1SQVK

Crystal structure analysis of bovine bc1 with uhdbt
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
51
structure length
51
Chain Sequence
b'MLTRFLGPRYRQLARNWVPTASLWGAVGAVGLVWATDWRLILDWVPYINGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome c reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 14
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF08997 UCR_6-4kD Ubiquinol-cytochrome C reductase complex, 6.4kD protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1sqvK00
2OARA 1SQQK 1NTKK 2WSEH 1NU1K 2WSCH 3M9QA 2FYUK 5KLVK 1SQVK 2LKMA 1SQBK 2O01H 1L0LK 2J59M 1SQPK 1NTMK 3CLQA 1NTZK 2WSFH 1L0NK 3LW5H 1SQXK 3G3ZA 4IFDK
chains in the Genus database with same CATH superfamily
4EDFA 2YKQA 2K9YA 2C9LY 1SQQE 3RK2D 2Y0EA 1ZR2A 2FXPA 4H0LB 3RK3E 1VF5C 3Q3DA 5GTHH 5AVYB 5AW2B 3AECC 4C7RA 3RK3B 3TSIA 4UB6H 2ZYAA 1GL2D 1NO4A 5BVZA 1DX7A 2FKWB 3H1KE 4H13D 4L73A 3I5CA 2W8ZA 5KJ7A 2HG5D 3V2PA 3CMAP 4YXWH 1LWUA 1GDTA 1EDJA 3L74G 2WT7A 5KLVG 1AQ5A 1YYCA 2LR2A 4JYCA 1YITP 2QM8A 3L35A 3FWNA 2WPRA 1GTWA 4U7JA 4YTPC 2CK3H 3B5NC 2FYNB 3A3YB 1PPJG 4C7NA 1FOSF 1Y47A 2KIKA 1J1DB 2IBZD 4I7ZC 3MUDC 3RK2B 2R3SA 1K73Q 5KAIH 1JY3N 2FYUJ 3HD7C 5AW7B 2QJKC 2J59M 1TU3F 2ZJSE 1GL2B 1OW7A 4H13B 3IF4A 1S4XA 5K5GB 3HE5A 3T97B 3GHGC 2N1TC 1KN7A 1VL2A 1RHZB 5AVQB 2B87A 3LIEA 2I1KA 1EZVG 3WUUA 1SQPJ 1IFPA 3LW5H 2QVAA 1GMJA 2OYIA 4PJ0H 1JY3P 2WSEH 3M0DC 4JQ0D 1BE3D 3M9BA 3WMM0 3L73D 1IFDA 3GW6A 4BRYB 2M3EA 1AQTA 3FGAD 5AW5B 1G1JA 5L8RJ 1VQ8P 1NGMB 1IFIA 1RF0A 3UIAA 3IN6A 3H1HJ 1EC5A 4CPGA 3CWBD 4GIFA 2YXRB 1NHLA 1RE4C 4GOEA 4PV1C 1ZMEC 3A5TA 4WB4A 2P7JA 1RH5B 2JKVA 1NJIQ 1T3UA 3HUSB 1BE3E 3L73E 3CCSP 2O1JA 3WU2E 5AVZB 2AXCA 2GUSA 1NVOA 1NTKJ 2JO1A 4XA4A 1SFCC 3A0BH 2ZYDA 3L74J 1BCCD 2HYNA 1NTZD 3D6YA 5KLVJ 1LT1A 1FE6A 1DEBA 3B71A 1NTZK 2IYPA 4IOIH 1AFOA 4IL6H 4N6JA 3TGUG 2JDIH 2G3AA 1EXJA 1KILA 1RQVA 2WMMA 4AQRD 1FZCC 1FZBA 3KYQA 1ZXGA 3CCUP 2R3CA 2WPQA 5AW0B 1P84H 5AW1B 1FJPA 3RGUA 1BGYG 4U3FD 5KAFE 1PL5A 3CX5H 3Q2YA 1IFJA 1KYOH 3FX0A 3CCMP 3F5HA 4M3LA 4EOTA 1OVVA 1R5SA 3HE4A 2JP3A 1URQD 1YBKA 2GA1A 1L4AC 2E76D 3VOPA 5APWA 1X22A 3M06A 5E79H 1S5LH 3AE6C 3GF7A 4JPZB 3V6IA 3BRVB 4OWFA 1AA0A 1USDA 2KZIA 2R44A 2Y9ZA 1T6AA 1VF5D 1LTIC 1YHQP 3V4WA 3PLNA 3E1RA 4U3FE 1OZHA 1A02F 2M0BA 4LGDE 2Q3IA 2Q7CA 3RL0C 1JOCA 1YI2P 3MD0A 5KJ7C 1MZ9A 2R32A 4BWNA 1QGKB 1X0TA 1JTHB 1LWUC 3Q1MA 1HJBA 4KT0J 2H88C 4Z1MH 1YIJP 3BCCG 2BEZF 4D6TE 1CW5A 1AVYA 3PH0A 5BU5A 1N7SA 1URQB 3CC7P 1E5WA 2IPPA 4WVZA 2E76B 2HODA 1OW6A 5GTIH 1SQQG 3B5ND 4I2LC 1LTTC 3AE2C 1OFCX 2FXOA 1VQ5P 3CPWO 1P84I 4EI2A 2HPCB 2E42A 1NOHA 1NU1D 1GW4A 4WY4A 2PFXA 1HUCA 1NU1K 4LLHA 1VF5B 3CX5I 1KORA 5TISH 3HD7D 1KYOI 1IO4A 2WITA 1SQVK 3H1KG 5APTA 1SQBK 3E1IA 2FFDA 3L70D 3TGUJ 3VMAA 3A0HH 1W2EA 4RO0A 2N9BA 2N1TD 1M8OB 3ITKA 1AV1A 1L0LD 2WSSH 1RF1A 3QH9A 1L0LK 2OYIC 3L71D 2K1AA 5CCGA 1FAVA 1NTME 3V5BA 1L0NE 4TLFA 1R8EA 1BGYJ 3H32B 1KB9H 3U1CA 1X79B 1M1JB 1Y8AA 1ZR4A 3B5NB 2RH0A 3MGNA 1YQ4C 3E7KA 2QJYB 1FJKA 1HGZA 2KB7P 2E74C 2Q5UA 1RF0C 2A06E 2CPBA 2WPSA 2KOGA 3HD7B 3L75E 3C1LA 2SPZA 2QJKB 5APVA 1JEKA 2AEJA 3GF3A 1J1EC 2DW3A 1CI6B 3SFDC 3GHGB 1JO5A 1JCCA 2N1TB 4N78D 2HR3A 4GODA 4PD4D 3L71E 3C9IA 5AW4B 2L5GB 4DJGA 1L2PA 5APUA 2IFMA 1OW8A 1EDKA 3N7NA 5B5EH 2XU6A 2KS1B 3CXHE 1SFCD 5KTBA 3H1IG 1JNMA 3BCCJ 2OTJP 3TDKA 3T97A 4GDOA 5AW6B 1GW3A 3H1LG 3D6ZA 1WT6A 1KQSO 4GOFA 3AE3C 2B89A 1SQQJ 5CJ4A 3USSA 1KILC 1SQXG 4N78E 4PD4E 1PZQA 2YXQB 1KB9I 2G8YA 4HJGH 1LTJA 3MIWA 2LXCB 1BE3G 4NPEA 1P84D 3H1KJ 3Q5PA 3CCJP 1H0TA 4XE5B 1JB0J 2KNCA 4UB8H 2BCCG 1NTKG 1DIPA 1UIXA 1HH0A 3G3ZA 3QWOC 1N86A 4W80A 1SFCB 1Q7YQ 1LNQA 2E43A 2FYUD 2M5AB 3L4FA 1G2CB 3A7OA 2FYUK 3L72G 2GM4A 1EZVI 1K05A 3PP5A 3K5BA 2HLOA 2E5YA 3CCVP 1PGQA 1SLQA 1MFZA 2AEFA 1VQ7P 1SQPD 3H1JD 1R5LA 1FZCB 2D2CC 2IZ0A 3S9OA 1GK4A 1SQPK 2ZFCA 3U1AA 4IFDK 1LP1A 1PGJA 2KZJA 5CMZA 3RL0D 2KUBA 2NZ2A 2P1JA 3H6PA 1AVOA 5B66H 4IFFA 4OVNF 1N7SC 3V2QA 1D7MA 3H1HD 3W67A 2P58A 3TNUA 2QJPC 1OX3A 2KLUA 2IBZE 2KYVA 3W68A 1JCDA 5BU8B 2RMZA 1ZP0C 2OYOA 5H2FE 3KHUA 4WY4C 1IZNB 1SQPE 3H1JE 5AVSB 3M91A 3HTKA 1ZOYC 5AVVB 3H1IJ 4RESB 1LGHB 1JY2N 3AE1C 3H1LJ 2E75C 2POHA 4C46A 2FXMA 3V2NA 2FFDC 2WQYC 2L91A 5APSA 1SQXJ 1N73A 2P10A 3L74D 1BSHA 3VN0A 1DEEG 2W6AA 1LWUB 2W6BA 4D6TG 1RF1C 3MP7B 1S1CX 1BE3J 3JCUH 3KZIE 5KLVK 5CCGC 2AXTE 1HTLC 2M8RA 1YJNP 1JY2P 1KB9D 2QA4P 2WSFJ 1PPJD 3NTNA 4ASWA 2BCCJ 2PRRA 3M0AA 3SWFA 2OGUA 1KD1Q 2YIUC 2XNXA 4H44C 2E74D 3AE9C 1PV3A 1JTHA 3L72J 3KXDA 3SFEC 3PTZA 2H89C 3CWBE 2B9BA 1LTGC 1FOSE 2IYOA 3HE5B 4K3AA 3CCLP 3G71P 1FZEA 1QL2A 1EZVD 2B87B 2K3RA 3MZWB 2P67A 2P2UA 1J1DC 3Q5SA 1NTMG 3CCQP 3D71A 2Y0DA 1L0NG 2H43A 1PPJE 2KLVA 3O6QA 4KJMA 2O1KA 4NPFX 2I1JA 1EQ7A 2LXBA 2J5UA 2ITAA 3Q5RA 1XTGB 1BCCE 2OYHA 1NTZE 1IC2A 1IK7A 3EQ2A 3FXEA 1MFTA 2W90A 2A06G 2RKLA 1HWTC 2E74B 3L75G 1FZGA 4IFMA 3CC2P 1YTZI 3G9RA 1J1EB 1EZVE 1KILD 3VTPC 3G6EP 3EFFK 2MJZA 1OXZA 1U57A 3H32A 1M1JA 1LTJC 2NPSA 4U3FJ 2JWAA 1VQOP 4Y99C 1PGPA 1PIXA 4RKUJ 1GU5A 1FDOA 1VQLP 3CL3D 1HBWA 3SWKA 1QL1A 3GLMA 1FZFA 4D6TJ 5C39A 4YPCA 4Y28J 4DZOA 2YKOA 1CI6A 1J2JB 1PP9G 4W7YA 3L37A 1YQ3C 1USEA 4K35A 2HFED 5KLIC 2C0WA 4DT0A 3TGUD 1N7LA 1SS1A 3P32A 1YJ9P 2QE7H 2KXPB 1NYHA 1T2KC 1WMKA 5GTHE 1T8ZA 1DD4A 1LTBC 3TK1A 1BSNA 1ZN5A 5AVWB 2N9YB 1QVFO 2I8DA 4L76A 5DJUB 3BATA 3AE5C 1N8RQ 4UB6E 1SQVD 1M7LA 1SQBD 1W2BO 2WWWA 3WU2H 2K9JB 3JC22 1OVUA 2KS1A 1BGYD 1JY3O 1MV8A 1HJ0A 2WPVB 3VMZA 2WSFH 1PGOA 3RBXA 4ZKUA 2W27A 3B4SA 1LT9A 1KZUB 4AYCA 3A2AA 1NTMJ 3C8VA 3CI9A 3HE4B 1L0NJ 4JYBA 1N7SD 1HF9A 4TT3H 1FU1A 1FZAA 1VQ6P 1EDLA 2QM7A 1LJ2A 4IL6X 1NU1E 1VPCA 1VQPP 1VQ4P 1FDIA 4KHXA 4I7ZB 3VP8A 4WY4D 1SQVE 2XNDH 1N2DC 1SQBE 2R5BA 4R4LA 2ZAEB 1ZRTD 3AE4C 5CCHA 1BGYE 2XV5A 3L75J 2IFNA 5KAFH 5DJTB 2E75D 2ZT9C 3L70E 1S72P 1VQNP 1N73C 3NFQA 1L0LE 2Y0CA 5M1BA 1K04A 3VMYA 3CMEP 1G1IA 4PV1D 4OGQC 3L36A 4DCKA 3BCCD 1LTSC 2M3BA 5CCGD 5EFWB 3P8MC 1N7SB 2K37A 2A45G 2IBZG 2ZXXA 2VRSA 2HODB 3S1KA 3NXSA 3GMAA 1SQQK 3AE8C 3SWYA 3H1JG 1S5LX 1ZW0A 1Q90D 1M1KQ 3AEFC 1GL2A 3VP9A 1GD2E 4WY4B 1QVGO 3KQGA 4HB1A 4H44D 3EFGA 4HYTB 4MN4C 1KQLA 1RE3A 3D70A 3H1KD 1PP9J 1Y9BA 3I56P 4LC1A 2E75B 1AJYA 1JMBA 1IK9A 4EYYQ 3S4RA 5TJHA 3P7KA 2WVRA 2FFDB 3U59A 3JSVC 3BCCE 1U7JA 3LIDA 4DOJA 2FBWC 1CZQA 4L75A 4R4MA 2C9NY 4PV1B 3AEBC 1RF1B 3L73G 1Q2NA 5APYA 1X8YA 4BRYA 3CX5D 1FBMA 3A0BE 2OYHC 2XKMA 2YO2A 2OQQA 1KYOD 3IR9A 1W5CE 3PHLA 1H88A 2AEMA 1MKMA 2O01N 3VMXA 2NRGA 2YIUB 4H44B 1EDIA 4IL6E 3ABVC 1L4AD 5AVUB 3CWBG 4YXDC 2Q3EA 3HUSA 1EXIA 4HH2A 1JMMA 4WBAA 3G4SP 2YKPA 3AE7C 1M1JC 1P84E 2NPSC 3AEEC 3SSUA 3FXDA 3CX5E 2QJYC 5KKZC 1U7MA 3O8ZA 4ASVA 3MHVA 1KYOE 1PFIA 1BDDA 1BCCG 2UWJE 2ZVOB 1NTZG 5KJ7D 2PP6A 3KDPB 1NAFA 1FS0E 4JBZA 3TYYA 4WWIA 4XFJA 3H1ID 2FYUE 1T3JA 1M57D 3R4YA 3H1LD 1BDCA 4AUWA 1YJWP 3B8EB 1M56D 1VQMP 5AW9B 1IFMA 1S5LE 1L4AB 5E79E 1GZLA 2Z5HA 1OIPA 3AEDC 1SQXD 1X9VA 4EIJA 1NH4A 1GU4A 3H1JJ 2PGDA 1T2KD 1SQXK 2KK7A 3N4XA 3AEGC 3IAOA 2IZ1A 2V7QJ 4U3FG 1M90Q 2K88A 1NAYA 1LTJB 2GUVA 1ZV8A 5AVTB 4ZKPA 4Y99B 1SP4A 1H0TB 2BCCD 3RL0B 1NTKD 3CXHH 2KNCB 3H1IE 1OMIA 1NTKK 1K8AQ 3H25A 1LT9C 3H1LE 3CCRP 2KP8A 3EWKA 5KLVD 2WT7B 3H1HE 2ZVNB 3L73J 3L72D 2Q1KA 5GTIE 3OA7A 4H0LC 1SQXE 2Z5IA 5KLIB 4PD4H 3RK3C 4C7NB 1Q82Q 5CBOA 2WSCJ 1GK6A 3II6A 5TISE 2PAJA 3BASA 1OWAA 1JUNA 5CCHC 1H8AA 1S2EA 3R2PA 2BCCE 1NTKE 3A0HE 3CWBJ 3F89A 2ZT9D 3OW2O 1KQFB 1LP1B 1SVFA 1QEXA 1VQKP 2H7HA 3L74E 2LKMA 4NPDA 5KLVE 3BVHA 1E79H 1URQA 2FYNC 4OGQD 3L72E 3M9QA 3RK2C 3KPEA 3RBZA 1KB9E 4JF7A 2HPCA 2OYIB 3FWLA 2J58A 1KFNA 3TNUB 1NU1G 1Q81Q 2Q9IA 1BCCJ 1NTZJ 2O01J 1Q86Q 2QSIA 4N3YB 5CHXA 1FDMA 2K9JA 1SQVG 1SQBG 3CCEP 3BRTB 1GL2C 4H13C 3HTKB 1FC2C 2YNYA 1RE3C 3CXHI 3L70G 2XZRA 2ZT9B 2FY8A 1L0LG 1KQGB 4GT1A 3IFMA 1CSBA 1NKZB 1N73B 4I1LA 4D6TD 3L71G 5AVXB 2ZXEB 1H89A 4OGQB 4PD4I 3V2RA 3B5NA 1DH3A 1WRGA 3I55P 2KSEA 2A45H 2YO3A 3MUDA 1OVRA 1ZLLA 5B5EE 1KTMA 2KI7B 5H2FH 1KFMA 4RJTA 2JJLA 5AVRB 3HD7A 2WZ7A 2V7QH 1UIIA 3ZDMA 2C0XA 4HKZH 3GHGA 2N1TA 3CD6P 2Y9YA 3M9HA 5APQA 1KILE 2YMKA 2IDBA 5CJ0A 3PJSK 1RY3A 2QG4A 3HUSC 1IJDB 3RL0g 3TF5A 3V4QA 4ZNCA 1KILB 3NMDA 2JR8A 2BASA 3WUTA 2ZYGA 1XTCC 3KZIH 2AXTH 2BEQD 1NTMD 3M0DA 2NPSD 1S3JA 1L0ND 2QEXP 5AW3B 2D2CD 1S9KD 1NTMK 2JWDA 4UB8E 1L0NK 4B86A 5APXA 1DD3A 3O6QB 2QRXA 1JM0A 2WSCH 4O9BA 2OYHB 5AW8B 2R5DA 1VDFA 2A06D 2CPSA 3L75D 2RN0A 3TGUE 3P8CD 1LTAC 1RE4A 1NU1J 3PRJA 1YTZT 4A7PA 1QX8A 3WUVA 2MKVA 1KMIZ 1SQVJ 4BXLA 1SQBJ 1K9MQ 2A45I 2IBZI 5KAIE 1Z56A 2Z4EA 1HVVA 4ZMDA 4I6MC 1S9KE 2W83C 2NPSB 3L70J 2IX7C 2D2CB 1VQ9P 2B88A 1JY2O 2H8PD 3VYIA 1SFCA 5KKZB 2O01H 5B66E 1L0LJ 2M5AA 2W6JH 3CXHD 3OJAB 1G2CA 2OARA 2FYUG 1KC8Q 3LW5J 4GKGA 3L71J 2V4HA 1NWQA 3MTUE 2YMYA 2WSEJ 1A02J 4PJ0E 4OH8B 3P8CE 1PP9D 2JEEA 4QMAA 1RQUA 3CLQA 4H0LD 1SQQD 2FYZA 2OTKE 2QJPB 1FZCA 2E5TA 3RK3D 1SQPG 3GG2A 4W7ZA 2KSJA 1ZRTE 2XDJA 2Q6QA 3CC4P 4L74A 5CCHD 2QIWA 2O3JA 1MUUA 1HGVA 3OAKA 1IFNA 3HRNA 2WTYA 1KV4A 2OTLP 5CBNA 1URQC 1NKNA 2E76C 3AEAC 1L4AA 3JCUE 1QLED 3H1HG 1LT9B 1PP9E
chains in the Genus database with same CATH topology
3N4XA 1W2EA 2YKQA 1IC2A 2N9BA 3EQ2A 2N1TD 2C9LY 3RK2D 1LTJB 1ZR2A 2GUVA 1ZV8A 5AVTB 1HWTC 1RF1A 4ZKPA 1L0LK 5AVYB 4Y99B 1SP4A 2OYIC 3RL0B 1FZGA 5CCGA 5AW2B 1FAVA 4C7RA 3RK3B 3V5BA 4IFMA 3TSIA 1YTZI 1NTKK 3H32B 1GL2D 1NO4A 5BVZA 3U1CA 1X79B 1DX7A 1J1EB 1KILD 1LT9C 1M1JB 2FKWB 1ZR4A 3VTPC 2KP8A 3I5CA 2MJZA 3B5NB 1OXZA 5KJ7A 2WT7B 2HG5D 3V2PA 3H32A 3MGNA 1M1JA 1LTJC 2NPSA 3OA7A 1LWUA 1GDTA 1FJKA 1HGZA 2KB7P 2WT7A 2Z5IA 2Q5UA 4Y99C 1AQ5A 1YYCA 1RF0C 2CPBA 2WPSA 2KOGA 3HD7B 4JYCA 3RK3C 1GU5A 2QM8A 3L35A 3CL3D 4C7NB 1HBWA 2WPRA 5APVA 1GTWA 1J1EC 3B5NC 1GK6A 1QL1A 3II6A 1CI6B 2PAJA 3A3YB 3BASA 4C7NA 1FZFA 1OWAA 1FOSF 3GHGB 1JO5A 1JCCA 1J1DB 5CCHC 1JUNA 2N1TB 1H8AA 4N78D 3RK2B 3R2PA 4DZOA 2YKOA 1CI6A 3C9IA 1J2JB 4W7YA 5AW4B 3L37A 1SVFA 2L5GB 2HFED 2C0WA 2H7HA 1JY3N 3HD7C 1N7LA 5APUA 2LKMA 5AW7B 3P32A 2IFMA 2J59M 3BVHA 1URQA 3N7NA 1GL2B 1T2KC 1T8ZA 1LTBC 3TK1A 3HE5A 2XU6A 1ZN5A 5AVWB 3GHGC 3BATA 2N1TC 1SFCD 3M9QA 5KTBA 3RK2C 3KPEA 1M7LA 4JF7A 5AVQB 2HPCA 2WWWA 1JNMA 2OYIB 3LIEA 2I1KA 3T97A 2J58A 5AW6B 1GW3A 1JY3O 1KFNA 1MV8A 3TNUB 1WT6A 3VMZA 2Q9IA 2WSFH 3LW5H 2OYHA 2OYIA 4N3YB 5CHXA 1FDMA 5CJ4A 1JY3P 3BRTB 1GL2C 2WSEH 3M0DC 3WMM0 1KILC 3M9BA 4N78E 3HTKB 4ZKUA 2W27A 1LT9A 1IFDA 2YNYA 1RE3C 1KZUB 4AYCA 3A2AA 2XZRA 3CI9A 3HE4B 1LTJA 3MIWA 1N7SD 4JYBA 1FU1A 1FZAA 5AW5B 1G1JA 4GT1A 3IFMA 1CSBA 2QM7A 1IFIA 1RF0A 3UIAA 1NKZB 1N73B 4XE5B 1VPCA 4I1LA 4KHXA 5AVXB 2ZXEB 1H89A 3VP8A 4WY4D 1HH0A 1N2DC 2R5BA 3G3ZA 3B5NA 4GIFA 3V2RA 1DH3A 1N86A 1WRGA 4W80A 1SFCB 1NHLA 1RE4C 5CCHA 3A5TA 2A45H 2XV5A 2E43A 2YO3A 2IFNA 3MUDA 4WB4A 1ZLLA 2P7JA 3L4FA 1G2CB 3A7OA 1KFMA 2FYUK 1T3UA 3HUSB 2JJLA 2GM4A 5AVRB 3PP5A 1N73C 2O1JA 3HD7A 2HLOA 5AVZB 3NFQA 2GUSA 3VMYA 2WZ7A 1G1IA 3L36A 1LTSC 4XA4A 1SLQA 2C0XA 1MFZA 1SFCC 3GHGA 2M3BA 2N1TA 2HYNA 3M9HA 1FZCB 5CCGD 5APQA 3P8MC 1DEBA 1N7SB 5CJ0A 1GK4A 1SQPK 1RY3A 2A45G 1NTZK 2ZFCA 2VRSA 3U1AA 3HUSC 1IJDB 2HODB 4IFDK 3V4QA 3NXSA 5CMZA 3RL0D 1KILB 1SQQK 3NMDA 3SWYA 2BASA 1AFOA 4N6JA 1XTCC 2P1JA 3H6PA 1GL2A 3VP9A 1GD2E 4WY4B 3M0DA 2NPSD 1KILA 5AW3B 3KQGA 3EFGA 1S9KD 4HYTB 1NTMK 1KQLA 1RE3A 1L0NK 4AQRD 4IFFA 1FZCC 4B86A 1FZBA 5APXA 3KYQA 4LC1A 1N7SC 3V2QA 1IK9A 2R3CA 2WPQA 5AW0B 3P7KA 3TNUA 5AW1B 2WSCH 2FFDB 1FJPA 4O9BA 2OYHB 2KYVA 3U59A 1JCDA 5AW8B 5BU8B 2R5DA 1VDFA 4DOJA 3LIDA 1CZQA 2CPSA 2C9NY 1IFJA 4WY4C 5AVSB 3M91A 3HTKA 5AVVB 1RF1B 4RESB 4M3LA 3P8CD 1LGHB 1LTAC 1JY2N 4EOTA 1RE4A 5APYA 1YTZT 1X8YA 3HE4A 1URQD 2POHA 4C46A 2FXMA 3V2NA 1FBMA 1L4AC 2FFDC 2OYHC 2XKMA 2YO2A 2A45I 3VOPA 5APWA 5APSA 3IR9A 1N73A 1Z56A 2Z4EA 1HVVA 3M06A 4I6MC 1S9KE 1H88A 3VN0A 3BRVB 2NPSB 3VMXA 2W6AA 1LWUB 2IX7C 2W6BA 1RF1C 2H8PD 1JY2O 3VYIA 1SFCA 5KLVK 1L4AD 5CCGC 5AVUB 1LTIC 2O01H 1HTLC 3V4WA 2M8RA 3OJAB 1JY2P 1G2CA 1A02F 2OARA 4LGDE 2Q3IA 2Q7CA 3NTNA 3HUSA 4GKGA 3RL0C 1JOCA 3MD0A 4HH2A 1NWQA 3MTUE 5KJ7C 1MZ9A 2R32A 1JMMA 4WBAA 3M0AA 3SWFA 2YMYA 2YKPA 1A02J 4OH8B 1M1JC 3P8CE 1JTHB 2NPSC 1LWUC 2XNXA 2JEEA 1HJBA 3CLQA 2FYZA 1CW5A 1JTHA 3O8ZA 1FZCA 5BU5A 1PFIA 3RK3D 5KJ7D 1N7SA 1URQB 4W7ZA 2PP6A 1E5WA 3KDPB 1NAFA 2KSJA 2IPPA 1LTGC 2XDJA 2HODA 1FOSE 3TYYA 3HE5B 3B5ND 4I2LC 1LTTC 1T3JA 1FZEA 1QL2A 5CCHD 2HPCB 2E42A 2P67A 1NOHA 4AUWA 1GW4A 1MUUA 1HGVA 3OAKA 4WY4A 1IFNA 3HRNA 2P2UA 1J1DC 3B8EB 2WTYA 1HUCA 1NU1K 4LLHA 5AW9B 1IFMA 2H43A 1L4AB 1GZLA 2KLVA 2Z5HA 3HD7D 1IO4A 2WITA 1X9VA 1SQVK 1URQC 2O1KA 5APTA 4EIJA 2I1JA 1SQBK 1EQ7A 1NH4A 1GU4A 1NKNA 3E1IA 1T2KD 1XTGB 1L4AA 1SQXK 2FFDA 1LT9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OAR A;  1SQQ K;  1NTK K;  2WSE H;  1NU1 K;  2WSC H;  3M9Q A;  2FYU K;  5KLV K;  1SQV K;  2LKM A;  1SQB K;  2O01 H;  1L0L K;  2J59 M;  1SQP K;  1NTM K;  3CLQ A;  1NTZ K;  2WSF H;  1L0N K;  3LW5 H;  1SQX K;  3G3Z A;  4IFD K; 
#chains in the Genus database with same CATH topology
 4EDF A;  2YKQ A;  2K9Y A;  2C9L Y;  1SQQ E;  3RK2 D;  2Y0E A;  1ZR2 A;  2FXP A;  4H0L B;  3RK3 E;  1VF5 C;  3Q3D A;  5GTH H;  5AVY B;  5AW2 B;  3AEC C;  4C7R A;  3RK3 B;  3TSI A;  4UB6 H;  2ZYA A;  1GL2 D;  1NO4 A;  5BVZ A;  1DX7 A;  2FKW B;  3H1K E;  4H13 D;  4L73 A;  3I5C A;  2W8Z A;  5KJ7 A;  2HG5 D;  3V2P A;  3CMA P;  4YXW H;  1LWU A;  1GDT A;  1EDJ A;  3L74 G;  2WT7 A;  5KLV G;  1AQ5 A;  1YYC A;  2LR2 A;  4JYC A;  1YIT P;  2QM8 A;  3L35 A;  3FWN A;  2WPR A;  1GTW A;  4U7J A;  4YTP C;  2CK3 H;  3B5N C;  2FYN B;  3A3Y B;  1PPJ G;  4C7N A;  1FOS F;  1Y47 A;  2KIK A;  1J1D B;  2IBZ D;  4I7Z C;  3MUD C;  3RK2 B;  2R3S A;  1K73 Q;  5KAI H;  1JY3 N;  2FYU J;  3HD7 C;  5AW7 B;  2QJK C;  2J59 M;  1TU3 F;  2ZJS E;  1GL2 B;  1OW7 A;  4H13 B;  3IF4 A;  1S4X A;  5K5G B;  3HE5 A;  3T97 B;  3GHG C;  2N1T C;  1KN7 A;  1VL2 A;  1RHZ B;  5AVQ B;  2B87 A;  3LIE A;  2I1K A;  1EZV G;  3WUU A;  1SQP J;  1IFP A;  3LW5 H;  2QVA A;  1GMJ A;  2OYI A;  4PJ0 H;  1JY3 P;  2WSE H;  3M0D C;  4JQ0 D;  1BE3 D;  3M9B A;  3WMM 0;  3L73 D;  1IFD A;  3GW6 A;  4BRY B;  2M3E A;  1AQT A;  3FGA D;  5AW5 B;  1G1J A;  5L8R J;  1VQ8 P;  1NGM B;  1IFI A;  1RF0 A;  3UIA A;  3IN6 A;  3H1H J;  1EC5 A;  4CPG A;  3CWB D;  4GIF A;  2YXR B;  1NHL A;  1RE4 C;  4GOE A;  4PV1 C;  1ZME C;  3A5T A;  4WB4 A;  2P7J A;  1RH5 B;  2JKV A;  1NJI Q;  1T3U A;  3HUS B;  1BE3 E;  3L73 E;  3CCS P;  2O1J A;  3WU2 E;  5AVZ B;  2AXC A;  2GUS A;  1NVO A;  1NTK J;  2JO1 A;  4XA4 A;  1SFC C;  3A0B H;  2ZYD A;  3L74 J;  1BCC D;  2HYN A;  1NTZ D;  3D6Y A;  5KLV J;  1LT1 A;  1FE6 A;  1DEB A;  3B71 A;  1NTZ K;  2IYP A;  4IOI H;  1AFO A;  4IL6 H;  4N6J A;  3TGU G;  2JDI H;  2G3A A;  1EXJ A;  1KIL A;  1RQV A;  2WMM A;  4AQR D;  1FZC C;  1FZB A;  3KYQ A;  1ZXG A;  3CCU P;  2R3C A;  2WPQ A;  5AW0 B;  1P84 H;  5AW1 B;  1FJP A;  3RGU A;  1BGY G;  4U3F D;  5KAF E;  1PL5 A;  3CX5 H;  3Q2Y A;  1IFJ A;  1KYO H;  3FX0 A;  3CCM P;  3F5H A;  4M3L A;  4EOT A;  1OVV A;  1R5S A;  3HE4 A;  2JP3 A;  1URQ D;  1YBK A;  2GA1 A;  1L4A C;  2E76 D;  3VOP A;  5APW A;  1X22 A;  3M06 A;  5E79 H;  1S5L H;  3AE6 C;  3GF7 A;  4JPZ B;  3V6I A;  3BRV B;  4OWF A;  1AA0 A;  1USD A;  2KZI A;  2R44 A;  2Y9Z A;  1T6A A;  1VF5 D;  1LTI C;  1YHQ P;  3V4W A;  3PLN A;  3E1R A;  4U3F E;  1OZH A;  1A02 F;  2M0B A;  4LGD E;  2Q3I A;  2Q7C A;  3RL0 C;  1JOC A;  1YI2 P;  3MD0 A;  5KJ7 C;  1MZ9 A;  2R32 A;  4BWN A;  1QGK B;  1X0T A;  1JTH B;  1LWU C;  3Q1M A;  1HJB A;  4KT0 J;  2H88 C;  4Z1M H;  1YIJ P;  3BCC G;  2BEZ F;  4D6T E;  1CW5 A;  1AVY A;  3PH0 A;  5BU5 A;  1N7S A;  1URQ B;  3CC7 P;  1E5W A;  2IPP A;  4WVZ A;  2E76 B;  2HOD A;  1OW6 A;  5GTI H;  1SQQ G;  3B5N D;  4I2L C;  1LTT C;  3AE2 C;  1OFC X;  2FXO A;  1VQ5 P;  3CPW O;  1P84 I;  4EI2 A;  2HPC B;  2E42 A;  1NOH A;  1NU1 D;  1GW4 A;  4WY4 A;  2PFX A;  1HUC A;  1NU1 K;  4LLH A;  1VF5 B;  3CX5 I;  1KOR A;  5TIS H;  3HD7 D;  1KYO I;  1IO4 A;  2WIT A;  1SQV K;  3H1K G;  5APT A;  1SQB K;  3E1I A;  2FFD A;  3L70 D;  3TGU J;  3VMA A;  3A0H H;  1W2E A;  4RO0 A;  2N9B A;  2N1T D;  1M8O B;  3ITK A;  1AV1 A;  1L0L D;  2WSS H;  1RF1 A;  3QH9 A;  1L0L K;  2OYI C;  3L71 D;  2K1A A;  5CCG A;  1FAV A;  1NTM E;  3V5B A;  1L0N E;  4TLF A;  1R8E A;  1BGY J;  3H32 B;  1KB9 H;  3U1C A;  1X79 B;  1M1J B;  1Y8A A;  1ZR4 A;  3B5N B;  2RH0 A;  3MGN A;  1YQ4 C;  3E7K A;  2QJY B;  1FJK A;  1HGZ A;  2KB7 P;  2E74 C;  2Q5U A;  1RF0 C;  2A06 E;  2CPB A;  2WPS A;  2KOG A;  3HD7 B;  3L75 E;  3C1L A;  2SPZ A;  2QJK B;  5APV A;  1JEK A;  2AEJ A;  3GF3 A;  1J1E C;  2DW3 A;  1CI6 B;  3SFD C;  3GHG B;  1JO5 A;  1JCC A;  2N1T B;  4N78 D;  2HR3 A;  4GOD A;  4PD4 D;  3L71 E;  3C9I A;  5AW4 B;  2L5G B;  4DJG A;  1L2P A;  5APU A;  2IFM A;  1OW8 A;  1EDK A;  3N7N A;  5B5E H;  2XU6 A;  2KS1 B;  3CXH E;  1SFC D;  5KTB A;  3H1I G;  1JNM A;  3BCC J;  2OTJ P;  3TDK A;  3T97 A;  4GDO A;  5AW6 B;  1GW3 A;  3H1L G;  3D6Z A;  1WT6 A;  1KQS O;  4GOF A;  3AE3 C;  2B89 A;  1SQQ J;  5CJ4 A;  3USS A;  1KIL C;  1SQX G;  4N78 E;  4PD4 E;  1PZQ A;  2YXQ B;  1KB9 I;  2G8Y A;  4HJG H;  1LTJ A;  3MIW A;  2LXC B;  1BE3 G;  4NPE A;  1P84 D;  3H1K J;  3Q5P A;  3CCJ P;  1H0T A;  4XE5 B;  1JB0 J;  2KNC A;  4UB8 H;  2BCC G;  1NTK G;  1DIP A;  1UIX A;  1HH0 A;  3G3Z A;  3QWO C;  1N86 A;  4W80 A;  1SFC B;  1Q7Y Q;  1LNQ A;  2E43 A;  2FYU D;  2M5A B;  3L4F A;  1G2C B;  3A7O A;  2FYU K;  3L72 G;  2GM4 A;  1EZV I;  1K05 A;  3PP5 A;  3K5B A;  2HLO A;  2E5Y A;  3CCV P;  1PGQ A;  1SLQ A;  1MFZ A;  2AEF A;  1VQ7 P;  1SQP D;  3H1J D;  1R5L A;  1FZC B;  2D2C C;  2IZ0 A;  3S9O A;  1GK4 A;  1SQP K;  2ZFC A;  3U1A A;  4IFD K;  1LP1 A;  1PGJ A;  2KZJ A;  5CMZ A;  3RL0 D;  2KUB A;  2NZ2 A;  2P1J A;  3H6P A;  1AVO A;  5B66 H;  4IFF A;  4OVN F;  1N7S C;  3V2Q A;  1D7M A;  3H1H D;  3W67 A;  2P58 A;  3TNU A;  2QJP C;  1OX3 A;  2KLU A;  2IBZ E;  2KYV A;  3W68 A;  1JCD A;  5BU8 B;  2RMZ A;  1ZP0 C;  2OYO A;  5H2F E;  3KHU A;  4WY4 C;  1IZN B;  1SQP E;  3H1J E;  5AVS B;  3M91 A;  3HTK A;  1ZOY C;  5AVV B;  3H1I J;  4RES B;  1LGH B;  1JY2 N;  3AE1 C;  3H1L J;  2E75 C;  2POH A;  4C46 A;  2FXM A;  3V2N A;  2FFD C;  2WQY C;  2L91 A;  5APS A;  1SQX J;  1N73 A;  2P10 A;  3L74 D;  1BSH A;  3VN0 A;  1DEE G;  2W6A A;  1LWU B;  2W6B A;  4D6T G;  1RF1 C;  3MP7 B;  1S1C X;  1BE3 J;  3JCU H;  3KZI E;  5KLV K;  5CCG C;  2AXT E;  1HTL C;  2M8R A;  1YJN P;  1JY2 P;  1KB9 D;  2QA4 P;  2WSF J;  1PPJ D;  3NTN A;  4ASW A;  2BCC J;  2PRR A;  3M0A A;  3SWF A;  2OGU A;  1KD1 Q;  2YIU C;  2XNX A;  4H44 C;  2E74 D;  3AE9 C;  1PV3 A;  1JTH A;  3L72 J;  3KXD A;  3SFE C;  3PTZ A;  2H89 C;  3CWB E;  2B9B A;  1LTG C;  1FOS E;  2IYO A;  3HE5 B;  4K3A A;  3CCL P;  3G71 P;  1FZE A;  1QL2 A;  1EZV D;  2B87 B;  2K3R A;  3MZW B;  2P67 A;  2P2U A;  1J1D C;  3Q5S A;  1NTM G;  3CCQ P;  3D71 A;  2Y0D A;  1L0N G;  2H43 A;  1PPJ E;  2KLV A;  3O6Q A;  4KJM A;  2O1K A;  4NPF X;  2I1J A;  1EQ7 A;  2LXB A;  2J5U A;  2ITA A;  3Q5R A;  1XTG B;  1BCC E;  2OYH A;  1NTZ E;  1IC2 A;  1IK7 A;  3EQ2 A;  3FXE A;  1MFT A;  2W90 A;  2A06 G;  2RKL A;  1HWT C;  2E74 B;  3L75 G;  1FZG A;  4IFM A;  3CC2 P;  1YTZ I;  3G9R A;  1J1E B;  1EZV E;  1KIL D;  3VTP C;  3G6E P;  3EFF K;  2MJZ A;  1OXZ A;  1U57 A;  3H32 A;  1M1J A;  1LTJ C;  2NPS A;  4U3F J;  2JWA A;  1VQO P;  4Y99 C;  1PGP A;  1PIX A;  4RKU J;  1GU5 A;  1FDO A;  1VQL P;  3CL3 D;  1HBW A;  3SWK A;  1QL1 A;  3GLM A;  1FZF A;  4D6T J;  5C39 A;  4YPC A;  4Y28 J;  4DZO A;  2YKO A;  1CI6 A;  1J2J B;  1PP9 G;  4W7Y A;  3L37 A;  1YQ3 C;  1USE A;  4K35 A;  2HFE D;  5KLI C;  2C0W A;  4DT0 A;  3TGU D;  1N7L A;  1SS1 A;  3P32 A;  1YJ9 P;  2QE7 H;  2KXP B;  1NYH A;  1T2K C;  1WMK A;  5GTH E;  1T8Z A;  1DD4 A;  1LTB C;  3TK1 A;  1BSN A;  1ZN5 A;  5AVW B;  2N9Y B;  1QVF O;  2I8D A;  4L76 A;  5DJU B;  3BAT A;  3AE5 C;  1N8R Q;  4UB6 E;  1SQV D;  1M7L A;  1SQB D;  1W2B O;  2WWW A;  3WU2 H;  2K9J B;  3JC2 2;  1OVU A;  2KS1 A;  1BGY D;  1JY3 O;  1MV8 A;  1HJ0 A;  2WPV B;  3VMZ A;  2WSF H;  1PGO A;  3RBX A;  4ZKU A;  2W27 A;  3B4S A;  1LT9 A;  1KZU B;  4AYC A;  3A2A A;  1NTM J;  3C8V A;  3CI9 A;  3HE4 B;  1L0N J;  4JYB A;  1N7S D;  1HF9 A;  4TT3 H;  1FU1 A;  1FZA A;  1VQ6 P;  1EDL A;  2QM7 A;  1LJ2 A;  4IL6 X;  1NU1 E;  1VPC A;  1VQP P;  1VQ4 P;  1FDI A;  4KHX A;  4I7Z B;  3VP8 A;  4WY4 D;  1SQV E;  2XND H;  1N2D C;  1SQB E;  2R5B A;  4R4L A;  2ZAE B;  1ZRT D;  3AE4 C;  5CCH A;  1BGY E;  2XV5 A;  3L75 J;  2IFN A;  5KAF H;  5DJT B;  2E75 D;  2ZT9 C;  3L70 E;  1S72 P;  1VQN P;  1N73 C;  3NFQ A;  1L0L E;  2Y0C A;  5M1B A;  1K04 A;  3VMY A;  3CME P;  1G1I A;  4PV1 D;  4OGQ C;  3L36 A;  4DCK A;  3BCC D;  1LTS C;  2M3B A;  5CCG D;  5EFW B;  3P8M C;  1N7S B;  2K37 A;  2A45 G;  2IBZ G;  2ZXX A;  2VRS A;  2HOD B;  3S1K A;  3NXS A;  3GMA A;  1SQQ K;  3AE8 C;  3SWY A;  3H1J G;  1S5L X;  1ZW0 A;  1Q90 D;  1M1K Q;  3AEF C;  1GL2 A;  3VP9 A;  1GD2 E;  4WY4 B;  1QVG O;  3KQG A;  4HB1 A;  4H44 D;  3EFG A;  4HYT B;  4MN4 C;  1KQL A;  1RE3 A;  3D70 A;  3H1K D;  1PP9 J;  1Y9B A;  3I56 P;  4LC1 A;  2E75 B;  1AJY A;  1JMB A;  1IK9 A;  4EYY Q;  3S4R A;  5TJH A;  3P7K A;  2WVR A;  2FFD B;  3U59 A;  3JSV C;  3BCC E;  1U7J A;  3LID A;  4DOJ A;  2FBW C;  1CZQ A;  4L75 A;  4R4M A;  2C9N Y;  4PV1 B;  3AEB C;  1RF1 B;  3L73 G;  1Q2N A;  5APY A;  1X8Y A;  4BRY A;  3CX5 D;  1FBM A;  3A0B E;  2OYH C;  2XKM A;  2YO2 A;  2OQQ A;  1KYO D;  3IR9 A;  1W5C E;  3PHL A;  1H88 A;  2AEM A;  1MKM A;  2O01 N;  3VMX A;  2NRG A;  2YIU B;  4H44 B;  1EDI A;  4IL6 E;  3ABV C;  1L4A D;  5AVU B;  3CWB G;  4YXD C;  2Q3E A;  3HUS A;  1EXI A;  4HH2 A;  1JMM A;  4WBA A;  3G4S P;  2YKP A;  3AE7 C;  1M1J C;  1P84 E;  2NPS C;  3AEE C;  3SSU A;  3FXD A;  3CX5 E;  2QJY C;  5KKZ C;  1U7M A;  3O8Z A;  4ASV A;  3MHV A;  1KYO E;  1PFI A;  1BDD A;  1BCC G;  2UWJ E;  2ZVO B;  1NTZ G;  5KJ7 D;  2PP6 A;  3KDP B;  1NAF A;  1FS0 E;  4JBZ A;  3TYY A;  4WWI A;  4XFJ A;  3H1I D;  2FYU E;  1T3J A;  1M57 D;  3R4Y A;  3H1L D;  1BDC A;  4AUW A;  1YJW P;  3B8E B;  1M56 D;  1VQM P;  5AW9 B;  1IFM A;  1S5L E;  1L4A B;  5E79 E;  1GZL A;  2Z5H A;  1OIP A;  3AED C;  1SQX D;  1X9V A;  4EIJ A;  1NH4 A;  1GU4 A;  3H1J J;  2PGD A;  1T2K D;  1SQX K;  2KK7 A;  3N4X A;  3AEG C;  3IAO A;  2IZ1 A;  2V7Q J;  4U3F G;  1M90 Q;  2K88 A;  1NAY A;  1LTJ B;  2GUV A;  1ZV8 A;  5AVT B;  4ZKP A;  4Y99 B;  1SP4 A;  1H0T B;  2BCC D;  3RL0 B;  1NTK D;  3CXH H;  2KNC B;  3H1I E;  1OMI A;  1NTK K;  1K8A Q;  3H25 A;  1LT9 C;  3H1L E;  3CCR P;  2KP8 A;  3EWK A;  5KLV D;  2WT7 B;  3H1H E;  2ZVN B;  3L73 J;  3L72 D;  2Q1K A;  5GTI E;  3OA7 A;  4H0L C;  1SQX E;  2Z5I A;  5KLI B;  4PD4 H;  3RK3 C;  4C7N B;  1Q82 Q;  5CBO A;  2WSC J;  1GK6 A;  3II6 A;  5TIS E;  2PAJ A;  3BAS A;  1OWA A;  1JUN A;  5CCH C;  1H8A A;  1S2E A;  3R2P A;  2BCC E;  1NTK E;  3A0H E;  3CWB J;  3F89 A;  2ZT9 D;  3OW2 O;  1KQF B;  1LP1 B;  1SVF A;  1QEX A;  1VQK P;  2H7H A;  3L74 E;  2LKM A;  4NPD A;  5KLV E;  3BVH A;  1E79 H;  1URQ A;  2FYN C;  4OGQ D;  3L72 E;  3M9Q A;  3RK2 C;  3KPE A;  3RBZ A;  1KB9 E;  4JF7 A;  2HPC A;  2OYI B;  3FWL A;  2J58 A;  1KFN A;  3TNU B;  1NU1 G;  1Q81 Q;  2Q9I A;  1BCC J;  1NTZ J;  2O01 J;  1Q86 Q;  2QSI A;  4N3Y B;  5CHX A;  1FDM A;  2K9J A;  1SQV G;  1SQB G;  3CCE P;  3BRT B;  1GL2 C;  4H13 C;  3HTK B;  1FC2 C;  2YNY A;  1RE3 C;  3CXH I;  3L70 G;  2XZR A;  2ZT9 B;  2FY8 A;  1L0L G;  1KQG B;  4GT1 A;  3IFM A;  1CSB A;  1NKZ B;  1N73 B;  4I1L A;  4D6T D;  3L71 G;  5AVX B;  2ZXE B;  1H89 A;  4OGQ B;  4PD4 I;  3V2R A;  3B5N A;  1DH3 A;  1WRG A;  3I55 P;  2KSE A;  2A45 H;  2YO3 A;  3MUD A;  1OVR A;  1ZLL A;  5B5E E;  1KTM A;  2KI7 B;  5H2F H;  1KFM A;  4RJT A;  2JJL A;  5AVR B;  3HD7 A;  2WZ7 A;  2V7Q H;  1UII A;  3ZDM A;  2C0X A;  4HKZ H;  3GHG A;  2N1T A;  3CD6 P;  2Y9Y A;  3M9H A;  5APQ A;  1KIL E;  2YMK A;  2IDB A;  5CJ0 A;  3PJS K;  1RY3 A;  2QG4 A;  3HUS C;  1IJD B;  3RL0 g;  3TF5 A;  3V4Q A;  4ZNC A;  1KIL B;  3NMD A;  2JR8 A;  2BAS A;  3WUT A;  2ZYG A;  1XTC C;  3KZI H;  2AXT H;  2BEQ D;  1NTM D;  3M0D A;  2NPS D;  1S3J A;  1L0N D;  2QEX P;  5AW3 B;  2D2C D;  1S9K D;  1NTM K;  2JWD A;  4UB8 E;  1L0N K;  4B86 A;  5APX A;  1DD3 A;  3O6Q B;  2QRX A;  1JM0 A;  2WSC H;  4O9B A;  2OYH B;  5AW8 B;  2R5D A;  1VDF A;  2A06 D;  2CPS A;  3L75 D;  2RN0 A;  3TGU E;  3P8C D;  1LTA C;  1RE4 A;  1NU1 J;  3PRJ A;  1YTZ T;  4A7P A;  1QX8 A;  3WUV A;  2MKV A;  1KMI Z;  1SQV J;  4BXL A;  1SQB J;  1K9M Q;  2A45 I;  2IBZ I;  5KAI E;  1Z56 A;  2Z4E A;  1HVV A;  4ZMD A;  4I6M C;  1S9K E;  2W83 C;  2NPS B;  3L70 J;  2IX7 C;  2D2C B;  1VQ9 P;  2B88 A;  1JY2 O;  2H8P D;  3VYI A;  1SFC A;  5KKZ B;  2O01 H;  5B66 E;  1L0L J;  2M5A A;  2W6J H;  3CXH D;  3OJA B;  1G2C A;  2OAR A;  2FYU G;  1KC8 Q;  3LW5 J;  4GKG A;  3L71 J;  2V4H A;  1NWQ A;  3MTU E;  2YMY A;  2WSE J;  1A02 J;  4PJ0 E;  4OH8 B;  3P8C E;  1PP9 D;  2JEE A;  4QMA A;  1RQU A;  3CLQ A;  4H0L D;  1SQQ D;  2FYZ A;  2OTK E;  2QJP B;  1FZC A;  2E5T A;  3RK3 D;  1SQP G;  3GG2 A;  4W7Z A;  2KSJ A;  1ZRT E;  2XDJ A;  2Q6Q A;  3CC4 P;  4L74 A;  5CCH D;  2QIW A;  2O3J A;  1MUU A;  1HGV A;  3OAK A;  1IFN A;  3HRN A;  2WTY A;  1KV4 A;  2OTL P;  5CBN A;  1URQ C;  1NKN A;  2E76 C;  3AEA C;  1L4A A;  3JCU E;  1QLE D;  3H1H G;  1LT9 B;  1PP9 E; 
#chains in the Genus database with same CATH homology
 3N4X A;  1W2E A;  2YKQ A;  1IC2 A;  2N9B A;  3EQ2 A;  2N1T D;  2C9L Y;  3RK2 D;  1LTJ B;  1ZR2 A;  2GUV A;  1ZV8 A;  5AVT B;  1HWT C;  1RF1 A;  4ZKP A;  1L0L K;  5AVY B;  4Y99 B;  1SP4 A;  2OYI C;  3RL0 B;  1FZG A;  5CCG A;  5AW2 B;  1FAV A;  4C7R A;  3RK3 B;  3V5B A;  4IFM A;  3TSI A;  1YTZ I;  1NTK K;  3H32 B;  1GL2 D;  1NO4 A;  5BVZ A;  3U1C A;  1X79 B;  1DX7 A;  1J1E B;  1KIL D;  1LT9 C;  1M1J B;  2FKW B;  1ZR4 A;  3VTP C;  2KP8 A;  3I5C A;  2MJZ A;  3B5N B;  1OXZ A;  5KJ7 A;  2WT7 B;  2HG5 D;  3V2P A;  3H32 A;  3MGN A;  1M1J A;  1LTJ C;  2NPS A;  3OA7 A;  1LWU A;  1GDT A;  1FJK A;  1HGZ A;  2KB7 P;  2WT7 A;  2Z5I A;  2Q5U A;  4Y99 C;  1AQ5 A;  1YYC A;  1RF0 C;  2CPB A;  2WPS A;  2KOG A;  3HD7 B;  4JYC A;  3RK3 C;  1GU5 A;  2QM8 A;  3L35 A;  3CL3 D;  4C7N B;  1HBW A;  2WPR A;  5APV A;  1GTW A;  1J1E C;  3B5N C;  1GK6 A;  1QL1 A;  3II6 A;  1CI6 B;  2PAJ A;  3A3Y B;  3BAS A;  4C7N A;  1FZF A;  1OWA A;  1FOS F;  3GHG B;  1JO5 A;  1JCC A;  1J1D B;  5CCH C;  1JUN A;  2N1T B;  1H8A A;  4N78 D;  3RK2 B;  3R2P A;  4DZO A;  2YKO A;  1CI6 A;  3C9I A;  1J2J B;  4W7Y A;  5AW4 B;  3L37 A;  1SVF A;  2L5G B;  2HFE D;  2C0W A;  2H7H A;  1JY3 N;  3HD7 C;  1N7L A;  5APU A;  2LKM A;  5AW7 B;  3P32 A;  2IFM A;  2J59 M;  3BVH A;  1URQ A;  3N7N A;  1GL2 B;  1T2K C;  1T8Z A;  1LTB C;  3TK1 A;  3HE5 A;  2XU6 A;  1ZN5 A;  5AVW B;  3GHG C;  3BAT A;  2N1T C;  1SFC D;  3M9Q A;  5KTB A;  3RK2 C;  3KPE A;  1M7L A;  4JF7 A;  5AVQ B;  2HPC A;  2WWW A;  1JNM A;  2OYI B;  3LIE A;  2I1K A;  3T97 A;  2J58 A;  5AW6 B;  1GW3 A;  1JY3 O;  1KFN A;  1MV8 A;  3TNU B;  1WT6 A;  3VMZ A;  2Q9I A;  2WSF H;  3LW5 H;  2OYH A;  2OYI A;  4N3Y B;  5CHX A;  1FDM A;  5CJ4 A;  1JY3 P;  3BRT B;  1GL2 C;  2WSE H;  3M0D C;  3WMM 0;  1KIL C;  3M9B A;  4N78 E;  3HTK B;  4ZKU A;  2W27 A;  1LT9 A;  1IFD A;  2YNY A;  1RE3 C;  1KZU B;  4AYC A;  3A2A A;  2XZR A;  3CI9 A;  3HE4 B;  1LTJ A;  3MIW A;  1N7S D;  4JYB A;  1FU1 A;  1FZA A;  5AW5 B;  1G1J A;  4GT1 A;  3IFM A;  1CSB A;  2QM7 A;  1IFI A;  1RF0 A;  3UIA A;  1NKZ B;  1N73 B;  4XE5 B;  1VPC A;  4I1L A;  4KHX A;  5AVX B;  2ZXE B;  1H89 A;  3VP8 A;  4WY4 D;  1HH0 A;  1N2D C;  2R5B A;  3G3Z A;  3B5N A;  4GIF A;  3V2R A;  1DH3 A;  1N86 A;  1WRG A;  4W80 A;  1SFC B;  1NHL A;  1RE4 C;  5CCH A;  3A5T A;  2A45 H;  2XV5 A;  2E43 A;  2YO3 A;  2IFN A;  3MUD A;  4WB4 A;  1ZLL A;  2P7J A;  3L4F A;  1G2C B;  3A7O A;  1KFM A;  2FYU K;  1T3U A;  3HUS B;  2JJL A;  2GM4 A;  5AVR B;  3PP5 A;  1N73 C;  2O1J A;  3HD7 A;  2HLO A;  5AVZ B;  3NFQ A;  2GUS A;  3VMY A;  2WZ7 A;  1G1I A;  3L36 A;  1LTS C;  4XA4 A;  1SLQ A;  2C0X A;  1MFZ A;  1SFC C;  3GHG A;  2M3B A;  2N1T A;  2HYN A;  3M9H A;  1FZC B;  5CCG D;  5APQ A;  3P8M C;  1DEB A;  1N7S B;  5CJ0 A;  1GK4 A;  1SQP K;  1RY3 A;  2A45 G;  1NTZ K;  2ZFC A;  2VRS A;  3U1A A;  3HUS C;  1IJD B;  2HOD B;  4IFD K;  3V4Q A;  3NXS A;  5CMZ A;  3RL0 D;  1KIL B;  1SQQ K;  3NMD A;  3SWY A;  2BAS A;  1AFO A;  4N6J A;  1XTC C;  2P1J A;  3H6P A;  1GL2 A;  3VP9 A;  1GD2 E;  4WY4 B;  3M0D A;  2NPS D;  1KIL A;  5AW3 B;  3KQG A;  3EFG A;  1S9K D;  4HYT B;  1NTM K;  1KQL A;  1RE3 A;  1L0N K;  4AQR D;  4IFF A;  1FZC C;  4B86 A;  1FZB A;  5APX A;  3KYQ A;  4LC1 A;  1N7S C;  3V2Q A;  1IK9 A;  2R3C A;  2WPQ A;  5AW0 B;  3P7K A;  3TNU A;  5AW1 B;  2WSC H;  2FFD B;  1FJP A;  4O9B A;  2OYH B;  2KYV A;  3U59 A;  1JCD A;  5AW8 B;  5BU8 B;  2R5D A;  1VDF A;  4DOJ A;  3LID A;  1CZQ A;  2CPS A;  2C9N Y;  1IFJ A;  4WY4 C;  5AVS B;  3M91 A;  3HTK A;  5AVV B;  1RF1 B;  4RES B;  4M3L A;  3P8C D;  1LGH B;  1LTA C;  1JY2 N;  4EOT A;  1RE4 A;  5APY A;  1YTZ T;  1X8Y A;  3HE4 A;  1URQ D;  2POH A;  4C46 A;  2FXM A;  3V2N A;  1FBM A;  1L4A C;  2FFD C;  2OYH C;  2XKM A;  2YO2 A;  2A45 I;  3VOP A;  5APW A;  5APS A;  3IR9 A;  1N73 A;  1Z56 A;  2Z4E A;  1HVV A;  3M06 A;  4I6M C;  1S9K E;  1H88 A;  3VN0 A;  3BRV B;  2NPS B;  3VMX A;  2W6A A;  1LWU B;  2IX7 C;  2W6B A;  1RF1 C;  2H8P D;  1JY2 O;  3VYI A;  1SFC A;  5KLV K;  1L4A D;  5CCG C;  5AVU B;  1LTI C;  2O01 H;  1HTL C;  3V4W A;  2M8R A;  3OJA B;  1JY2 P;  1G2C A;  1A02 F;  2OAR A;  4LGD E;  2Q3I A;  2Q7C A;  3NTN A;  3HUS A;  4GKG A;  3RL0 C;  1JOC A;  3MD0 A;  4HH2 A;  1NWQ A;  3MTU E;  5KJ7 C;  1MZ9 A;  2R32 A;  1JMM A;  4WBA A;  3M0A A;  3SWF A;  2YMY A;  2YKP A;  1A02 J;  4OH8 B;  1M1J C;  3P8C E;  1JTH B;  2NPS C;  1LWU C;  2XNX A;  2JEE A;  1HJB A;  3CLQ A;  2FYZ A;  1CW5 A;  1JTH A;  3O8Z A;  1FZC A;  5BU5 A;  1PFI A;  3RK3 D;  5KJ7 D;  1N7S A;  1URQ B;  4W7Z A;  2PP6 A;  1E5W A;  3KDP B;  1NAF A;  2KSJ A;  2IPP A;  1LTG C;  2XDJ A;  2HOD A;  1FOS E;  3TYY A;  3HE5 B;  3B5N D;  4I2L C;  1LTT C;  1T3J A;  1FZE A;  1QL2 A;  5CCH D;  2HPC B;  2E42 A;  2P67 A;  1NOH A;  4AUW A;  1GW4 A;  1MUU A;  1HGV A;  3OAK A;  4WY4 A;  1IFN A;  3HRN A;  2P2U A;  1J1D C;  3B8E B;  2WTY A;  1HUC A;  1NU1 K;  4LLH A;  5AW9 B;  1IFM A;  2H43 A;  1L4A B;  1GZL A;  2KLV A;  2Z5H A;  3HD7 D;  1IO4 A;  2WIT A;  1X9V A;  1SQV K;  1URQ C;  2O1K A;  5APT A;  4EIJ A;  2I1J A;  1SQB K;  1EQ7 A;  1NH4 A;  1GU4 A;  1NKN A;  3E1I A;  1T2K D;  1XTG B;  1L4A A;  1SQX K;  2FFD A;  1LT9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...