1SQVK

Crystal structure analysis of bovine bc1 with uhdbt
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
51
structure length
51
Chain Sequence
MLTRFLGPRYRQLARNWVPTASLWGAVGAVGLVWATDWRLILDWVPYINGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome c reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 14
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF08997 UCR_6-4kD Ubiquinol-cytochrome C reductase complex, 6.4kD protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1sqvK00
3CLQA 1SQQK 2OARA 2J59M 2O01H 2LKMA 2WSFH 1NTKK 2WSCH 1L0NK 2WSEH 4IFDK 3G3ZA 1SQXK 1NU1K 1NTMK 1NTZK 1L0LK 3M9QA 2FYUK 5KLVK 1SQPK 1SQVK 1SQBK 3LW5H
chains in the Genus database with same CATH superfamily
5H2FE 4PD4H 2YMYA 2QE7H 1MFTA 1VQNP 2WZ7A 2BEQD 2R44A 1JY2P 1PPJD 1URQC 2E76C 3PTZA 3G71P 2IFMA 3HD7D 1JO5A 2P1JA 2V4HA 3VN0A 4AUWA 5KLVK 1RHZB 2FFDB 1Y47A 4WY4D 2E5YA 1U7JA 4PJ0H 3A7OA 1HVVA 1BCCD 2KZIA 3AE7C 2IZ0A 1S4XA 1PP9E 3CXHI 3HUSC 1H8AA 2XU6A 3JC22 4H0LB 1SP4A 2W6BA 5KLVE 2H7HA 3A0HH 3CCUP 3HE5B 1U57A 2M8RA 4IFDK 1NKNA 1EZVI 2KUBA 4U3FE 1NAYA 3BCCJ 4O9BA 2FYUG 1PGQA 5AW5B 3PH0A 2JO1A 2QJPC 3RK3B 2P67A 5B66H 2O1KA 2Q1KA 3D70A 1PP9D 2NPSC 1YHQP 5CCHD 3TK1A 3RL0D 1FZEA 1P84E 2K9JA 3PJSK 5KLVD 2C9LY 2E74C 2HPCA 3AE2C 2RN0A 2ZT9C 3HTKA 1L0LJ 4OGQD 1KB9H 1HBWA 4L75A 2XDJA 3CXHE 4U3FD 1GL2A 2RH0A 3H1HJ 4EI2A 4I6MC 1E5WA 1T2KC 5AVRB 3G4SP 2W8ZA 3VOPA 5CJ0A 1BGYG 5GTIH 1EZVE 4NPFX 3M0DA 2KXPB 1P84D 2N1TA 3CCEP 2O01J 2Y9YA 1YYCA 1N7SD 3TGUG 1NWQA 3L70E 3G6EP 2N9YB 3MIWA 1SFCB 4GKGA 4L76A 3CXHD 1USEA 1W2EA 1GK4A 5GTHH 1RE3C 1NYHA 2QA4P 1NJIQ 3Q5RA 2CPSA 1BSHA 3VTPC 1ZLLA 2IBZI 1OW8A 1VQ7P 1HJ0A 1ZXGA 1NU1J 1XTGB 2KS1B 1EZVD 1XTCC 1NOHA 1VQ5P 4GOEA 1LWUC 1VDFA 3BASA 5KAIH 3Q5SA 3L70D 4I1LA 3CWBE 1N7LA 1WRGA 1K9MQ 4ZMDA 2Q6QA 2OARA 1T3JA 2ZYGA 4DCKA 3NFQA 2KNCA 4HB1A 1IFNA 5AW7B 3AE6C 2H8PD 4GODA 1VQMP 2LR2A 1WMKA 1X0TA 4IFFA 3EQ2A 2B9BA 2P10A 2O01H 3RL0g 1VF5B 2FYUJ 2G3AA 1L0NK 2P58A 4EDFA 3CWBD 2IBZE 2C0WA 3G3ZA 2V7QH 3AE3C 2YO2A 3VMAA 4HJGH 2WSCJ 3CCJP 1L4AA 5KKZC 2G8YA 1NKZB 1GU4A 1EXIA 1SQXK 2E43A 1LTTC 4XFJA 3LIEA 3CLQA 5AVZB 1L0NE 3RK3C 3B5NC 1Z56A 4NPDA 2IBZD 1FC2C 2LKMA 3CCQP 1KN7A 2B88A 3MD0A 1HGVA 4N3YB 1EXJA 3TGUJ 1SQBG 1OVUA 2B87B 5APVA 1IFDA 3RK2D 2IDBA 3KZIE 4A7PA 3KQGA 3A2AA 1L0ND 2M5AB 4C46A 2OTKE 2C0XA 1M1JB 1LJ2A 1N2DC 1NTZG 3I56P 5TJHA 1SQVG 4H13C 3R2PA 1AVYA 1N86A 3FXDA 1LGHB 1KILA 5KLIC 4I2LC 4ASWA 3HD7B 1HTLC 1LTJB 1URQB 2AXCA 2E76B 3FXEA 5M1BA 1QL1A 3AE4C 1SFCC 2VRSA 1EDKA 1BSNA 5KJ7A 4OVNF 3NXSA 3I55P 1USDA 4NPEA 5BU5A 1LP1B 4BWNA 5AW8B 3QWOC 3AEFC 3SWKA 3Q2YA 2GM4A 3V2NA 3VMYA 4K35A 1X22A 2WITA 1YBKA 5CCGC 1KTMA 2M3EA 3HUSB 5AVSB 5CHXA 2J58A 2QM7A 5CBNA 1KQGB 1LT9A 5CJ4A 1ZR4A 1T6AA 1FZAA 2XNXA 2KOGA 3KDPB 2OYHC 2E75D 4L74A 3SFEC 3BRTB 3H25A 1FDMA 1KYOH 3LW5J 3O6QB 3EFFK 2ZXEB 2WWWA 1S5LH 4D6TE 1BGYE 2QJPB 3AEGC 1LTAC 2OGUA 3H1LE 1GL2D 4IL6H 1LTIC 2NPSB 2L91A 3RL0B 3GHGA 1GW4A 1CI6B 1L2PA 5APTA 3LIDA 1OFCX 3M9BA 1FOSF 1FU1A 2E74B 1KFNA 5APWA 2N1TC 2ZT9B 4GIFA 1D7MA 3V6IA 1GK6A 1AA0A 1MV8A 4LLHA 2IFNA 1BE3E 4D6TD 1BGYD 1SQBJ 3MUDC 3VMZA 2ZVNB 3H1LD 4WBAA 1BDCA 1IFJA 4GT1A 2K3RA 3U1AA 1X9VA 2FFDA 1NTMK 4KT0J 2WPRA 3GLMA 2KB7P 4HKZH 5AVWB 3S1KA 1W2BO 2WT7B 4Y99C 2IX7C 1NTZJ 3AE5C 3WU2E 4YXDC 2ZFCA 3A0BE 2W6JH 1JOCA 3H1JJ 2MKVA 3L73G 5CMZA 3LW5H 1W5CE 1BE3D 1FDOA 1FE6A 1NTME 3E1RA 1AQ5A 1Y8AA 2MJZA 3G9RA 3GG2A 3CX5E 4WVZA 2YNYA 4W7ZA 1LWUB 5APQA 4I7ZC 4Y28J 2WSFJ 3IFMA 2B89A 1M56D 2Z5IA 2W27A 1SQPG 5AW3B 2ZYAA 1FJPA 4H44D 2C9NY 2PFXA 3HD7C 1LTJC 3PLNA 3ABVC 4N6JA 4UB8E 1VQLP 3L71G 4WY4C 1NTMD 1S72P 1NU1G 1PV3A 1L4AD 1EC5A 1P84I 4ZKPA 1K73Q 1N8RQ 2E42A 1R5LA 2IZ1A 3CX5D 1YTZI 3SFDC 3L75G 1RF1C 2K37A 1N73C 4EOTA 5APYA 1EQ7A 1IC2A 1VQ6P 4C7NB 1SS1A 2HR3A 5EFWB 3RBXA 3H6PA 5KKZB 2BASA 3JCUE 2NRGA 4W80A 1IFMA 1KILE 4UB6H 3NTNA 1SQQK 4MN4C 2YO3A 5AW4B 1S9KE 4WWIA 1SQVE 2WSFH 3B5NB 3MTUE 5CCHC 2BCCG 3ITKA 2D2CD 3L74G 3RL0C 1IK9A 2CPBA 3L72E 3CCVP 1OIPA 2KS1A 3F89A 3V2RA 1EDLA 5BVZA 1T3UA 3CXHH 3FGAD 3TNUB 3E1IA 4OGQC 1TU3F 1NAFA 1JB0J 2OYOA 1KORA 1J1DB 3RK2B 1SQQE 1KILD 4DOJA 2R5DA 3WUUA 1DIPA 2ZJSE 2WMMA 5B66E 2HODA 1Y9BA 3AE1C 1S9KD 3L73J 1PGPA 1SQVD 2OYIC 2FYNB 1YTZT 4BRYB 3D6ZA 1JNMA 5KAFE 3II6A 3V5BA 5KJ7D 3CC4P 1QVFO 1M57D 3L72D 4H13B 3TSIA 2AEMA 1N7SC 1VQ4P 5KLIB 2PP6A 1VQ9P 1VQOP 3A5TA 2V7QJ 1SQQD 1IFIA 3H1KG 1SQPJ 3CCRP 1Q7YQ 1DD4A 3TDKA 2Y0CA 2A06G 1NTKG 1HGZA 1JMMA 3OW2O 1R8EA 3L71J 3CCSP 2R3SA 2Y9ZA 5AW9B 2KLVA 1FJKA 1HF9A 5AVXB 1H89A 1UIIA 3E7KA 1AFOA 3L75J 2DW3A 1L0LK 5AW2B 3BCCE 5GTHE 3H1IG 1SQXJ 3AEBC 4PV1D 2E75B 3N7NA 2OYHB 1IFPA 3CC2P 5DJUB 2JWAA 1K05A 3RGUA 4HH2A 4HYTB 4LGDE 4AYCA 2B87A 2BEZF 5KAIE 2WTYA 1Q86Q 2FKWB 1JCDA 2I1JA 1L0LE 1YIJP 1PPJG 2M5AA 1FOSE 1DEEG 3BCCD 4QMAA 1M1JA 2JDIH 3USSA 4YPCA 2BCCJ 3H1HE 3WUTA 4CPGA 3L74J 2N1TB 1HWTC 1YQ3C 1ZR2A 3EWKA 3B8EB 3C1LA 4IFMA 1YJWP 2K9YA 1BCCG 1URQA 2R5BA 3GF3A 2FBWC 5B5EH 1RE4C 2H88C 4H0LD 1L0LD 3HRNA 1LP1A 1RF0C 3H1HD 4Y99B 2WSSH 1OX3A 2M0BA 1JTHB 1OXZA 3F5HA 2HYNA 2WQYC 4XE5B 3HUSA 1AVOA 1NU1E 4DJGA 1GDTA 1FZCA 1J1DC 3RK2C 1MUUA 2KNCB 1ZOYC 2QJKB 2KK7A 3MP7B 1PP9G 1QEXA 3H1KJ 2FYNC 3VMXA 2OTLP 2FYUK 1EDIA 1NTKJ 1Q2NA 3O6QA 5KLVG 1HH0A 4I7ZB 3H1JG 3SWFA 3OJAB 1H0TA 1U7MA 2NPSA 4OH8B 3NMDA 4U3FG 2QVAA 1NU1D 1RQVA 1G1JA 1H88A 1K04A 1S2EA 4WY4B 3PP5A 3H1IJ 2FYUE 2J5UA 1KV4A 2KZJA 5AVQB 1NH4A 2YKOA 1QVGO 4DT0A 2KP8A 5APSA 1RF1B 4EIJA 2P2UA 4JYCA 1N73B 1J1EC 1KQSO 4XA4A 2R3CA 2A45I 2QM8A 1SLQA 3P7KA 1DEBA 2CK3H 1VL2A 4W7YA 2H43A 1OWAA 1ZRTE 2WT7A 2E75C 2FYUD 1G2CB 2JKVA 4Z1MH 3FWNA 1GW3A 2OTJP 1EZVG 5DJTB 4L73A 2AEJA 3Q1MA 3OAKA 1RE3A 2YXRB 1A02J 4EYYQ 1GL2C 3HE4B 1BCCJ 3L70G 3CI9A 2HFED 4YTPC 3TGUE 1NO4A 2I8DA 2J59M 5AW0B 5APUA 1LWUA 3M0DC 3H1KE 4OGQB 1ZRTD 3EFGA 2AXTE 3TYYA 3CMEP 3PRJA 1OW7A 1QL2A 3CX5I 1FZBA 1S5LE 1CW5A 1VF5D 1QLED 2W90A 2OYIB 1KQLA 1LTGC 1MZ9A 2JWDA 1T8ZA 1HUCA 3AEEC 1Q82Q 3TGUD 1YJNP 1PP9J 2FY8A 3T97B 3WU2H 1N7SB 1DH3A 1IZNB 1PL5A 2PAJA 3H1KD 2KSEA 5KLVJ 5AW6B 1ZP0C 3V2PA 1AJYA 5K5GB 4PD4I 1DD3A 4C7NA 5TISH 1S5LX 3IN6A 4U3FJ 1JUNA 3HE5A 3GMAA 2QJKC 1UIXA 2IBZG 2Q3IA 1Q90D 5H2FH 3B4SA 2M3BA 3M91A 5BU8B 1PGJA 3B5NA 2ZYDA 3GHGB 3L4FA 4H44C 4AQRD 4UB8H 5AVTB 3BVHA 3KHUA 3V4QA 2IYOA 1JCCA 1JM0A 1FZGA 1L0NG 1OZHA 2IPPA 1SQBK 3TNUA 1DX7A 2RKLA 1L4AC 5E79E 2UWJE 3M06A 2KLUA 2FXMA 4U7JA 2WPSA 5L8RJ 4DZOA 1LNQA 4PD4E 3CL3D 1URQD 1AV1A 2E76D 2RMZA 5CBOA 1PZQA 3MZWB 1NTZK 2O1JA 2H89C 4BRYA 3Q5PA 2Y0EA 1JY3N 1SQVK 2QRXA 1SQXG 4ZNCA 1FZFA 1KZUB 3L70J 3K5BA 3AE9C 3JCUH 1SQBE 1M7LA 1KMIZ 1PIXA 3FX0A 2Q7CA 3B71A 2K88A 2OQQA 3P8MC 1LTBC 4PJ0E 1JEKA 2XV5A 1PFIA 1FBMA 3H32B 4M3LA 5AW1B 2K1AA 1SFCA 3KYQA 3IAOA 4JYBA 1KB9I 1FZCC 4PD4D 1NTZE 2XNDH 3BRVB 2D2CC 1VPCA 1P84H 3H1JE 3MHVA 4YXWH 4TT3H 1CSBA 3A0HE 3CWBJ 1ZW0A 3N4XA 1SQBD 5CCGA 1GTWA 2HODB 3P32A 4UB6E 1YQ4C 4R4MA 2JR8A 1VQPP 1KILC 1QGKB 1MKMA 2XKMA 2WVRA 1Q81Q 4ZKUA 2NPSD 5KAFH 3AECC 3L37A 1NTZD 2Q5UA 3V2QA 4C7RA 2OYHA 5AVYB 3QH9A 2E74D 5KJ7C 2YIUC 3H1JD 2ZT9D 1GU5A 3Q3DA 2YXQB 2LXBA 2KSJA 3CCLP 1KB9E 1VQ8P 3KXDA 3RBZA 1E79H 2R32A 1M90Q 3GW6A 2PGDA 2QJYC 2W83C 1T2KD 4D6TG 4JPZB 3VP8A 3L36A 1JMBA 1LT9C 3H1LG 1JY2N 1LT1A 2ZAEB 3CD6P 5GTIE 2AEFA 2P7JA 4R4LA 1L0NJ 3O8ZA 2Y0DA 1J1EB 3P8CE 3MUDA 1J2JB 1M8OB 1KB9D 3AEAC 2A45G 3MGNA 1QX8A 3GHGC 1RH5B 2QEXP 2PRRA 4PV1C 1BE3G 1FDIA 2K9JB 1ZN5A 2FXOA 1A02F 1IK7A 2HPCB 1JTHA 3R4YA 3HTKB 1GD2E 3C8VA 2NZ2A 3FWLA 3JSVC 2JJLA 1GL2B 3P8CD 4RKUJ 3M0AA 2GUSA 2FFDC 1FS0E 2POHA 3SSUA 3U59A 2L5GB 1SQPK 2ZVOB 3L73E 1NTMG 1IO4A 2WSEJ 3S4RA 3GF7A 1ZV8A 3HD7A 1LTJA 3RK3E 4N78E 1NU1K 4H0LC 4WY4A 2Q3EA 2YKPA 1LTSC 1SQPE 3CPWO 2ITAA 1RF1A 3W67A 1YJ9P 1K8AQ 1N73A 3L73D 4KHXA 3L35A 3TF5A 3L71E 5B5EE 3CMAP 3KZIH 3RK3D 3B5ND 4N78D 1KQFB 1RQUA 4RJTA 5AVUB 3L75E 4D6TJ 1BGYJ 1G2CA 3M9QA 3H1LJ 2JEEA 4JQ0D 3A3YB 2QG4A 1SQPD 1SQXE 1EDJA 3IR9A 4LC1A 2E5TA 3BATA 3HE4A 5CCHA 4H44B 2KI7B 2WSEH 2W6AA 3M9HA 1WT6A 2FYZA 1KFMA 4BXLA 3L71D 2LXCB 1YITP 1JY3O 1CI6A 1M1KQ 2Q9IA 2GA1A 2YMKA 3PHLA 1X79B 4H13D 1L4AB 1VQKP 3L75D 1BE3J 3D6YA 2WSCH 1PGOA 4ASVA 3L72G 4RO0A 2BCCE 4GDOA 2WPVB 3L74E 1SQXD 3UIAA 1KYOI 2OYIA 1SFCD 1OVVA 1SQQG 4KJMA 1HJBA 3S9OA 3T97A 2XZRA 1N7SA 2Z4EA 5AVVB 5CCGD 3WMM0 1OVRA 2O3JA 1NTMJ 3ZDMA 1NGMB 2BCCD 1NTKK 1FZCB 2HG5D 3L74D 1R5SA 1GMJA 5APXA 2D2CB 3VYIA 3D71A 3CC7P 2AXTH 3AEDC 2A45H 1JY3P 3I5CA 2GUVA 1SVFA 4JF7A 1KILB 1MFZA 1KYOE 1H0TB 4JBZA 2I1KA 3IF4A 1GZLA 2A06E 1NTKE 1KD1Q 1VF5C 1YI2P 2QIWA 4IL6E 3SWYA 4B86A 1OMIA 2FXPA 3OA7A 1AQTA 2YIUB 1JY2O 2N1TD 3BCCG 3CWBG 3V4WA 3A0BH 1KC8Q 4GOFA 1BDDA 3H1IE 4K3AA 4WB4A 1KYOD 1NVOA 3W68A 3U1CA 2A06D 2O01N 1NTKD 2QJYB 1S3JA 1CZQA 1LT9B 1L0LG 3VP9A 3CX5H 1ZMEC 4IL6X 4OWFA 2IYPA 1G1IA 1SQVJ 3KPEA 4TLFA 3H32A 2KIKA 3H1HG 2QSIA 3CCMP 1PPJE 2KYVA 4IOIH 5KTBA 2SPZA 3L72J 1RE4A 3AE8C 1OW6A 3H1ID 1RY3A 2N9BA 2WPQA 1X8YA 1FAVA 3WUVA 5TISE 3C9IA 2ZXXA 1RF0A 5C39A 4PV1B 2Z5HA 1NHLA 5E79H 1SQQJ 2HLOA 1BCCE 1M1JC 1IJDB 1S1CX 2JP3A 2YKQA 4RESB
chains in the Genus database with same CATH topology
2YMYA 3KDPB 2OYHC 3BRTB 2R32A 2WZ7A 3HRNA 1FDMA 1RF0C 1JY2P 1T2KD 1URQC 3VP8A 3L36A 2ZXEB 2IFMA 2WWWA 1LT9C 3HD7D 4Y99B 1JO5A 2P1JA 1JTHB 3VN0A 1JY2N 4AUWA 1LTAC 1GL2D 5KLVK 1OXZA 1LTIC 2HYNA 2NPSB 3RL0B 4XE5B 3HUSA 2FFDB 3GHGA 2P7JA 4WY4D 1GW4A 1CI6B 1GDTA 3O8ZA 5APTA 3LIDA 1FZCA 1J1DC 3A7OA 3RK2C 1HVVA 3M9BA 1J1EB 1FOSF 1FU1A 3P8CE 1MUUA 1KFNA 5APWA 3MUDA 1J2JB 2N1TC 4GIFA 2A45G 3MGNA 3VMXA 2FYUK 3HUSC 3GHGC 1H8AA 2XU6A 1GK6A 1HH0A 1MV8A 4LLHA 2IFNA 1SP4A 1ZN5A 2W6BA 1A02F 2H7HA 2HPCB 3HE5B 1JTHA 3VMZA 3SWFA 3OJAB 4WBAA 3HTKB 2NPSA 2M8RA 1GD2E 4IFDK 4OH8B 1IFJA 4GT1A 3U1AA 3NMDA 1X9VA 2FFDA 1NTMK 1NKNA 2WPRA 1G1JA 2JJLA 1GL2B 1H88A 4O9BA 2KB7P 3P8CD 5AVWB 5AW5B 4WY4B 2WT7B 3PP5A 4Y99C 2IX7C 3M0AA 3RK3B 2ZFCA 2P67A 2O1KA 5AVQB 1NH4A 2YKOA 2NPSC 5CCHD 1JOCA 3TK1A 2GUSA 2FFDC 2KP8A 2POHA 5APSA 3RL0D 1FZEA 3U59A 2L5GB 1RF1B 5CMZA 4EIJA 2P2UA 1SQPK 3LW5H 4JYCA 4RESB 1N73B 1J1EC 4XA4A 1IO4A 2C9LY 2HPCA 2R3CA 2A45I 2QM8A 3HTKA 1ZV8A 1SLQA 1AQ5A 3P7KA 3HD7A 1LTJA 1HBWA 4N78E 2MJZA 1DEBA 1NU1K 2XDJA 2YNYA 1GL2A 4W7YA 4W7ZA 1LWUB 5APQA 2H43A 3IFMA 4WY4A 1OWAA 2WT7A 1G2CB 2Z5IA 2W27A 1GW3A 4I6MC 5AW3B 1E5WA 1T2KC 2YKPA 1FJPA 1LTSC 5AVRB 2C9NY 3VOPA 3HD7C 1LTJC 5CJ0A 1RF1A 3M0DA 3OAKA 1RE3A 1A02J 1N73A 2N1TA 1GL2C 3HE4B 4N6JA 1YYCA 4KHXA 1N7SD 3L35A 4WY4C 3CI9A 1NWQA 2HFED 1NO4A 2J59M 1L4AD 3MIWA 3RK3D 4ZKPA 5AW0B 1SFCB 3B5ND 4GKGA 4N78D 2E42A 1YTZI 5APUA 1RF1C 1W2EA 1LWUA 3M0DC 1GK4A 1RE3C 5AVUB 1N73C 4EOTA 2CPSA 3VTPC 1ZLLA 5APYA 3EFGA 1G2CA 3M9QA 3TYYA 1EQ7A 1QL2A 2JEEA 1FZBA 1IC2A 3A3YB 4C7NB 3IR9A 1CW5A 1XTGB 4LC1A 1XTCC 1NOHA 2OYIB 3BATA 3H6PA 1KQLA 3HE4A 2BASA 1LWUC 5CCHA 1LTGC 2WSEH 1MZ9A 2W6AA 1T8ZA 1VDFA 3M9HA 1HUCA 1WT6A 3BASA 2FYZA 1KFMA 4W80A 1IFMA 4I1LA 1JY3O 1N7LA 1WRGA 1CI6A 2Q9IA 3NTNA 1N7SB 1SQQK 2OARA 2YO3A 1T3JA 1DH3A 3NFQA 5AW4B 1S9KE 2PAJA 1X79B 1IFNA 1L4AB 5AW7B 5AW6B 2WSFH 3B5NB 2WSCH 2H8PD 3MTUE 5CCHC 3V2PA 3RL0C 1IK9A 2CPBA 4C7NA 3UIAA 4IFFA 3V2RA 3EQ2A 2OYIA 1SFCD 1JUNA 5BVZA 3HE5A 1T3UA 3TNUB 3E1IA 2O01H 1NAFA 2Q3IA 1HJBA 1J1DB 3RK2B 1KILD 1L0NK 2C0WA 3G3ZA 3T97A 4DOJA 2R5DA 2XZRA 2M3BA 3M91A 2YO2A 1N7SA 5BU8B 2HODA 2Z4EA 1S9KD 2OYIC 1L4AA 1YTZT 3B5NA 1NKZB 1GU4A 5AVVB 1JNMA 5CCGD 3GHGB 3L4FA 3WMM0 4AQRD 3II6A 3V5BA 5AVTB 5KJ7D 1NTKK 1FZCB 3BVHA 3V4QA 3TSIA 2HG5D 1SQXK 1JCCA 1N7SC 5APXA 2E43A 1FZGA 1LTTC 2IPPA 1SQBK 2PP6A 3TNUA 1DX7A 3LIEA 3CLQA 5AVZB 1L4AC 3VYIA 3M06A 3RK3C 3B5NC 2FXMA 3A5TA 1Z56A 2WPSA 1IFIA 2LKMA 4DZOA 2A45H 3CL3D 1JY3P 1URQD 3I5CA 2GUVA 1SVFA 3MD0A 4JF7A 1KILB 1MFZA 1NTZK 2O1JA 2I1KA 1HGZA 1SQVK 1JY3N 1JMMA 1GZLA 1HGVA 1FZFA 4N3YB 1KZUB 5APVA 3SWYA 4B86A 5AW9B 2KLVA 1FJKA 1IFDA 1M7LA 3RK2D 3OA7A 2Q7CA 5AVXB 1H89A 3P8MC 1LTBC 3KQGA 1JY2O 2XV5A 2N1TD 3A2AA 1FBMA 1PFIA 1AFOA 3H32B 1L0LK 4C46A 4M3LA 5AW1B 3V4WA 5AW2B 2C0XA 1M1JB 1SFCA 1N2DC 3KYQA 4JYBA 1FZCC 3R2PA 3N7NA 2OYHB 3BRVB 1N86A 4WB4A 1LGHB 1KILA 1VPCA 3U1CA 4I2LC 3HD7B 1HTLC 1LTJB 1URQB 1CZQA 4HH2A 1CSBA 1QL1A 4HYTB 1LT9B 4LGDE 4AYCA 1SFCC 2VRSA 3N4XA 2WTYA 5CCGA 3VP9A 1GTWA 2FKWB 1JCDA 2HODB 3P32A 2I1JA 5KJ7A 1G1IA 3KPEA 3NXSA 1KILC 3H32A 5BU5A 1FOSE 2XKMA 5AW8B 4ZKUA 2KYVA 1M1JA 2NPSD 5KTBA 2GM4A 3V2NA 1RE4A 2N1TB 3VMYA 1HWTC 3L37A 1RY3A 2Q5UA 2N9BA 3V2QA 1ZR2A 2WPQA 4C7RA 2WITA 2OYHA 5CCGC 5AVYB 3B8EB 1X8YA 3HUSB 1FAVA 5KJ7C 3C9IA 4IFMA 1RF0A 5AVSB 1GU5A 2Z5HA 1NHLA 1URQA 5CHXA 2J58A 2QM7A 2R5BA 2HLOA 1LT9A 1M1JC 1IJDB 5CJ4A 1ZR4A 1RE4C 2KSJA 1FZAA 2XNXA 2YKQA 2KOGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CLQ A;  1SQQ K;  2OAR A;  2J59 M;  2O01 H;  2LKM A;  2WSF H;  1NTK K;  2WSC H;  1L0N K;  2WSE H;  4IFD K;  3G3Z A;  1SQX K;  1NU1 K;  1NTM K;  1NTZ K;  1L0L K;  3M9Q A;  2FYU K;  5KLV K;  1SQP K;  1SQV K;  1SQB K;  3LW5 H; 
#chains in the Genus database with same CATH topology
 5H2F E;  4PD4 H;  2YMY A;  2QE7 H;  1MFT A;  1VQN P;  2WZ7 A;  2BEQ D;  2R44 A;  1JY2 P;  1PPJ D;  1URQ C;  2E76 C;  3PTZ A;  3G71 P;  2IFM A;  3HD7 D;  1JO5 A;  2P1J A;  2V4H A;  3VN0 A;  4AUW A;  5KLV K;  1RHZ B;  2FFD B;  1Y47 A;  4WY4 D;  2E5Y A;  1U7J A;  4PJ0 H;  3A7O A;  1HVV A;  1BCC D;  2KZI A;  3AE7 C;  2IZ0 A;  1S4X A;  1PP9 E;  3CXH I;  3HUS C;  1H8A A;  2XU6 A;  3JC2 2;  4H0L B;  1SP4 A;  2W6B A;  5KLV E;  2H7H A;  3A0H H;  3CCU P;  3HE5 B;  1U57 A;  2M8R A;  4IFD K;  1NKN A;  1EZV I;  2KUB A;  4U3F E;  1NAY A;  3BCC J;  4O9B A;  2FYU G;  1PGQ A;  5AW5 B;  3PH0 A;  2JO1 A;  2QJP C;  3RK3 B;  2P67 A;  5B66 H;  2O1K A;  2Q1K A;  3D70 A;  1PP9 D;  2NPS C;  1YHQ P;  5CCH D;  3TK1 A;  3RL0 D;  1FZE A;  1P84 E;  2K9J A;  3PJS K;  5KLV D;  2C9L Y;  2E74 C;  2HPC A;  3AE2 C;  2RN0 A;  2ZT9 C;  3HTK A;  1L0L J;  4OGQ D;  1KB9 H;  1HBW A;  4L75 A;  2XDJ A;  3CXH E;  4U3F D;  1GL2 A;  2RH0 A;  3H1H J;  4EI2 A;  4I6M C;  1E5W A;  1T2K C;  5AVR B;  3G4S P;  2W8Z A;  3VOP A;  5CJ0 A;  1BGY G;  5GTI H;  1EZV E;  4NPF X;  3M0D A;  2KXP B;  1P84 D;  2N1T A;  3CCE P;  2O01 J;  2Y9Y A;  1YYC A;  1N7S D;  3TGU G;  1NWQ A;  3L70 E;  3G6E P;  2N9Y B;  3MIW A;  1SFC B;  4GKG A;  4L76 A;  3CXH D;  1USE A;  1W2E A;  1GK4 A;  5GTH H;  1RE3 C;  1NYH A;  2QA4 P;  1NJI Q;  3Q5R A;  2CPS A;  1BSH A;  3VTP C;  1ZLL A;  2IBZ I;  1OW8 A;  1VQ7 P;  1HJ0 A;  1ZXG A;  1NU1 J;  1XTG B;  2KS1 B;  1EZV D;  1XTC C;  1NOH A;  1VQ5 P;  4GOE A;  1LWU C;  1VDF A;  3BAS A;  5KAI H;  3Q5S A;  3L70 D;  4I1L A;  3CWB E;  1N7L A;  1WRG A;  1K9M Q;  4ZMD A;  2Q6Q A;  2OAR A;  1T3J A;  2ZYG A;  4DCK A;  3NFQ A;  2KNC A;  4HB1 A;  1IFN A;  5AW7 B;  3AE6 C;  2H8P D;  4GOD A;  1VQM P;  2LR2 A;  1WMK A;  1X0T A;  4IFF A;  3EQ2 A;  2B9B A;  2P10 A;  2O01 H;  3RL0 g;  1VF5 B;  2FYU J;  2G3A A;  1L0N K;  2P58 A;  4EDF A;  3CWB D;  2IBZ E;  2C0W A;  3G3Z A;  2V7Q H;  3AE3 C;  2YO2 A;  3VMA A;  4HJG H;  2WSC J;  3CCJ P;  1L4A A;  5KKZ C;  2G8Y A;  1NKZ B;  1GU4 A;  1EXI A;  1SQX K;  2E43 A;  1LTT C;  4XFJ A;  3LIE A;  3CLQ A;  5AVZ B;  1L0N E;  3RK3 C;  3B5N C;  1Z56 A;  4NPD A;  2IBZ D;  1FC2 C;  2LKM A;  3CCQ P;  1KN7 A;  2B88 A;  3MD0 A;  1HGV A;  4N3Y B;  1EXJ A;  3TGU J;  1SQB G;  1OVU A;  2B87 B;  5APV A;  1IFD A;  3RK2 D;  2IDB A;  3KZI E;  4A7P A;  3KQG A;  3A2A A;  1L0N D;  2M5A B;  4C46 A;  2OTK E;  2C0X A;  1M1J B;  1LJ2 A;  1N2D C;  1NTZ G;  3I56 P;  5TJH A;  1SQV G;  4H13 C;  3R2P A;  1AVY A;  1N86 A;  3FXD A;  1LGH B;  1KIL A;  5KLI C;  4I2L C;  4ASW A;  3HD7 B;  1HTL C;  1LTJ B;  1URQ B;  2AXC A;  2E76 B;  3FXE A;  5M1B A;  1QL1 A;  3AE4 C;  1SFC C;  2VRS A;  1EDK A;  1BSN A;  5KJ7 A;  4OVN F;  3NXS A;  3I55 P;  1USD A;  4NPE A;  5BU5 A;  1LP1 B;  4BWN A;  5AW8 B;  3QWO C;  3AEF C;  3SWK A;  3Q2Y A;  2GM4 A;  3V2N A;  3VMY A;  4K35 A;  1X22 A;  2WIT A;  1YBK A;  5CCG C;  1KTM A;  2M3E A;  3HUS B;  5AVS B;  5CHX A;  2J58 A;  2QM7 A;  5CBN A;  1KQG B;  1LT9 A;  5CJ4 A;  1ZR4 A;  1T6A A;  1FZA A;  2XNX A;  2KOG A;  3KDP B;  2OYH C;  2E75 D;  4L74 A;  3SFE C;  3BRT B;  3H25 A;  1FDM A;  1KYO H;  3LW5 J;  3O6Q B;  3EFF K;  2ZXE B;  2WWW A;  1S5L H;  4D6T E;  1BGY E;  2QJP B;  3AEG C;  1LTA C;  2OGU A;  3H1L E;  1GL2 D;  4IL6 H;  1LTI C;  2NPS B;  2L91 A;  3RL0 B;  3GHG A;  1GW4 A;  1CI6 B;  1L2P A;  5APT A;  3LID A;  1OFC X;  3M9B A;  1FOS F;  1FU1 A;  2E74 B;  1KFN A;  5APW A;  2N1T C;  2ZT9 B;  4GIF A;  1D7M A;  3V6I A;  1GK6 A;  1AA0 A;  1MV8 A;  4LLH A;  2IFN A;  1BE3 E;  4D6T D;  1BGY D;  1SQB J;  3MUD C;  3VMZ A;  2ZVN B;  3H1L D;  4WBA A;  1BDC A;  1IFJ A;  4GT1 A;  2K3R A;  3U1A A;  1X9V A;  2FFD A;  1NTM K;  4KT0 J;  2WPR A;  3GLM A;  2KB7 P;  4HKZ H;  5AVW B;  3S1K A;  1W2B O;  2WT7 B;  4Y99 C;  2IX7 C;  1NTZ J;  3AE5 C;  3WU2 E;  4YXD C;  2ZFC A;  3A0B E;  2W6J H;  1JOC A;  3H1J J;  2MKV A;  3L73 G;  5CMZ A;  3LW5 H;  1W5C E;  1BE3 D;  1FDO A;  1FE6 A;  1NTM E;  3E1R A;  1AQ5 A;  1Y8A A;  2MJZ A;  3G9R A;  3GG2 A;  3CX5 E;  4WVZ A;  2YNY A;  4W7Z A;  1LWU B;  5APQ A;  4I7Z C;  4Y28 J;  2WSF J;  3IFM A;  2B89 A;  1M56 D;  2Z5I A;  2W27 A;  1SQP G;  5AW3 B;  2ZYA A;  1FJP A;  4H44 D;  2C9N Y;  2PFX A;  3HD7 C;  1LTJ C;  3PLN A;  3ABV C;  4N6J A;  4UB8 E;  1VQL P;  3L71 G;  4WY4 C;  1NTM D;  1S72 P;  1NU1 G;  1PV3 A;  1L4A D;  1EC5 A;  1P84 I;  4ZKP A;  1K73 Q;  1N8R Q;  2E42 A;  1R5L A;  2IZ1 A;  3CX5 D;  1YTZ I;  3SFD C;  3L75 G;  1RF1 C;  2K37 A;  1N73 C;  4EOT A;  5APY A;  1EQ7 A;  1IC2 A;  1VQ6 P;  4C7N B;  1SS1 A;  2HR3 A;  5EFW B;  3RBX A;  3H6P A;  5KKZ B;  2BAS A;  3JCU E;  2NRG A;  4W80 A;  1IFM A;  1KIL E;  4UB6 H;  3NTN A;  1SQQ K;  4MN4 C;  2YO3 A;  5AW4 B;  1S9K E;  4WWI A;  1SQV E;  2WSF H;  3B5N B;  3MTU E;  5CCH C;  2BCC G;  3ITK A;  2D2C D;  3L74 G;  3RL0 C;  1IK9 A;  2CPB A;  3L72 E;  3CCV P;  1OIP A;  2KS1 A;  3F89 A;  3V2R A;  1EDL A;  5BVZ A;  1T3U A;  3CXH H;  3FGA D;  3TNU B;  3E1I A;  4OGQ C;  1TU3 F;  1NAF A;  1JB0 J;  2OYO A;  1KOR A;  1J1D B;  3RK2 B;  1SQQ E;  1KIL D;  4DOJ A;  2R5D A;  3WUU A;  1DIP A;  2ZJS E;  2WMM A;  5B66 E;  2HOD A;  1Y9B A;  3AE1 C;  1S9K D;  3L73 J;  1PGP A;  1SQV D;  2OYI C;  2FYN B;  1YTZ T;  4BRY B;  3D6Z A;  1JNM A;  5KAF E;  3II6 A;  3V5B A;  5KJ7 D;  3CC4 P;  1QVF O;  1M57 D;  3L72 D;  4H13 B;  3TSI A;  2AEM A;  1N7S C;  1VQ4 P;  5KLI B;  2PP6 A;  1VQ9 P;  1VQO P;  3A5T A;  2V7Q J;  1SQQ D;  1IFI A;  3H1K G;  1SQP J;  3CCR P;  1Q7Y Q;  1DD4 A;  3TDK A;  2Y0C A;  2A06 G;  1NTK G;  1HGZ A;  1JMM A;  3OW2 O;  1R8E A;  3L71 J;  3CCS P;  2R3S A;  2Y9Z A;  5AW9 B;  2KLV A;  1FJK A;  1HF9 A;  5AVX B;  1H89 A;  1UII A;  3E7K A;  1AFO A;  3L75 J;  2DW3 A;  1L0L K;  5AW2 B;  3BCC E;  5GTH E;  3H1I G;  1SQX J;  3AEB C;  4PV1 D;  2E75 B;  3N7N A;  2OYH B;  1IFP A;  3CC2 P;  5DJU B;  2JWA A;  1K05 A;  3RGU A;  4HH2 A;  4HYT B;  4LGD E;  4AYC A;  2B87 A;  2BEZ F;  5KAI E;  2WTY A;  1Q86 Q;  2FKW B;  1JCD A;  2I1J A;  1L0L E;  1YIJ P;  1PPJ G;  2M5A A;  1FOS E;  1DEE G;  3BCC D;  4QMA A;  1M1J A;  2JDI H;  3USS A;  4YPC A;  2BCC J;  3H1H E;  3WUT A;  4CPG A;  3L74 J;  2N1T B;  1HWT C;  1YQ3 C;  1ZR2 A;  3EWK A;  3B8E B;  3C1L A;  4IFM A;  1YJW P;  2K9Y A;  1BCC G;  1URQ A;  2R5B A;  3GF3 A;  2FBW C;  5B5E H;  1RE4 C;  2H88 C;  4H0L D;  1L0L D;  3HRN A;  1LP1 A;  1RF0 C;  3H1H D;  4Y99 B;  2WSS H;  1OX3 A;  2M0B A;  1JTH B;  1OXZ A;  3F5H A;  2HYN A;  2WQY C;  4XE5 B;  3HUS A;  1AVO A;  1NU1 E;  4DJG A;  1GDT A;  1FZC A;  1J1D C;  3RK2 C;  1MUU A;  2KNC B;  1ZOY C;  2QJK B;  2KK7 A;  3MP7 B;  1PP9 G;  1QEX A;  3H1K J;  2FYN C;  3VMX A;  2OTL P;  2FYU K;  1EDI A;  1NTK J;  1Q2N A;  3O6Q A;  5KLV G;  1HH0 A;  4I7Z B;  3H1J G;  3SWF A;  3OJA B;  1H0T A;  1U7M A;  2NPS A;  4OH8 B;  3NMD A;  4U3F G;  2QVA A;  1NU1 D;  1RQV A;  1G1J A;  1H88 A;  1K04 A;  1S2E A;  4WY4 B;  3PP5 A;  3H1I J;  2FYU E;  2J5U A;  1KV4 A;  2KZJ A;  5AVQ B;  1NH4 A;  2YKO A;  1QVG O;  4DT0 A;  2KP8 A;  5APS A;  1RF1 B;  4EIJ A;  2P2U A;  4JYC A;  1N73 B;  1J1E C;  1KQS O;  4XA4 A;  2R3C A;  2A45 I;  2QM8 A;  1SLQ A;  3P7K A;  1DEB A;  2CK3 H;  1VL2 A;  4W7Y A;  2H43 A;  1OWA A;  1ZRT E;  2WT7 A;  2E75 C;  2FYU D;  1G2C B;  2JKV A;  4Z1M H;  3FWN A;  1GW3 A;  2OTJ P;  1EZV G;  5DJT B;  4L73 A;  2AEJ A;  3Q1M A;  3OAK A;  1RE3 A;  2YXR B;  1A02 J;  4EYY Q;  1GL2 C;  3HE4 B;  1BCC J;  3L70 G;  3CI9 A;  2HFE D;  4YTP C;  3TGU E;  1NO4 A;  2I8D A;  2J59 M;  5AW0 B;  5APU A;  1LWU A;  3M0D C;  3H1K E;  4OGQ B;  1ZRT D;  3EFG A;  2AXT E;  3TYY A;  3CME P;  3PRJ A;  1OW7 A;  1QL2 A;  3CX5 I;  1FZB A;  1S5L E;  1CW5 A;  1VF5 D;  1QLE D;  2W90 A;  2OYI B;  1KQL A;  1LTG C;  1MZ9 A;  2JWD A;  1T8Z A;  1HUC A;  3AEE C;  1Q82 Q;  3TGU D;  1YJN P;  1PP9 J;  2FY8 A;  3T97 B;  3WU2 H;  1N7S B;  1DH3 A;  1IZN B;  1PL5 A;  2PAJ A;  3H1K D;  2KSE A;  5KLV J;  5AW6 B;  1ZP0 C;  3V2P A;  1AJY A;  5K5G B;  4PD4 I;  1DD3 A;  4C7N A;  5TIS H;  1S5L X;  3IN6 A;  4U3F J;  1JUN A;  3HE5 A;  3GMA A;  2QJK C;  1UIX A;  2IBZ G;  2Q3I A;  1Q90 D;  5H2F H;  3B4S A;  2M3B A;  3M91 A;  5BU8 B;  1PGJ A;  3B5N A;  2ZYD A;  3GHG B;  3L4F A;  4H44 C;  4AQR D;  4UB8 H;  5AVT B;  3BVH A;  3KHU A;  3V4Q A;  2IYO A;  1JCC A;  1JM0 A;  1FZG A;  1L0N G;  1OZH A;  2IPP A;  1SQB K;  3TNU A;  1DX7 A;  2RKL A;  1L4A C;  5E79 E;  2UWJ E;  3M06 A;  2KLU A;  2FXM A;  4U7J A;  2WPS A;  5L8R J;  4DZO A;  1LNQ A;  4PD4 E;  3CL3 D;  1URQ D;  1AV1 A;  2E76 D;  2RMZ A;  5CBO A;  1PZQ A;  3MZW B;  1NTZ K;  2O1J A;  2H89 C;  4BRY A;  3Q5P A;  2Y0E A;  1JY3 N;  1SQV K;  2QRX A;  1SQX G;  4ZNC A;  1FZF A;  1KZU B;  3L70 J;  3K5B A;  3AE9 C;  3JCU H;  1SQB E;  1M7L A;  1KMI Z;  1PIX A;  3FX0 A;  2Q7C A;  3B71 A;  2K88 A;  2OQQ A;  3P8M C;  1LTB C;  4PJ0 E;  1JEK A;  2XV5 A;  1PFI A;  1FBM A;  3H32 B;  4M3L A;  5AW1 B;  2K1A A;  1SFC A;  3KYQ A;  3IAO A;  4JYB A;  1KB9 I;  1FZC C;  4PD4 D;  1NTZ E;  2XND H;  3BRV B;  2D2C C;  1VPC A;  1P84 H;  3H1J E;  3MHV A;  4YXW H;  4TT3 H;  1CSB A;  3A0H E;  3CWB J;  1ZW0 A;  3N4X A;  1SQB D;  5CCG A;  1GTW A;  2HOD B;  3P32 A;  4UB6 E;  1YQ4 C;  4R4M A;  2JR8 A;  1VQP P;  1KIL C;  1QGK B;  1MKM A;  2XKM A;  2WVR A;  1Q81 Q;  4ZKU A;  2NPS D;  5KAF H;  3AEC C;  3L37 A;  1NTZ D;  2Q5U A;  3V2Q A;  4C7R A;  2OYH A;  5AVY B;  3QH9 A;  2E74 D;  5KJ7 C;  2YIU C;  3H1J D;  2ZT9 D;  1GU5 A;  3Q3D A;  2YXQ B;  2LXB A;  2KSJ A;  3CCL P;  1KB9 E;  1VQ8 P;  3KXD A;  3RBZ A;  1E79 H;  2R32 A;  1M90 Q;  3GW6 A;  2PGD A;  2QJY C;  2W83 C;  1T2K D;  4D6T G;  4JPZ B;  3VP8 A;  3L36 A;  1JMB A;  1LT9 C;  3H1L G;  1JY2 N;  1LT1 A;  2ZAE B;  3CD6 P;  5GTI E;  2AEF A;  2P7J A;  4R4L A;  1L0N J;  3O8Z A;  2Y0D A;  1J1E B;  3P8C E;  3MUD A;  1J2J B;  1M8O B;  1KB9 D;  3AEA C;  2A45 G;  3MGN A;  1QX8 A;  3GHG C;  1RH5 B;  2QEX P;  2PRR A;  4PV1 C;  1BE3 G;  1FDI A;  2K9J B;  1ZN5 A;  2FXO A;  1A02 F;  1IK7 A;  2HPC B;  1JTH A;  3R4Y A;  3HTK B;  1GD2 E;  3C8V A;  2NZ2 A;  3FWL A;  3JSV C;  2JJL A;  1GL2 B;  3P8C D;  4RKU J;  3M0A A;  2GUS A;  2FFD C;  1FS0 E;  2POH A;  3SSU A;  3U59 A;  2L5G B;  1SQP K;  2ZVO B;  3L73 E;  1NTM G;  1IO4 A;  2WSE J;  3S4R A;  3GF7 A;  1ZV8 A;  3HD7 A;  1LTJ A;  3RK3 E;  4N78 E;  1NU1 K;  4H0L C;  4WY4 A;  2Q3E A;  2YKP A;  1LTS C;  1SQP E;  3CPW O;  2ITA A;  1RF1 A;  3W67 A;  1YJ9 P;  1K8A Q;  1N73 A;  3L73 D;  4KHX A;  3L35 A;  3TF5 A;  3L71 E;  5B5E E;  3CMA P;  3KZI H;  3RK3 D;  3B5N D;  4N78 D;  1KQF B;  1RQU A;  4RJT A;  5AVU B;  3L75 E;  4D6T J;  1BGY J;  1G2C A;  3M9Q A;  3H1L J;  2JEE A;  4JQ0 D;  3A3Y B;  2QG4 A;  1SQP D;  1SQX E;  1EDJ A;  3IR9 A;  4LC1 A;  2E5T A;  3BAT A;  3HE4 A;  5CCH A;  4H44 B;  2KI7 B;  2WSE H;  2W6A A;  3M9H A;  1WT6 A;  2FYZ A;  1KFM A;  4BXL A;  3L71 D;  2LXC B;  1YIT P;  1JY3 O;  1CI6 A;  1M1K Q;  2Q9I A;  2GA1 A;  2YMK A;  3PHL A;  1X79 B;  4H13 D;  1L4A B;  1VQK P;  3L75 D;  1BE3 J;  3D6Y A;  2WSC H;  1PGO A;  4ASV A;  3L72 G;  4RO0 A;  2BCC E;  4GDO A;  2WPV B;  3L74 E;  1SQX D;  3UIA A;  1KYO I;  2OYI A;  1SFC D;  1OVV A;  1SQQ G;  4KJM A;  1HJB A;  3S9O A;  3T97 A;  2XZR A;  1N7S A;  2Z4E A;  5AVV B;  5CCG D;  3WMM 0;  1OVR A;  2O3J A;  1NTM J;  3ZDM A;  1NGM B;  2BCC D;  1NTK K;  1FZC B;  2HG5 D;  3L74 D;  1R5S A;  1GMJ A;  5APX A;  2D2C B;  3VYI A;  3D71 A;  3CC7 P;  2AXT H;  3AED C;  2A45 H;  1JY3 P;  3I5C A;  2GUV A;  1SVF A;  4JF7 A;  1KIL B;  1MFZ A;  1KYO E;  1H0T B;  4JBZ A;  2I1K A;  3IF4 A;  1GZL A;  2A06 E;  1NTK E;  1KD1 Q;  1VF5 C;  1YI2 P;  2QIW A;  4IL6 E;  3SWY A;  4B86 A;  1OMI A;  2FXP A;  3OA7 A;  1AQT A;  2YIU B;  1JY2 O;  2N1T D;  3BCC G;  3CWB G;  3V4W A;  3A0B H;  1KC8 Q;  4GOF A;  1BDD A;  3H1I E;  4K3A A;  4WB4 A;  1KYO D;  1NVO A;  3W68 A;  3U1C A;  2A06 D;  2O01 N;  1NTK D;  2QJY B;  1S3J A;  1CZQ A;  1LT9 B;  1L0L G;  3VP9 A;  3CX5 H;  1ZME C;  4IL6 X;  4OWF A;  2IYP A;  1G1I A;  1SQV J;  3KPE A;  4TLF A;  3H32 A;  2KIK A;  3H1H G;  2QSI A;  3CCM P;  1PPJ E;  2KYV A;  4IOI H;  5KTB A;  2SPZ A;  3L72 J;  1RE4 A;  3AE8 C;  1OW6 A;  3H1I D;  1RY3 A;  2N9B A;  2WPQ A;  1X8Y A;  1FAV A;  3WUV A;  5TIS E;  3C9I A;  2ZXX A;  1RF0 A;  5C39 A;  4PV1 B;  2Z5H A;  1NHL A;  5E79 H;  1SQQ J;  2HLO A;  1BCC E;  1M1J C;  1IJD B;  1S1C X;  2JP3 A;  2YKQ A;  4RES B; 
#chains in the Genus database with same CATH homology
 2YMY A;  3KDP B;  2OYH C;  3BRT B;  2R32 A;  2WZ7 A;  3HRN A;  1FDM A;  1RF0 C;  1JY2 P;  1T2K D;  1URQ C;  3VP8 A;  3L36 A;  2ZXE B;  2IFM A;  2WWW A;  1LT9 C;  3HD7 D;  4Y99 B;  1JO5 A;  2P1J A;  1JTH B;  3VN0 A;  1JY2 N;  4AUW A;  1LTA C;  1GL2 D;  5KLV K;  1OXZ A;  1LTI C;  2HYN A;  2NPS B;  3RL0 B;  4XE5 B;  3HUS A;  2FFD B;  3GHG A;  2P7J A;  4WY4 D;  1GW4 A;  1CI6 B;  1GDT A;  3O8Z A;  5APT A;  3LID A;  1FZC A;  1J1D C;  3A7O A;  3RK2 C;  1HVV A;  3M9B A;  1J1E B;  1FOS F;  1FU1 A;  3P8C E;  1MUU A;  1KFN A;  5APW A;  3MUD A;  1J2J B;  2N1T C;  4GIF A;  2A45 G;  3MGN A;  3VMX A;  2FYU K;  3HUS C;  3GHG C;  1H8A A;  2XU6 A;  1GK6 A;  1HH0 A;  1MV8 A;  4LLH A;  2IFN A;  1SP4 A;  1ZN5 A;  2W6B A;  1A02 F;  2H7H A;  2HPC B;  3HE5 B;  1JTH A;  3VMZ A;  3SWF A;  3OJA B;  4WBA A;  3HTK B;  2NPS A;  2M8R A;  1GD2 E;  4IFD K;  4OH8 B;  1IFJ A;  4GT1 A;  3U1A A;  3NMD A;  1X9V A;  2FFD A;  1NTM K;  1NKN A;  2WPR A;  1G1J A;  2JJL A;  1GL2 B;  1H88 A;  4O9B A;  2KB7 P;  3P8C D;  5AVW B;  5AW5 B;  4WY4 B;  2WT7 B;  3PP5 A;  4Y99 C;  2IX7 C;  3M0A A;  3RK3 B;  2ZFC A;  2P67 A;  2O1K A;  5AVQ B;  1NH4 A;  2YKO A;  2NPS C;  5CCH D;  1JOC A;  3TK1 A;  2GUS A;  2FFD C;  2KP8 A;  2POH A;  5APS A;  3RL0 D;  1FZE A;  3U59 A;  2L5G B;  1RF1 B;  5CMZ A;  4EIJ A;  2P2U A;  1SQP K;  3LW5 H;  4JYC A;  4RES B;  1N73 B;  1J1E C;  4XA4 A;  1IO4 A;  2C9L Y;  2HPC A;  2R3C A;  2A45 I;  2QM8 A;  3HTK A;  1ZV8 A;  1SLQ A;  1AQ5 A;  3P7K A;  3HD7 A;  1LTJ A;  1HBW A;  4N78 E;  2MJZ A;  1DEB A;  1NU1 K;  2XDJ A;  2YNY A;  1GL2 A;  4W7Y A;  4W7Z A;  1LWU B;  5APQ A;  2H43 A;  3IFM A;  4WY4 A;  1OWA A;  2WT7 A;  1G2C B;  2Z5I A;  2W27 A;  1GW3 A;  4I6M C;  5AW3 B;  1E5W A;  1T2K C;  2YKP A;  1FJP A;  1LTS C;  5AVR B;  2C9N Y;  3VOP A;  3HD7 C;  1LTJ C;  5CJ0 A;  1RF1 A;  3M0D A;  3OAK A;  1RE3 A;  1A02 J;  1N73 A;  2N1T A;  1GL2 C;  3HE4 B;  4N6J A;  1YYC A;  4KHX A;  1N7S D;  3L35 A;  4WY4 C;  3CI9 A;  1NWQ A;  2HFE D;  1NO4 A;  2J59 M;  1L4A D;  3MIW A;  3RK3 D;  4ZKP A;  5AW0 B;  1SFC B;  3B5N D;  4GKG A;  4N78 D;  2E42 A;  1YTZ I;  5APU A;  1RF1 C;  1W2E A;  1LWU A;  3M0D C;  1GK4 A;  1RE3 C;  5AVU B;  1N73 C;  4EOT A;  2CPS A;  3VTP C;  1ZLL A;  5APY A;  3EFG A;  1G2C A;  3M9Q A;  3TYY A;  1EQ7 A;  1QL2 A;  2JEE A;  1FZB A;  1IC2 A;  3A3Y B;  4C7N B;  3IR9 A;  1CW5 A;  1XTG B;  4LC1 A;  1XTC C;  1NOH A;  2OYI B;  3BAT A;  3H6P A;  1KQL A;  3HE4 A;  2BAS A;  1LWU C;  5CCH A;  1LTG C;  2WSE H;  1MZ9 A;  2W6A A;  1T8Z A;  1VDF A;  3M9H A;  1HUC A;  1WT6 A;  3BAS A;  2FYZ A;  1KFM A;  4W80 A;  1IFM A;  4I1L A;  1JY3 O;  1N7L A;  1WRG A;  1CI6 A;  2Q9I A;  3NTN A;  1N7S B;  1SQQ K;  2OAR A;  2YO3 A;  1T3J A;  1DH3 A;  3NFQ A;  5AW4 B;  1S9K E;  2PAJ A;  1X79 B;  1IFN A;  1L4A B;  5AW7 B;  5AW6 B;  2WSF H;  3B5N B;  2WSC H;  2H8P D;  3MTU E;  5CCH C;  3V2P A;  3RL0 C;  1IK9 A;  2CPB A;  4C7N A;  3UIA A;  4IFF A;  3V2R A;  3EQ2 A;  2OYI A;  1SFC D;  1JUN A;  5BVZ A;  3HE5 A;  1T3U A;  3TNU B;  3E1I A;  2O01 H;  1NAF A;  2Q3I A;  1HJB A;  1J1D B;  3RK2 B;  1KIL D;  1L0N K;  2C0W A;  3G3Z A;  3T97 A;  4DOJ A;  2R5D A;  2XZR A;  2M3B A;  3M91 A;  2YO2 A;  1N7S A;  5BU8 B;  2HOD A;  2Z4E A;  1S9K D;  2OYI C;  1L4A A;  1YTZ T;  3B5N A;  1NKZ B;  1GU4 A;  5AVV B;  1JNM A;  5CCG D;  3GHG B;  3L4F A;  3WMM 0;  4AQR D;  3II6 A;  3V5B A;  5AVT B;  5KJ7 D;  1NTK K;  1FZC B;  3BVH A;  3V4Q A;  3TSI A;  2HG5 D;  1SQX K;  1JCC A;  1N7S C;  5APX A;  2E43 A;  1FZG A;  1LTT C;  2IPP A;  1SQB K;  2PP6 A;  3TNU A;  1DX7 A;  3LIE A;  3CLQ A;  5AVZ B;  1L4A C;  3VYI A;  3M06 A;  3RK3 C;  3B5N C;  2FXM A;  3A5T A;  1Z56 A;  2WPS A;  1IFI A;  2LKM A;  4DZO A;  2A45 H;  3CL3 D;  1JY3 P;  1URQ D;  3I5C A;  2GUV A;  1SVF A;  3MD0 A;  4JF7 A;  1KIL B;  1MFZ A;  1NTZ K;  2O1J A;  2I1K A;  1HGZ A;  1SQV K;  1JY3 N;  1JMM A;  1GZL A;  1HGV A;  1FZF A;  4N3Y B;  1KZU B;  5APV A;  3SWY A;  4B86 A;  5AW9 B;  2KLV A;  1FJK A;  1IFD A;  1M7L A;  3RK2 D;  3OA7 A;  2Q7C A;  5AVX B;  1H89 A;  3P8M C;  1LTB C;  3KQG A;  1JY2 O;  2XV5 A;  2N1T D;  3A2A A;  1FBM A;  1PFI A;  1AFO A;  3H32 B;  1L0L K;  4C46 A;  4M3L A;  5AW1 B;  3V4W A;  5AW2 B;  2C0X A;  1M1J B;  1SFC A;  1N2D C;  3KYQ A;  4JYB A;  1FZC C;  3R2P A;  3N7N A;  2OYH B;  3BRV B;  1N86 A;  4WB4 A;  1LGH B;  1KIL A;  1VPC A;  3U1C A;  4I2L C;  3HD7 B;  1HTL C;  1LTJ B;  1URQ B;  1CZQ A;  4HH2 A;  1CSB A;  1QL1 A;  4HYT B;  1LT9 B;  4LGD E;  4AYC A;  1SFC C;  2VRS A;  3N4X A;  2WTY A;  5CCG A;  3VP9 A;  1GTW A;  2FKW B;  1JCD A;  2HOD B;  3P32 A;  2I1J A;  5KJ7 A;  1G1I A;  3KPE A;  3NXS A;  1KIL C;  3H32 A;  5BU5 A;  1FOS E;  2XKM A;  5AW8 B;  4ZKU A;  2KYV A;  1M1J A;  2NPS D;  5KTB A;  2GM4 A;  3V2N A;  1RE4 A;  2N1T B;  3VMY A;  1HWT C;  3L37 A;  1RY3 A;  2Q5U A;  2N9B A;  3V2Q A;  1ZR2 A;  2WPQ A;  4C7R A;  2WIT A;  2OYH A;  5CCG C;  5AVY B;  3B8E B;  1X8Y A;  3HUS B;  1FAV A;  5KJ7 C;  3C9I A;  4IFM A;  1RF0 A;  5AVS B;  1GU5 A;  2Z5H A;  1NHL A;  1URQ A;  5CHX A;  2J58 A;  2QM7 A;  2R5B A;  2HLO A;  1LT9 A;  1M1J C;  1IJD B;  5CJ4 A;  1ZR4 A;  1RE4 C;  2KSJ A;  1FZA A;  2XNX A;  2YKQ A;  2KOG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...