1SQVK

Crystal structure analysis of bovine bc1 with uhdbt
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
51
structure length
51
Chain Sequence
MLTRFLGPRYRQLARNWVPTASLWGAVGAVGLVWATDWRLILDWVPYINGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome c reductase complex core protein I, mit
total genus 14
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF08997 UCR_6-4kD Ubiquinol-cytochrome C reductase complex, 6.4kD protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1sqvK00
1SQQK 2WSFH 3M9QA 1SQBK 2WSCH 1SQVK 1NTKK 2J59M 1SQXK 1SQPK 2WSEH 1L0NK 2LKMA 1NTMK 2O01H 3G3ZA 5KLVK 1NU1K 3CLQA 4IFDK 2FYUK 2OARA 1L0LK 3LW5H 1NTZK
chains in the Genus database with same CATH superfamily
1VPCA 2GUSA 3L37A 1SFCD 3RK3B 4RO0A 1KYOH 3IF4A 3L74J 3L72G 1P84H 1DEEG 3O6QA 2J58A 5AVSB 3WUUA 3CPWO 1YIJP 2A06G 1HWTC 3BATA 5CCHD 3L35A 1BGYG 1QVGO 3CCEP 1SQBE 3MGNA 2FY8A 4OVNF 3AE1C 2H43A 2K9YA 1EDIA 3H1IG 1RF0C 2KZJA 1CZQA 3H1LE 1IFDA 1CSBA 2YNYA 3F89A 1VQ5P 1VF5D 3EFGA 3H25A 4LC1A 2KXPB 5KLVD 3L71G 2BASA 2BCCD 4H0LD 3CCUP 1PP9G 3CC2P 2K9JB 2OARA 1RHZB 2KK7A 5DJUB 1GL2D 3IAOA 1DD4A 1HGVA 1T2KC 1LTJC 2GA1A 2QSIA 1JM0A 2M0BA 1VL2A 2W6AA 2ZYGA 3MD0A 1GK6A 4I7ZB 3H1JJ 1L4AA 3KQGA 3L72E 1LWUC 2NZ2A 2QJPB 1KYOE 2AXTH 2GUVA 1M1JA 2OQQA 2E43A 2QVAA 2YO2A 1M57D 1P84E 2JO1A 1MFZA 1QGKB 1SQPD 1JY3N 1ZW0A 2K88A 3E1IA 5AW2B 4GOEA 1NTKE 2WSFJ 1N7SD 2NPSC 3TGUJ 2WVRA 3RGUA 1IFJA 5KAFE 3VP9A 1SQVJ 1M1JC 3CCQP 2YKOA 2IBZD 1KILA 2QIWA 1L0LG 1EZVI 4PV1C 1N2DC 3V2QA 3V6IA 2D2CC 2P67A 2ZVOB 5APVA 3C8VA 1NU1D 1ZMEC 2FKWB 2CPBA 3L75J 2Y0DA 1H8AA 2O3JA 2M5AA 3S9OA 2QM7A 1A02F 1NTME 1EXJA 1OW6A 1PIXA 1URQC 5AW8B 1M8OB 3BASA 4Y99C 5AVQB 4HH2A 5AVZB 1JUNA 2YIUB 1X22A 1OVUA 3CCSP 1DD3A 4D6TG 3L71E 3CWBG 3SFEC 1KB9D 2BCCE 2MKVA 2WSCH 3V4QA 4YXDC 3FX0A 2A45H 4YTPC 4QMAA 3VMAA 3CD6P 2A06E 1PGPA 2ZT9B 5GTIH 2JWAA 1L0NJ 3H32B 1U7MA 1HGZA 3CX5I 4NPDA 3L70E 1SQXD 2N1TA 5AW1B 1HJ0A 1Y47A 1KC8Q 2E74B 2M5AB 2N1TB 2XDJA 5GTHH 1NKNA 4DCKA 2OYHA 3AEEC 5AVUB 1VF5C 2N9BA 1KZUB 2QEXP 2OGUA 4U3FJ 2WSEJ 1JY2P 1J1DC 1PGOA 3H1KJ 1SQXG 3Q2YA 1PFIA 1SQBJ 4IFDK 2C0XA 1HTLC 3BRTB 2KSEA 1KFNA 1GL2C 4PD4I 1JY2O 1VQ4P 3BCCE 1PGJA 3PHLA 5TJHA 2RMZA 5KLVJ 1W5CE 4YXWH 4JPZB 1P84D 1L0NG 2N9YB 2LR2A 1L0NE 2LXBA 1PPJD 3CWBE 2WMMA 2L91A 2RN0A 3B8EB 2WSSH 1AVYA 1JMBA 1JEKA 1SQQG 3H1LG 3ITKA 4W7ZA 3C1LA 1N7SC 2NPSD 4H0LB 1YTZI 4DT0A 2PGDA 4R4MA 4GT1A 1SQBG 2AXCA 2FBWC 3L72D 5KJ7D 3WUTA 1KB9E 3JCUH 4U3FE 4CPGA 3U1CA 1YHQP 2OYIC 1KORA 1NTMD 1Q81Q 3A7OA 5AW7B 3B71A 1L4AD 3AE4C 3HE4B 4EIJA 1SQPJ 2ZT9C 3VP8A 1W2BO 3HE4A 2ITAA 4PJ0H 1URQD 5DJTB 2KNCA 1L0LJ 3A5TA 2HFED 2QE7H 3H1ID 1IC2A 1LTIC 1EDKA 2JJLA 1N73C 3Q5PA 2OYIB 2QJYC 3A2AA 3AEDC 3M0AA 2POHA 2FXOA 2ZYAA 4H44C 1S9KD 1NU1E 1VQLP 3W68A 3PTZA 1XTCC 2K9JA 3RBZA 1OIPA 1SFCB 3GMAA 4PD4E 5KAIE 3RK3D 4N3YB 2KS1B 4K3AA 2KB7P 3BRVB 1S5LX 4IL6H 3PP5A 1JTHB 3FWLA 3BCCD 3CXHI 2DW3A 2KSJA 2P1JA 2P10A 5KLIC 5APSA 2L5GB 4BWNA 1SFCC 2CPSA 3NMDA 3TDKA 1OW7A 3L4FA 3NXSA 4HJGH 3QWOC 1IFPA 3RL0C 1VQNP 2QG4A 2BEQD 3L70D 3O8ZA 5CCHC 4BXLA 1L0LE 5AVVB 3GF7A 3BVHA 1JCCA 2NPSA 1YITP 1RE3A 1YTZT 1PPJG 2IYOA 3P8MC 3GG2A 4WB4A 1GMJA 2FXPA 2JP3A 4U3FD 1KFMA 3ABVC 3PRJA 1RF1C 4XE5B 1VF5B 2CK3H 4I1LA 2HODB 1T6AA 5AW4B 2FFDB 3CMEP 1SQXE 1FDIA 2KUBA 2YO3A 3IFMA 1JNMA 1BSHA 2ZVNB 1J1DB 4IFFA 2OTKE 1AA0A 2P7JA 2QJKB 1WRGA 2V4HA 3B5ND 3HE5A 4ZKUA 4U3FG 2M3BA 5CHXA 2I1KA 2FYZA 2LXCB 5C39A 3V2RA 5BU8B 2W27A 1JB0J 3CXHH 5KJ7C 1LJ2A 2O1KA 3SFDC 2WPVB 1YQ3C 3GF3A 4N78D 3AEBC 1PPJE 3CWBD 2V7QJ 5AVRB 1BCCE 1U7JA 3M06A 2ZT9D 2LKMA 2C9LY 3VMXA 3OAKA 1NTMK 1LT9C 1RQUA 1SFCA 1KILB 2WPSA 2E76B 2KP8A 2XZRA 3OJAB 3TNUA 3AE8C 2QA4P 1YJWP 2IFNA 2HPCA 2WPQA 4OGQC 3BCCG 1SP4A 3W67A 1CI6A 1M1KQ 3D70A 5APQA 1UIXA 3LW5H 5AVWB 4PV1B 5BU5A 3EQ2A 1FOSE 4TLFA 1M1JB 2KYVA 1FBMA 2YXQB 3VTPC 1NTZD 4LLHA 3IN6A 1E79H 3U1AA 2FYUJ 3CX5E 3M9BA 1LTBC 1RH5B 4HB1A 4AYCA 1AQ5A 5KLVG 5CCGA 3M0DC 3AEAC 4AUWA 2JKVA 1PV3A 1NU1G 5EFWB 3VN0A 1K8AQ 4ZNCA 5KTBA 3L74D 2Q3EA 3CXHD 3RL0D 5CCGC 1KILD 1NO4A 5KLVE 3FGAD 2YIUC 1MZ9A 2Q1KA 3MUDA 1G1JA 3TK1A 2W83C 5KAFH 4RJTA 1N7SA 2Q7CA 1NJIQ 2FFDC 1H0TA 1J1EC 1HBWA 3KXDA 1RF1A 1M56D 1X79B 1KN7A 1KQGB 4C7NB 5KLVK 1FZAA 3F5HA 3FXDA 4OWFA 1QX8A 2H89C 3H6PA 4C7NA 2VRSA 1T8ZA 3HRNA 1NTMG 1QL1A 5TISE 4IL6X 1S5LH 1BDDA 1FC2C 1J1EB 3AECC 4N6JA 1PP9J 3KYQA 1S3JA 2HG5D 2IZ0A 3B5NC 3MZWB 4YPCA 2RH0A 3D6ZA 3E7KA 3HD7D 3AE2C 1SS1A 2WWWA 3LIDA 3R2PA 4DOJA 1BCCG 1NTKD 3L75E 3L72J 3RL0B 3V4WA 5H2FE 3CX5H 3GHGB 4GOFA 1KQFB 1GW4A 3SWKA 3RBXA 3T97A 1Q2NA 3TYYA 1LTJB 2Y9YA 2ZJSE 1VQPP 1S1CX 1LTAC 5AVXB 4IFMA 3M0DA 5CBNA 2OTJP 1OX3A 3TGUE 3PJSK 3H1IJ 1EZVD 3Q1MA 3H1HG 2FYNC 4KT0J 3CWBJ 1HH0A 1LTGC 2Y0CA 3MTUE 3AEFC 1DEBA 3L74E 5AW9B 2E5TA 1SQVD 4D6TD 4PD4H 2QJKC 5KKZC 5KAIH 1PGQA 4EOTA 1ZR2A 4XFJA 1E5WA 1PP9E 3WU2E 2IZ1A 1MV8A 1BGYD 1ZOYC 1NU1J 1L4AC 3L75G 1FZCA 2D2CB 3H1HD 1RE3C 1BCCJ 3HTKB 2W6BA 2Z5IA 1AFOA 1PL5A 3M9QA 1SQVG 4H13C 4WY4B 1QVFO 3EWKA 3H1KE 2QJYB 3P8CE 4H44D 2ZFCA 1GL2B 1CI6B 3CI9A 3JC22 3U59A 2O01J 1KILC 2FYUD 3HE5B 3L71D 1LP1A 1Z56A 3HUSC 4LGDE 3KDPB 3CCRP 4R4LA 5E79H 3B5NB 3PLNA 3FXEA 1VQKP 3RK2D 1L4AB 1L0ND 1KB9I 1NWQA 1K9MQ 5GTHE 1A02J 4HKZH 5KJ7A 5APYA 1EDLA 2QM8A 3OW2O 1Q86Q 2M3EA 1DX7A 3V2NA 3AE6C 1KILE 1IK7A 2IDBA 1NTKG 2R32A 2NPSB 3AE5C 1BE3J 3VMZA 3AE3C 4L76A 1ZV8A 2AEMA 1NAFA 2H7HA 1OXZA 1LWUA 1SQQD 1SVFA 1NHLA 3CXHE 4RESB 3S4RA 1VQ7P 1LGHB 1N86A 3A0HE 1FZBA 4NPFX 3NFQA 4IL6E 4A7PA 3TGUD 1EDJA 1PP9D 2XNDH 1FZFA 4K35A 3E1RA 1Y8AA 3L73E 2B9BA 2YMKA 1L0NK 5CCHA 3CC7P 3H1JD 3MP7B 1FS0E 3L75D 2WTYA 1RQVA 3C9IA 3L36A 4JQ0D 4L74A 4Y28J 4ZMDA 1GU5A 2YMYA 1URQA 1WMKA 2Z5HA 3V2PA 2JEEA 2O01H 5B5EH 1FZCC 3HD7A 3H1HE 1AQTA 4WBAA 1SLQA 3II6A 1IFNA 4PJ0E 3QH9A 1MFTA 2E75D 1MKMA 4W7YA 2G3AA 3G9RA 1KQLA 4IOIH 3Q5RA 2IBZG 2W6JH 1L0LD 1JMMA 3CL3D 2E76D 2Q5UA 2WSFH 2C0WA 1Q82Q 1BSNA 4OGQD 1SQBK 2A45G 1ZLLA 4Z1MH 5AVYB 1S9KE 2KIKA 1OVVA 2K37A 3UIAA 1X9VA 3D6YA 1LTTC 2E75B 2OYIA 2B87B 3L70G 4UB8H 4PD4D 3KZIE 3RK3E 5B66H 1LT9A 2B87A 1U57A 1ZRTE 1SQVE 2QRXA 1G2CA 2GM4A 3H1KD 5CJ0A 3P8CD 5K5GB 1Q90D 2BCCJ 1LWUB 3OA7A 1RF1B 2FYUE 3GHGA 3MIWA 5AW3B 5TISH 1SQXJ 2J5UA 1N7SB 3SSUA 1JOCA 5CCGD 4N78E 4L75A 3LIEA 2Q3IA 1R5LA 2B88A 1NH4A 3H1LD 3G6EP 1FJPA 1J2JB 2OYOA 3AE7C 1L0LK 1EZVG 3S1KA 4EYYQ 1X8YA 1EC5A 2KNCB 1DIPA 5APXA 1D7MA 1SQBD 2H88C 2W90A 3EFFK 1FDOA 1BE3D 1KMIZ 5CJ4A 2R3CA 1W2EA 2YKQA 3A0BE 4ASVA 1VQOP 1FZGA 2E74D 1JY3P 3KPEA 1NTKK 4JYBA 2OTLP 1SQXK 2HR3A 2KLUA 3SWFA 1Y9BA 2IBZE 2KOGA 3TSIA 1IK9A 1BE3G 1IFIA 4U7JA 1OFCX 1FU1A 1NTZG 3HD7C 1NKZB 1GDTA 4D6TJ 1T3JA 5CMZA 1RY3A 4JBZA 4DJGA 4HYTB 2K1AA 5B66E 1X0TA 2K3RA 3HUSA 1L2PA 1IFMA 4O9BA 2FYUG 4JYCA 3CC4P 4EI2A 1KD1Q 2BEZF 2E75C 1T3UA 1SQPG 2NRGA 3HUSB 2R44A 1BCCD 1ZRTD 3B5NA 1GU4A 1IO4A 1CW5A 1QEXA 1K05A 1OW8A 3GHGC 3H32A 2JR8A 3A3YB 4I6MC 1Q7YQ 3K5BA 1BDCA 2C9NY 3P7KA 2WT7A 1NTZK 3BCCJ 1R5SA 4WY4A 1SQPE 1KYOI 4WVZA 3L74G 5M1BA 3WMM0 2IPPA 2HODA 1LT1A 1UIIA 1USEA 2AEJA 2WITA 1LNQA 4XA4A 3T97B 1R8EA 1KQSO 2ZXXA 1TU3F 1SQPK 2AXTE 1RE4A 3AEGC 1JTHA 2HLOA 1HUCA 2KLVA 4RKUJ 5H2FH 3VYIA 2M8RA 3CX5D 5KKZB 1FDMA 1S2EA 1NGMB 1QL2A 2FXMA 1GW3A 2IX7C 1JY2N 2R5BA 4H13D 1AV1A 2WZ7A 3TGUG 3USSA 1GD2E 1H88A 3KHUA 4ZKPA 1N7LA 3VOPA 2PRRA 3ZDMA 1OWAA 1SQQJ 3G4SP 1WT6A 2ZYDA 2AEFA 3CLQA 1S4XA 3L73J 2FYUK 3M91A 1FAVA 4I7ZC 3A0HH 3RK2C 3L70J 2JWDA 1M7LA 2KS1A 5AW0B 5AW6B 1M90Q 1AJYA 1S5LE 2JDIH 1SQQK 3HD7B 1AVOA 1JO5A 2E74C 1OMIA 2Z4EA 3O6QB 2IBZI 2O01N 3FWNA 3H1KG 1P84I 3R4YA 3CMAP 3H1IE 3IR9A 4WWIA 4EDFA 3CCMP 3Q3DA 1EXIA 4NPEA 3V5BA 5GTIE 2A45I 2WPRA 2Q6QA 3WUVA 1BGYE 1RF0A 2N1TD 1VQ8P 1NTMJ 1BE3E 2UWJE 1GZLA 2XV5A 1YJ9P 1NTKJ 5AW5B 2XNXA 1FE6A 2MJZA 2PP6A 2SPZA 2YKPA 1RE4C 1URQB 3VMYA 4BRYB 2R5DA 3CCLP 2Y0EA 2P58A 1YYCA 3B4SA 3G3ZA 1ZN5A 3GW6A 1HVVA 4B86A 1YJNP 1NU1K 1YQ4C 2XU6A 5BVZA 1NTZJ 2OYHC 1DH3A 4WY4C 1K04A 1H0TB 4TT3H 1EZVE 1NOHA 4UB6E 4BRYA 2HYNA 5APWA 1S72P 5AVTB 3SWYA 1N8RQ 1FOSF 3D71A 1IJDB 2V7QH 3NTNA 3WU2H 3JSVC 2IFMA 2PAJA 1JY3O 1OZHA 2E5YA 4D6TE 3P32A 4ASWA 4UB8E 1YI2P 2Q9IA 3KZIH 4I2LC 1NYHA 4W80A 2YXRB 1SQVK 3G71P 2P2UA 2B89A 2J59M 1VQMP 1NVOA 1VDFA 2WQYC 1HJBA 1EQ7A 2FYNB 2E76C 2WT7B 1LTSC 2O1JA 2ZXEB 3TNUB 1N73B 4C7RA 1KB9H 1PZQA 1ZXGA 2G8YA 2R3SA 3JCUE 3MHVA 5E79E 1FJKA 1QLED 4Y99B 2QJPC 3H1LJ 4KHXA 1ZR4A 3L71J 4MN4C 1GTWA 1KYOD 3Q5SA 1HF9A 2W8ZA 4OH8B 2ZAEB 3TF5A 1VQ6P 4L73A 3MUDC 3H1JE 2WSCJ 1GK4A 3H1JG 5KLIB 3A0BH 4C46A 1KTMA 1H89A 4H0LC 1XTGB 1JCDA 3N7NA 3I55P 2FFDA 3M9HA 2KI7B 4UB6H 4AQRD 5APUA 3L73D 1MUUA 4GKGA 4GODA 1N73A 2XKMA 1KV4A 2RKLA 4OGQB 5APTA 2N1TC 1VQ9P 1T2KD 2I1JA 2OYHB 1ZP0C 2BCCG 3AE9C 1SQQE 3RK2B 1USDA 1G2CB 3RL0g 2Y9ZA 1LTJA 2WSEH 3HTKA 4GIFA 3CCVP 1OVRA 3I5CA 3L73G 3I56P 5L8RJ 4DZOA 3PH0A 1NAYA 1G1IA 4H44B 2H8PD 1FZEA 1GL2A 1K73Q 2E42A 2HPCB 4WY4D 1BGYJ 4JF7A 4GDOA 1LP1B 4H13B 3CCJP 4PV1D 3H1HJ 2I8DA 1IZNB 1NTZE 3N4XA 3RK3C 5B5EE 2D2CD 5CBOA 2KZIA 2IYPA 2PFXA 3GLMA 4KJMA 1LT9B 4M3LA 2A06D 1FZCB 3LW5J 1YBKA
chains in the Genus database with same CATH topology
1VPCA 2GUSA 3L37A 1SFCD 3RK3B 5AVSB 2J58A 1HWTC 3BATA 5CCHD 3L35A 3MGNA 2H43A 1RF0C 1CZQA 1IFDA 1CSBA 2YNYA 3EFGA 4LC1A 2BASA 2OARA 1GL2D 1HGVA 1T2KC 1LTJC 2W6AA 3MD0A 1GK6A 1L4AA 3KQGA 1LWUC 2GUVA 1M1JA 2E43A 2YO2A 1MFZA 3E1IA 3VMYA 1JY3N 5AW2B 1N7SD 2NPSC 3VP9A 1IFJA 1M1JC 2YKOA 1KILA 1N2DC 3V2QA 2P67A 5APVA 2FKWB 2CPBA 1H8AA 2QM7A 1A02F 5AW8B 1URQC 3BASA 5AVQB 4Y99C 5AVZB 4HH2A 2WSCH 3V4QA 2A45H 3H32B 1HGZA 2N1TA 5AW1B 2N1TB 2XDJA 1NKNA 2OYHA 5AVUB 2N9BA 1KZUB 1JY2P 1J1DC 1PFIA 4IFDK 2C0XA 1HTLC 3BRTB 1KFNA 1GL2C 1JY2O 3B8EB 1H88A 4W7ZA 1N7SC 2NPSD 1YTZI 4GT1A 5KJ7D 3U1CA 2OYIC 3A7OA 5AW7B 4EIJA 1L4AD 3HE4B 3VP8A 3HE4A 1URQD 3A5TA 1A02J 2HFED 1IC2A 1LTIC 2JJLA 1N73C 2OYIB 3A2AA 3M0AA 2POHA 1S9KD 1XTCC 1SFCB 3RK3D 4N3YB 2KB7P 3BRVB 3PP5A 1JTHB 2KSJA 2P1JA 5APSA 2L5GB 1SFCC 2CPSA 3NMDA 3L4FA 3NXSA 3RL0C 3O8ZA 5CCHC 5AVVB 3BVHA 1JCCA 2NPSA 1RE3A 1YTZT 3P8MC 4WB4A 1KFMA 1RF1C 4XE5B 4I1LA 2HODB 5AW4B 2YO3A 3IFMA 1JNMA 1J1DB 4IFFA 2P7JA 1WRGA 3B5ND 3HE5A 4ZKUA 2FFDB 2M3BA 5CHXA 2I1KA 2FYZA 3V2RA 5BU8B 2W27A 5KJ7C 2O1KA 4N78D 5AVRB 3M06A 2LKMA 2C9LY 3VMXA 3OAKA 1NTMK 1LT9C 1SFCA 1KILB 2WPSA 2KP8A 2XZRA 3OJAB 3TNUA 2IFNA 2WPQA 1SP4A 1CI6A 5APQA 3LW5H 5AVWB 5BU5A 3EQ2A 1FOSE 1M1JB 2KYVA 1FBMA 3VTPC 4LLHA 3U1AA 3M9BA 1LTBC 4AYCA 1AQ5A 5CCGA 3M0DC 4AUWA 3VN0A 5KTBA 3RL0D 5CCGC 1KILD 1NO4A 3TK1A 3MUDA 1MZ9A 1GU4A 1G1JA 1HBWA 1N7SA 2Q7CA 2FFDC 1J1EC 1RF1A 1X79B 4C7NB 5KLVK 1FZAA 3H6PA 4C7NA 2VRSA 1T8ZA 3HRNA 1QL1A 1J1EB 4N6JA 3KYQA 2HG5D 3B5NC 3R2PA 3HD7D 3LIDA 4DOJA 2WWWA 3RL0B 3V4WA 3GHGB 1GW4A 3T97A 3TYYA 1LTJB 1LTAC 5AVXB 4IFMA 3M0DA 2HPCA 1HH0A 1LTGC 3MTUE 1DEBA 5AW9B 1ZR2A 4EOTA 1E5WA 1FZCA 1MV8A 1L4AC 1RE3C 3HTKB 2W6BA 2Z5IA 1AFOA 3M9QA 4WY4B 3P8CE 2ZFCA 1GL2B 1CI6B 3CI9A 3U59A 1KILC 3HE5B 4LGDE 2FFDA 1Z56A 3HUSC 3KDPB 3B5NB 3RK2D 1L4AB 1NWQA 5KJ7A 5APYA 2QM8A 1DX7A 3V2NA 2R32A 2NPSB 3VMZA 1ZV8A 2H7HA 1NAFA 1OXZA 1LWUA 1SVFA 1NHLA 4RESB 1LGHB 1N86A 1FZBA 3NFQA 1FZFA 1L0NK 5CCHA 2WTYA 3C9IA 3L36A 1GU5A 2YMYA 1URQA 2Z5HA 3V2PA 2JEEA 2O01H 1FZCC 3HD7A 4WBAA 1SLQA 3II6A 1IFNA 4W7YA 1KQLA 3CL3D 1JMMA 2Q5UA 2WSFH 2C0WA 1SQBK 2A45G 1ZLLA 5AVYB 1S9KE 3UIAA 1X9VA 1LTTC 2OYIA 1LT9A 2GM4A 1G2CA 5CJ0A 3P8CD 1LWUB 3OA7A 1RF1B 3GHGA 3MIWA 5AW3B 1N7SB 1JOCA 5CCGD 4N78E 3LIEA 2Q3IA 1NH4A 1FJPA 1J2JB 1L0LK 1X8YA 5APXA 5CJ4A 2R3CA 1W2EA 2YKQA 1FZGA 1JY3P 3KPEA 1NTKK 4JYBA 1SQXK 3SWFA 2KOGA 3TSIA 1IK9A 1IFIA 1FU1A 3HD7C 1NKZB 1GDTA 1T3JA 5CMZA 1RY3A 4HYTB 3HUSA 1IFMA 4O9BA 4JYCA 3HUSB 1T3UA 3B5NA 1IO4A 1CW5A 3GHGC 3H32A 3A3YB 4I6MC 2C9NY 3P7KA 2WT7A 1NTZK 4WY4A 3WMM0 2IPPA 2HODA 4XA4A 2WITA 1SQPK 1RE4A 1JTHA 2HLOA 1HUCA 2KLVA 3VYIA 1FDMA 2M8RA 1QL2A 2FXMA 1GW3A 2IX7C 1JY2N 2R5BA 2WZ7A 1GD2E 4ZKPA 1N7LA 3VOPA 1OWAA 1WT6A 3CLQA 2FYUK 3M91A 1FAVA 3RK2C 1M7LA 5AW0B 5AW6B 1JO5A 1SQQK 3HD7B 2Z4EA 3IR9A 3V5BA 2A45I 2WPRA 1RF0A 2N1TD 1GZLA 2XV5A 5AW5B 2XNXA 2MJZA 2PP6A 2YKPA 1RE4C 1URQB 2R5DA 1YYCA 3G3ZA 1ZN5A 4B86A 1HVVA 1NU1K 2XU6A 1DH3A 5BVZA 2OYHC 4WY4C 1NOHA 1FOSF 2HYNA 5APWA 5AVTB 3SWYA 1IJDB 3NTNA 2IFMA 2PAJA 1JY3O 2Q9IA 1JUNA 3P32A 4I2LC 4W80A 1SQVK 2P2UA 2J59M 1VDFA 1HJBA 1EQ7A 2WT7B 1LTSC 2O1JA 2ZXEB 3TNUB 1N73B 4C7RA 1FJKA 4Y99B 1ZR4A 4KHXA 1GTWA 4OH8B 1GK4A 4C46A 1H89A 1XTGB 1JCDA 3N7NA 3M9HA 4AQRD 5APUA 1MUUA 4GKGA 1N73A 2XKMA 5APTA 2N1TC 1T2KD 2I1JA 2OYHB 3RK2B 1G2CB 1LTJA 2WSEH 3HTKA 4GIFA 3I5CA 4DZOA 1G1IA 2H8PD 1FZEA 1GL2A 2E42A 2HPCB 4WY4D 4JF7A 3N4XA 3RK3C 1LT9B 4M3LA 1FZCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQQ K;  2WSF H;  3M9Q A;  1SQB K;  2WSC H;  1SQV K;  1NTK K;  2J59 M;  1SQX K;  1SQP K;  2WSE H;  1L0N K;  2LKM A;  1NTM K;  2O01 H;  3G3Z A;  5KLV K;  1NU1 K;  3CLQ A;  4IFD K;  2FYU K;  2OAR A;  1L0L K;  3LW5 H;  1NTZ K; 
#chains in the Genus database with same CATH topology
 1VPC A;  2GUS A;  3L37 A;  1SFC D;  3RK3 B;  4RO0 A;  1KYO H;  3IF4 A;  3L74 J;  3L72 G;  1P84 H;  1DEE G;  3O6Q A;  2J58 A;  5AVS B;  3WUU A;  3CPW O;  1YIJ P;  2A06 G;  1HWT C;  3BAT A;  5CCH D;  3L35 A;  1BGY G;  1QVG O;  3CCE P;  1SQB E;  3MGN A;  2FY8 A;  4OVN F;  3AE1 C;  2H43 A;  2K9Y A;  1EDI A;  3H1I G;  1RF0 C;  2KZJ A;  1CZQ A;  3H1L E;  1IFD A;  1CSB A;  2YNY A;  3F89 A;  1VQ5 P;  1VF5 D;  3EFG A;  3H25 A;  4LC1 A;  2KXP B;  5KLV D;  3L71 G;  2BAS A;  2BCC D;  4H0L D;  3CCU P;  1PP9 G;  3CC2 P;  2K9J B;  2OAR A;  1RHZ B;  2KK7 A;  5DJU B;  1GL2 D;  3IAO A;  1DD4 A;  1HGV A;  1T2K C;  1LTJ C;  2GA1 A;  2QSI A;  1JM0 A;  2M0B A;  1VL2 A;  2W6A A;  2ZYG A;  3MD0 A;  1GK6 A;  4I7Z B;  3H1J J;  1L4A A;  3KQG A;  3L72 E;  1LWU C;  2NZ2 A;  2QJP B;  1KYO E;  2AXT H;  2GUV A;  1M1J A;  2OQQ A;  2E43 A;  2QVA A;  2YO2 A;  1M57 D;  1P84 E;  2JO1 A;  1MFZ A;  1QGK B;  1SQP D;  1JY3 N;  1ZW0 A;  2K88 A;  3E1I A;  5AW2 B;  4GOE A;  1NTK E;  2WSF J;  1N7S D;  2NPS C;  3TGU J;  2WVR A;  3RGU A;  1IFJ A;  5KAF E;  3VP9 A;  1SQV J;  1M1J C;  3CCQ P;  2YKO A;  2IBZ D;  1KIL A;  2QIW A;  1L0L G;  1EZV I;  4PV1 C;  1N2D C;  3V2Q A;  3V6I A;  2D2C C;  2P67 A;  2ZVO B;  5APV A;  3C8V A;  1NU1 D;  1ZME C;  2FKW B;  2CPB A;  3L75 J;  2Y0D A;  1H8A A;  2O3J A;  2M5A A;  3S9O A;  2QM7 A;  1A02 F;  1NTM E;  1EXJ A;  1OW6 A;  1PIX A;  1URQ C;  5AW8 B;  1M8O B;  3BAS A;  4Y99 C;  5AVQ B;  4HH2 A;  5AVZ B;  1JUN A;  2YIU B;  1X22 A;  1OVU A;  3CCS P;  1DD3 A;  4D6T G;  3L71 E;  3CWB G;  3SFE C;  1KB9 D;  2BCC E;  2MKV A;  2WSC H;  3V4Q A;  4YXD C;  3FX0 A;  2A45 H;  4YTP C;  4QMA A;  3VMA A;  3CD6 P;  2A06 E;  1PGP A;  2ZT9 B;  5GTI H;  2JWA A;  1L0N J;  3H32 B;  1U7M A;  1HGZ A;  3CX5 I;  4NPD A;  3L70 E;  1SQX D;  2N1T A;  5AW1 B;  1HJ0 A;  1Y47 A;  1KC8 Q;  2E74 B;  2M5A B;  2N1T B;  2XDJ A;  5GTH H;  1NKN A;  4DCK A;  2OYH A;  3AEE C;  5AVU B;  1VF5 C;  2N9B A;  1KZU B;  2QEX P;  2OGU A;  4U3F J;  2WSE J;  1JY2 P;  1J1D C;  1PGO A;  3H1K J;  1SQX G;  3Q2Y A;  1PFI A;  1SQB J;  4IFD K;  2C0X A;  1HTL C;  3BRT B;  2KSE A;  1KFN A;  1GL2 C;  4PD4 I;  1JY2 O;  1VQ4 P;  3BCC E;  1PGJ A;  3PHL A;  5TJH A;  2RMZ A;  5KLV J;  1W5C E;  4YXW H;  4JPZ B;  1P84 D;  1L0N G;  2N9Y B;  2LR2 A;  1L0N E;  2LXB A;  1PPJ D;  3CWB E;  2WMM A;  2L91 A;  2RN0 A;  3B8E B;  2WSS H;  1AVY A;  1JMB A;  1JEK A;  1SQQ G;  3H1L G;  3ITK A;  4W7Z A;  3C1L A;  1N7S C;  2NPS D;  4H0L B;  1YTZ I;  4DT0 A;  2PGD A;  4R4M A;  4GT1 A;  1SQB G;  2AXC A;  2FBW C;  3L72 D;  5KJ7 D;  3WUT A;  1KB9 E;  3JCU H;  4U3F E;  4CPG A;  3U1C A;  1YHQ P;  2OYI C;  1KOR A;  1NTM D;  1Q81 Q;  3A7O A;  5AW7 B;  3B71 A;  1L4A D;  3AE4 C;  3HE4 B;  4EIJ A;  1SQP J;  2ZT9 C;  3VP8 A;  1W2B O;  3HE4 A;  2ITA A;  4PJ0 H;  1URQ D;  5DJT B;  2KNC A;  1L0L J;  3A5T A;  2HFE D;  2QE7 H;  3H1I D;  1IC2 A;  1LTI C;  1EDK A;  2JJL A;  1N73 C;  3Q5P A;  2OYI B;  2QJY C;  3A2A A;  3AED C;  3M0A A;  2POH A;  2FXO A;  2ZYA A;  4H44 C;  1S9K D;  1NU1 E;  1VQL P;  3W68 A;  3PTZ A;  1XTC C;  2K9J A;  3RBZ A;  1OIP A;  1SFC B;  3GMA A;  4PD4 E;  5KAI E;  3RK3 D;  4N3Y B;  2KS1 B;  4K3A A;  2KB7 P;  3BRV B;  1S5L X;  4IL6 H;  3PP5 A;  1JTH B;  3FWL A;  3BCC D;  3CXH I;  2DW3 A;  2KSJ A;  2P1J A;  2P10 A;  5KLI C;  5APS A;  2L5G B;  4BWN A;  1SFC C;  2CPS A;  3NMD A;  3TDK A;  1OW7 A;  3L4F A;  3NXS A;  4HJG H;  3QWO C;  1IFP A;  3RL0 C;  1VQN P;  2QG4 A;  2BEQ D;  3L70 D;  3O8Z A;  5CCH C;  4BXL A;  1L0L E;  5AVV B;  3GF7 A;  3BVH A;  1JCC A;  2NPS A;  1YIT P;  1RE3 A;  1YTZ T;  1PPJ G;  2IYO A;  3P8M C;  3GG2 A;  4WB4 A;  1GMJ A;  2FXP A;  2JP3 A;  4U3F D;  1KFM A;  3ABV C;  3PRJ A;  1RF1 C;  4XE5 B;  1VF5 B;  2CK3 H;  4I1L A;  2HOD B;  1T6A A;  5AW4 B;  2FFD B;  3CME P;  1SQX E;  1FDI A;  2KUB A;  2YO3 A;  3IFM A;  1JNM A;  1BSH A;  2ZVN B;  1J1D B;  4IFF A;  2OTK E;  1AA0 A;  2P7J A;  2QJK B;  1WRG A;  2V4H A;  3B5N D;  3HE5 A;  4ZKU A;  4U3F G;  2M3B A;  5CHX A;  2I1K A;  2FYZ A;  2LXC B;  5C39 A;  3V2R A;  5BU8 B;  2W27 A;  1JB0 J;  3CXH H;  5KJ7 C;  1LJ2 A;  2O1K A;  3SFD C;  2WPV B;  1YQ3 C;  3GF3 A;  4N78 D;  3AEB C;  1PPJ E;  3CWB D;  2V7Q J;  5AVR B;  1BCC E;  1U7J A;  3M06 A;  2ZT9 D;  2LKM A;  2C9L Y;  3VMX A;  3OAK A;  1NTM K;  1LT9 C;  1RQU A;  1SFC A;  1KIL B;  2WPS A;  2E76 B;  2KP8 A;  2XZR A;  3OJA B;  3TNU A;  3AE8 C;  2QA4 P;  1YJW P;  2IFN A;  2HPC A;  2WPQ A;  4OGQ C;  3BCC G;  1SP4 A;  3W67 A;  1CI6 A;  1M1K Q;  3D70 A;  5APQ A;  1UIX A;  3LW5 H;  5AVW B;  4PV1 B;  5BU5 A;  3EQ2 A;  1FOS E;  4TLF A;  1M1J B;  2KYV A;  1FBM A;  2YXQ B;  3VTP C;  1NTZ D;  4LLH A;  3IN6 A;  1E79 H;  3U1A A;  2FYU J;  3CX5 E;  3M9B A;  1LTB C;  1RH5 B;  4HB1 A;  4AYC A;  1AQ5 A;  5KLV G;  5CCG A;  3M0D C;  3AEA C;  4AUW A;  2JKV A;  1PV3 A;  1NU1 G;  5EFW B;  3VN0 A;  1K8A Q;  4ZNC A;  5KTB A;  3L74 D;  2Q3E A;  3CXH D;  3RL0 D;  5CCG C;  1KIL D;  1NO4 A;  5KLV E;  3FGA D;  2YIU C;  1MZ9 A;  2Q1K A;  3MUD A;  1G1J A;  3TK1 A;  2W83 C;  5KAF H;  4RJT A;  1N7S A;  2Q7C A;  1NJI Q;  2FFD C;  1H0T A;  1J1E C;  1HBW A;  3KXD A;  1RF1 A;  1M56 D;  1X79 B;  1KN7 A;  1KQG B;  4C7N B;  5KLV K;  1FZA A;  3F5H A;  3FXD A;  4OWF A;  1QX8 A;  2H89 C;  3H6P A;  4C7N A;  2VRS A;  1T8Z A;  3HRN A;  1NTM G;  1QL1 A;  5TIS E;  4IL6 X;  1S5L H;  1BDD A;  1FC2 C;  1J1E B;  3AEC C;  4N6J A;  1PP9 J;  3KYQ A;  1S3J A;  2HG5 D;  2IZ0 A;  3B5N C;  3MZW B;  4YPC A;  2RH0 A;  3D6Z A;  3E7K A;  3HD7 D;  3AE2 C;  1SS1 A;  2WWW A;  3LID A;  3R2P A;  4DOJ A;  1BCC G;  1NTK D;  3L75 E;  3L72 J;  3RL0 B;  3V4W A;  5H2F E;  3CX5 H;  3GHG B;  4GOF A;  1KQF B;  1GW4 A;  3SWK A;  3RBX A;  3T97 A;  1Q2N A;  3TYY A;  1LTJ B;  2Y9Y A;  2ZJS E;  1VQP P;  1S1C X;  1LTA C;  5AVX B;  4IFM A;  3M0D A;  5CBN A;  2OTJ P;  1OX3 A;  3TGU E;  3PJS K;  3H1I J;  1EZV D;  3Q1M A;  3H1H G;  2FYN C;  4KT0 J;  3CWB J;  1HH0 A;  1LTG C;  2Y0C A;  3MTU E;  3AEF C;  1DEB A;  3L74 E;  5AW9 B;  2E5T A;  1SQV D;  4D6T D;  4PD4 H;  2QJK C;  5KKZ C;  5KAI H;  1PGQ A;  4EOT A;  1ZR2 A;  4XFJ A;  1E5W A;  1PP9 E;  3WU2 E;  2IZ1 A;  1MV8 A;  1BGY D;  1ZOY C;  1NU1 J;  1L4A C;  3L75 G;  1FZC A;  2D2C B;  3H1H D;  1RE3 C;  1BCC J;  3HTK B;  2W6B A;  2Z5I A;  1AFO A;  1PL5 A;  3M9Q A;  1SQV G;  4H13 C;  4WY4 B;  1QVF O;  3EWK A;  3H1K E;  2QJY B;  3P8C E;  4H44 D;  2ZFC A;  1GL2 B;  1CI6 B;  3CI9 A;  3JC2 2;  3U59 A;  2O01 J;  1KIL C;  2FYU D;  3HE5 B;  3L71 D;  1LP1 A;  1Z56 A;  3HUS C;  4LGD E;  3KDP B;  3CCR P;  4R4L A;  5E79 H;  3B5N B;  3PLN A;  3FXE A;  1VQK P;  3RK2 D;  1L4A B;  1L0N D;  1KB9 I;  1NWQ A;  1K9M Q;  5GTH E;  1A02 J;  4HKZ H;  5KJ7 A;  5APY A;  1EDL A;  2QM8 A;  3OW2 O;  1Q86 Q;  2M3E A;  1DX7 A;  3V2N A;  3AE6 C;  1KIL E;  1IK7 A;  2IDB A;  1NTK G;  2R32 A;  2NPS B;  3AE5 C;  1BE3 J;  3VMZ A;  3AE3 C;  4L76 A;  1ZV8 A;  2AEM A;  1NAF A;  2H7H A;  1OXZ A;  1LWU A;  1SQQ D;  1SVF A;  1NHL A;  3CXH E;  4RES B;  3S4R A;  1VQ7 P;  1LGH B;  1N86 A;  3A0H E;  1FZB A;  4NPF X;  3NFQ A;  4IL6 E;  4A7P A;  3TGU D;  1EDJ A;  1PP9 D;  2XND H;  1FZF A;  4K35 A;  3E1R A;  1Y8A A;  3L73 E;  2B9B A;  2YMK A;  1L0N K;  5CCH A;  3CC7 P;  3H1J D;  3MP7 B;  1FS0 E;  3L75 D;  2WTY A;  1RQV A;  3C9I A;  3L36 A;  4JQ0 D;  4L74 A;  4Y28 J;  4ZMD A;  1GU5 A;  2YMY A;  1URQ A;  1WMK A;  2Z5H A;  3V2P A;  2JEE A;  2O01 H;  5B5E H;  1FZC C;  3HD7 A;  3H1H E;  1AQT A;  4WBA A;  1SLQ A;  3II6 A;  1IFN A;  4PJ0 E;  3QH9 A;  1MFT A;  2E75 D;  1MKM A;  4W7Y A;  2G3A A;  3G9R A;  1KQL A;  4IOI H;  3Q5R A;  2IBZ G;  2W6J H;  1L0L D;  1JMM A;  3CL3 D;  2E76 D;  2Q5U A;  2WSF H;  2C0W A;  1Q82 Q;  1BSN A;  4OGQ D;  1SQB K;  2A45 G;  1ZLL A;  4Z1M H;  5AVY B;  1S9K E;  2KIK A;  1OVV A;  2K37 A;  3UIA A;  1X9V A;  3D6Y A;  1LTT C;  2E75 B;  2OYI A;  2B87 B;  3L70 G;  4UB8 H;  4PD4 D;  3KZI E;  3RK3 E;  5B66 H;  1LT9 A;  2B87 A;  1U57 A;  1ZRT E;  1SQV E;  2QRX A;  1G2C A;  2GM4 A;  3H1K D;  5CJ0 A;  3P8C D;  5K5G B;  1Q90 D;  2BCC J;  1LWU B;  3OA7 A;  1RF1 B;  2FYU E;  3GHG A;  3MIW A;  5AW3 B;  5TIS H;  1SQX J;  2J5U A;  1N7S B;  3SSU A;  1JOC A;  5CCG D;  4N78 E;  4L75 A;  3LIE A;  2Q3I A;  1R5L A;  2B88 A;  1NH4 A;  3H1L D;  3G6E P;  1FJP A;  1J2J B;  2OYO A;  3AE7 C;  1L0L K;  1EZV G;  3S1K A;  4EYY Q;  1X8Y A;  1EC5 A;  2KNC B;  1DIP A;  5APX A;  1D7M A;  1SQB D;  2H88 C;  2W90 A;  3EFF K;  1FDO A;  1BE3 D;  1KMI Z;  5CJ4 A;  2R3C A;  1W2E A;  2YKQ A;  3A0B E;  4ASV A;  1VQO P;  1FZG A;  2E74 D;  1JY3 P;  3KPE A;  1NTK K;  4JYB A;  2OTL P;  1SQX K;  2HR3 A;  2KLU A;  3SWF A;  1Y9B A;  2IBZ E;  2KOG A;  3TSI A;  1IK9 A;  1BE3 G;  1IFI A;  4U7J A;  1OFC X;  1FU1 A;  1NTZ G;  3HD7 C;  1NKZ B;  1GDT A;  4D6T J;  1T3J A;  5CMZ A;  1RY3 A;  4JBZ A;  4DJG A;  4HYT B;  2K1A A;  5B66 E;  1X0T A;  2K3R A;  3HUS A;  1L2P A;  1IFM A;  4O9B A;  2FYU G;  4JYC A;  3CC4 P;  4EI2 A;  1KD1 Q;  2BEZ F;  2E75 C;  1T3U A;  1SQP G;  2NRG A;  3HUS B;  2R44 A;  1BCC D;  1ZRT D;  3B5N A;  1GU4 A;  1IO4 A;  1CW5 A;  1QEX A;  1K05 A;  1OW8 A;  3GHG C;  3H32 A;  2JR8 A;  3A3Y B;  4I6M C;  1Q7Y Q;  3K5B A;  1BDC A;  2C9N Y;  3P7K A;  2WT7 A;  1NTZ K;  3BCC J;  1R5S A;  4WY4 A;  1SQP E;  1KYO I;  4WVZ A;  3L74 G;  5M1B A;  3WMM 0;  2IPP A;  2HOD A;  1LT1 A;  1UII A;  1USE A;  2AEJ A;  2WIT A;  1LNQ A;  4XA4 A;  3T97 B;  1R8E A;  1KQS O;  2ZXX A;  1TU3 F;  1SQP K;  2AXT E;  1RE4 A;  3AEG C;  1JTH A;  2HLO A;  1HUC A;  2KLV A;  4RKU J;  5H2F H;  3VYI A;  2M8R A;  3CX5 D;  5KKZ B;  1FDM A;  1S2E A;  1NGM B;  1QL2 A;  2FXM A;  1GW3 A;  2IX7 C;  1JY2 N;  2R5B A;  4H13 D;  1AV1 A;  2WZ7 A;  3TGU G;  3USS A;  1GD2 E;  1H88 A;  3KHU A;  4ZKP A;  1N7L A;  3VOP A;  2PRR A;  3ZDM A;  1OWA A;  1SQQ J;  3G4S P;  1WT6 A;  2ZYD A;  2AEF A;  3CLQ A;  1S4X A;  3L73 J;  2FYU K;  3M91 A;  1FAV A;  4I7Z C;  3A0H H;  3RK2 C;  3L70 J;  2JWD A;  1M7L A;  2KS1 A;  5AW0 B;  5AW6 B;  1M90 Q;  1AJY A;  1S5L E;  2JDI H;  1SQQ K;  3HD7 B;  1AVO A;  1JO5 A;  2E74 C;  1OMI A;  2Z4E A;  3O6Q B;  2IBZ I;  2O01 N;  3FWN A;  3H1K G;  1P84 I;  3R4Y A;  3CMA P;  3H1I E;  3IR9 A;  4WWI A;  4EDF A;  3CCM P;  3Q3D A;  1EXI A;  4NPE A;  3V5B A;  5GTI E;  2A45 I;  2WPR A;  2Q6Q A;  3WUV A;  1BGY E;  1RF0 A;  2N1T D;  1VQ8 P;  1NTM J;  1BE3 E;  2UWJ E;  1GZL A;  2XV5 A;  1YJ9 P;  1NTK J;  5AW5 B;  2XNX A;  1FE6 A;  2MJZ A;  2PP6 A;  2SPZ A;  2YKP A;  1RE4 C;  1URQ B;  3VMY A;  4BRY B;  2R5D A;  3CCL P;  2Y0E A;  2P58 A;  1YYC A;  3B4S A;  3G3Z A;  1ZN5 A;  3GW6 A;  1HVV A;  4B86 A;  1YJN P;  1NU1 K;  1YQ4 C;  2XU6 A;  5BVZ A;  1NTZ J;  2OYH C;  1DH3 A;  4WY4 C;  1K04 A;  1H0T B;  4TT3 H;  1EZV E;  1NOH A;  4UB6 E;  4BRY A;  2HYN A;  5APW A;  1S72 P;  5AVT B;  3SWY A;  1N8R Q;  1FOS F;  3D71 A;  1IJD B;  2V7Q H;  3NTN A;  3WU2 H;  3JSV C;  2IFM A;  2PAJ A;  1JY3 O;  1OZH A;  2E5Y A;  4D6T E;  3P32 A;  4ASW A;  4UB8 E;  1YI2 P;  2Q9I A;  3KZI H;  4I2L C;  1NYH A;  4W80 A;  2YXR B;  1SQV K;  3G71 P;  2P2U A;  2B89 A;  2J59 M;  1VQM P;  1NVO A;  1VDF A;  2WQY C;  1HJB A;  1EQ7 A;  2FYN B;  2E76 C;  2WT7 B;  1LTS C;  2O1J A;  2ZXE B;  3TNU B;  1N73 B;  4C7R A;  1KB9 H;  1PZQ A;  1ZXG A;  2G8Y A;  2R3S A;  3JCU E;  3MHV A;  5E79 E;  1FJK A;  1QLE D;  4Y99 B;  2QJP C;  3H1L J;  4KHX A;  1ZR4 A;  3L71 J;  4MN4 C;  1GTW A;  1KYO D;  3Q5S A;  1HF9 A;  2W8Z A;  4OH8 B;  2ZAE B;  3TF5 A;  1VQ6 P;  4L73 A;  3MUD C;  3H1J E;  2WSC J;  1GK4 A;  3H1J G;  5KLI B;  3A0B H;  4C46 A;  1KTM A;  1H89 A;  4H0L C;  1XTG B;  1JCD A;  3N7N A;  3I55 P;  2FFD A;  3M9H A;  2KI7 B;  4UB6 H;  4AQR D;  5APU A;  3L73 D;  1MUU A;  4GKG A;  4GOD A;  1N73 A;  2XKM A;  1KV4 A;  2RKL A;  4OGQ B;  5APT A;  2N1T C;  1VQ9 P;  1T2K D;  2I1J A;  2OYH B;  1ZP0 C;  2BCC G;  3AE9 C;  1SQQ E;  3RK2 B;  1USD A;  1G2C B;  3RL0 g;  2Y9Z A;  1LTJ A;  2WSE H;  3HTK A;  4GIF A;  3CCV P;  1OVR A;  3I5C A;  3L73 G;  3I56 P;  5L8R J;  4DZO A;  3PH0 A;  1NAY A;  1G1I A;  4H44 B;  2H8P D;  1FZE A;  1GL2 A;  1K73 Q;  2E42 A;  2HPC B;  4WY4 D;  1BGY J;  4JF7 A;  4GDO A;  1LP1 B;  4H13 B;  3CCJ P;  4PV1 D;  3H1H J;  2I8D A;  1IZN B;  1NTZ E;  3N4X A;  3RK3 C;  5B5E E;  2D2C D;  5CBO A;  2KZI A;  2IYP A;  2PFX A;  3GLM A;  4KJM A;  1LT9 B;  4M3L A;  2A06 D;  1FZC B;  3LW5 J;  1YBK A; 
#chains in the Genus database with same CATH homology
 1VPC A;  2GUS A;  3L37 A;  1SFC D;  3RK3 B;  5AVS B;  2J58 A;  1HWT C;  3BAT A;  5CCH D;  3L35 A;  3MGN A;  2H43 A;  1RF0 C;  1CZQ A;  1IFD A;  1CSB A;  2YNY A;  3EFG A;  4LC1 A;  2BAS A;  2OAR A;  1GL2 D;  1HGV A;  1T2K C;  1LTJ C;  2W6A A;  3MD0 A;  1GK6 A;  1L4A A;  3KQG A;  1LWU C;  2GUV A;  1M1J A;  2E43 A;  2YO2 A;  1MFZ A;  3E1I A;  3VMY A;  1JY3 N;  5AW2 B;  1N7S D;  2NPS C;  3VP9 A;  1IFJ A;  1M1J C;  2YKO A;  1KIL A;  1N2D C;  3V2Q A;  2P67 A;  5APV A;  2FKW B;  2CPB A;  1H8A A;  2QM7 A;  1A02 F;  5AW8 B;  1URQ C;  3BAS A;  5AVQ B;  4Y99 C;  5AVZ B;  4HH2 A;  2WSC H;  3V4Q A;  2A45 H;  3H32 B;  1HGZ A;  2N1T A;  5AW1 B;  2N1T B;  2XDJ A;  1NKN A;  2OYH A;  5AVU B;  2N9B A;  1KZU B;  1JY2 P;  1J1D C;  1PFI A;  4IFD K;  2C0X A;  1HTL C;  3BRT B;  1KFN A;  1GL2 C;  1JY2 O;  3B8E B;  1H88 A;  4W7Z A;  1N7S C;  2NPS D;  1YTZ I;  4GT1 A;  5KJ7 D;  3U1C A;  2OYI C;  3A7O A;  5AW7 B;  4EIJ A;  1L4A D;  3HE4 B;  3VP8 A;  3HE4 A;  1URQ D;  3A5T A;  1A02 J;  2HFE D;  1IC2 A;  1LTI C;  2JJL A;  1N73 C;  2OYI B;  3A2A A;  3M0A A;  2POH A;  1S9K D;  1XTC C;  1SFC B;  3RK3 D;  4N3Y B;  2KB7 P;  3BRV B;  3PP5 A;  1JTH B;  2KSJ A;  2P1J A;  5APS A;  2L5G B;  1SFC C;  2CPS A;  3NMD A;  3L4F A;  3NXS A;  3RL0 C;  3O8Z A;  5CCH C;  5AVV B;  3BVH A;  1JCC A;  2NPS A;  1RE3 A;  1YTZ T;  3P8M C;  4WB4 A;  1KFM A;  1RF1 C;  4XE5 B;  4I1L A;  2HOD B;  5AW4 B;  2YO3 A;  3IFM A;  1JNM A;  1J1D B;  4IFF A;  2P7J A;  1WRG A;  3B5N D;  3HE5 A;  4ZKU A;  2FFD B;  2M3B A;  5CHX A;  2I1K A;  2FYZ A;  3V2R A;  5BU8 B;  2W27 A;  5KJ7 C;  2O1K A;  4N78 D;  5AVR B;  3M06 A;  2LKM A;  2C9L Y;  3VMX A;  3OAK A;  1NTM K;  1LT9 C;  1SFC A;  1KIL B;  2WPS A;  2KP8 A;  2XZR A;  3OJA B;  3TNU A;  2IFN A;  2WPQ A;  1SP4 A;  1CI6 A;  5APQ A;  3LW5 H;  5AVW B;  5BU5 A;  3EQ2 A;  1FOS E;  1M1J B;  2KYV A;  1FBM A;  3VTP C;  4LLH A;  3U1A A;  3M9B A;  1LTB C;  4AYC A;  1AQ5 A;  5CCG A;  3M0D C;  4AUW A;  3VN0 A;  5KTB A;  3RL0 D;  5CCG C;  1KIL D;  1NO4 A;  3TK1 A;  3MUD A;  1MZ9 A;  1GU4 A;  1G1J A;  1HBW A;  1N7S A;  2Q7C A;  2FFD C;  1J1E C;  1RF1 A;  1X79 B;  4C7N B;  5KLV K;  1FZA A;  3H6P A;  4C7N A;  2VRS A;  1T8Z A;  3HRN A;  1QL1 A;  1J1E B;  4N6J A;  3KYQ A;  2HG5 D;  3B5N C;  3R2P A;  3HD7 D;  3LID A;  4DOJ A;  2WWW A;  3RL0 B;  3V4W A;  3GHG B;  1GW4 A;  3T97 A;  3TYY A;  1LTJ B;  1LTA C;  5AVX B;  4IFM A;  3M0D A;  2HPC A;  1HH0 A;  1LTG C;  3MTU E;  1DEB A;  5AW9 B;  1ZR2 A;  4EOT A;  1E5W A;  1FZC A;  1MV8 A;  1L4A C;  1RE3 C;  3HTK B;  2W6B A;  2Z5I A;  1AFO A;  3M9Q A;  4WY4 B;  3P8C E;  2ZFC A;  1GL2 B;  1CI6 B;  3CI9 A;  3U59 A;  1KIL C;  3HE5 B;  4LGD E;  2FFD A;  1Z56 A;  3HUS C;  3KDP B;  3B5N B;  3RK2 D;  1L4A B;  1NWQ A;  5KJ7 A;  5APY A;  2QM8 A;  1DX7 A;  3V2N A;  2R32 A;  2NPS B;  3VMZ A;  1ZV8 A;  2H7H A;  1NAF A;  1OXZ A;  1LWU A;  1SVF A;  1NHL A;  4RES B;  1LGH B;  1N86 A;  1FZB A;  3NFQ A;  1FZF A;  1L0N K;  5CCH A;  2WTY A;  3C9I A;  3L36 A;  1GU5 A;  2YMY A;  1URQ A;  2Z5H A;  3V2P A;  2JEE A;  2O01 H;  1FZC C;  3HD7 A;  4WBA A;  1SLQ A;  3II6 A;  1IFN A;  4W7Y A;  1KQL A;  3CL3 D;  1JMM A;  2Q5U A;  2WSF H;  2C0W A;  1SQB K;  2A45 G;  1ZLL A;  5AVY B;  1S9K E;  3UIA A;  1X9V A;  1LTT C;  2OYI A;  1LT9 A;  2GM4 A;  1G2C A;  5CJ0 A;  3P8C D;  1LWU B;  3OA7 A;  1RF1 B;  3GHG A;  3MIW A;  5AW3 B;  1N7S B;  1JOC A;  5CCG D;  4N78 E;  3LIE A;  2Q3I A;  1NH4 A;  1FJP A;  1J2J B;  1L0L K;  1X8Y A;  5APX A;  5CJ4 A;  2R3C A;  1W2E A;  2YKQ A;  1FZG A;  1JY3 P;  3KPE A;  1NTK K;  4JYB A;  1SQX K;  3SWF A;  2KOG A;  3TSI A;  1IK9 A;  1IFI A;  1FU1 A;  3HD7 C;  1NKZ B;  1GDT A;  1T3J A;  5CMZ A;  1RY3 A;  4HYT B;  3HUS A;  1IFM A;  4O9B A;  4JYC A;  3HUS B;  1T3U A;  3B5N A;  1IO4 A;  1CW5 A;  3GHG C;  3H32 A;  3A3Y B;  4I6M C;  2C9N Y;  3P7K A;  2WT7 A;  1NTZ K;  4WY4 A;  3WMM 0;  2IPP A;  2HOD A;  4XA4 A;  2WIT A;  1SQP K;  1RE4 A;  1JTH A;  2HLO A;  1HUC A;  2KLV A;  3VYI A;  1FDM A;  2M8R A;  1QL2 A;  2FXM A;  1GW3 A;  2IX7 C;  1JY2 N;  2R5B A;  2WZ7 A;  1GD2 E;  4ZKP A;  1N7L A;  3VOP A;  1OWA A;  1WT6 A;  3CLQ A;  2FYU K;  3M91 A;  1FAV A;  3RK2 C;  1M7L A;  5AW0 B;  5AW6 B;  1JO5 A;  1SQQ K;  3HD7 B;  2Z4E A;  3IR9 A;  3V5B A;  2A45 I;  2WPR A;  1RF0 A;  2N1T D;  1GZL A;  2XV5 A;  5AW5 B;  2XNX A;  2MJZ A;  2PP6 A;  2YKP A;  1RE4 C;  1URQ B;  2R5D A;  1YYC A;  3G3Z A;  1ZN5 A;  4B86 A;  1HVV A;  1NU1 K;  2XU6 A;  1DH3 A;  5BVZ A;  2OYH C;  4WY4 C;  1NOH A;  1FOS F;  2HYN A;  5APW A;  5AVT B;  3SWY A;  1IJD B;  3NTN A;  2IFM A;  2PAJ A;  1JY3 O;  2Q9I A;  1JUN A;  3P32 A;  4I2L C;  4W80 A;  1SQV K;  2P2U A;  2J59 M;  1VDF A;  1HJB A;  1EQ7 A;  2WT7 B;  1LTS C;  2O1J A;  2ZXE B;  3TNU B;  1N73 B;  4C7R A;  1FJK A;  4Y99 B;  1ZR4 A;  4KHX A;  1GTW A;  4OH8 B;  1GK4 A;  4C46 A;  1H89 A;  1XTG B;  1JCD A;  3N7N A;  3M9H A;  4AQR D;  5APU A;  1MUU A;  4GKG A;  1N73 A;  2XKM A;  5APT A;  2N1T C;  1T2K D;  2I1J A;  2OYH B;  3RK2 B;  1G2C B;  1LTJ A;  2WSE H;  3HTK A;  4GIF A;  3I5C A;  4DZO A;  1G1I A;  2H8P D;  1FZE A;  1GL2 A;  2E42 A;  2HPC B;  4WY4 D;  4JF7 A;  3N4X A;  3RK3 C;  1LT9 B;  4M3L A;  1FZC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...