV8 B;  5LGN A;  3SJC C;  2GTS A;  2QKA A;  4UV8 A;  4FLY A;  2X6C A;  3MD0 A;  1IX9 A;  4FFK A;  5BZB A;  3MHS C;  1PNL A;  3H1H H;  3SJQ C;  1XNQ B;  2B1G A;  1O9H A;  3MDS A;  4LF9 O;  1Q7Y W;  1WA8 B;  1NKD A;  4AI8 A;  4U7N A;  3ZJZ A;  4DR4 B;  2A9H A;  4JYA B;  4H13 B;  5KMG B;  2DYR C;  4DR2 O;  3OM3 B;  3CX5 F;  4CH6 A;  3G71 V;  1YIJ V;  5J2U B;  3WB0 A;  3ASN C;  4IYI A;  2RQ6 A;  1KQS U;  3JAS A;  2UXB B;  2YIB D;  1PPJ H;  4F4L A;  2B1I A;  3RYC A;  2QWO B;  3A8T A;  3DC6 A;  1GN4 A;  3WB2 A;  1BT8 A;  4NXN O;  4NKG B;  4FM0 A;  3B8M A;  1VMG A;  3FD9 A;  5L3F A;  2ZR2 A;  3AG4 C;  1AJP A;  4FPP A;  3QNE A;  3L9D A;  3FKS G;  2ITD C;  4D6T H;  4B3S O;  3FYI B;  5CA1 B;  3T1H B;  1UPG A;  4GCZ A;  1R3L C;  2JGD B;  4JAA A;  1ZUQ A;  5JVD A;  5L3G A;  5LL6 Y;  3SJB C;  4JPR A;  3CCE V;  2HVK C;  1ZSP A;  1YF2 A;  1YDX A;  1XQ8 A;  1GM9 A;  4TV9 A;  3A0B Z;  2X0L A;  2RJZ A;  4FLZ A;  3VOU A;  3TET A;  4X1I A;  4RWU A;  1OCR B;  2JDI G;  3CXH F;  1I7F A;  4NVP A;  3G4S V;  5EBM C;  1OCZ B;  2GTA A;  2DOS A;  4TV8 A;  3L75 H;  1B04 A;  5KA6 A;  2Q5Z A;  3CRQ A;  4PA3 A;  4JAU A;  1YSC A;  1P84 F;  1YJN V;  1WNS A;  2UXD B;  5EZY B;  4DR6 B;  4DR5 O;  3JD1 A;  1SA0 B;  5IYZ B;  4DUY O;  1Z5V A;  1IBM B;  1VQ9 V;  3OTF A; 
#chains in the Genus database with same CATH homology
 1EZV H;  3TGU H;  1NTK H;  3H1H H;  4D6T H;  1PPJ H;  1NTZ H;  3CXH F;  3L71 H;  1L0L H;  2FYU H;  1KYO F;  1NTM H;  1KB9 F;  2IBZ H;  3L74 H;  5KLV H;  1BE3 H;  3L75 H;  3BCC H;  1NU1 H;  3H1I H;  4U3F H;  1SQP H;  1BGY H;  1SQV H;  3CWB H;  1SQQ H;  1SQX H;  2A06 H;  3H1J H;  3H1L H;  1P84 F;  3L72 H;  1BCC H;  3L70 H;  3L73 H;  1L0N H;  3CX5 F;  1PP9 H;  3H1K H;  1SQB H;  2BCC H;  4PD4 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...