1SQXE

Crystal structure analysis of bovine bc1 with stigmatellin a
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
molecule tags Oxidoreductase
total genus 45
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2004-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1sqxE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1sqxE02
1ULJA 2GBWA 4NB9D 4NBHD 2E4QA 2YFLA 1BCCE 2NVFA 1FQTA 4P1BH 1Q90C 2E75D 3GZYA 3D89A 4HM0A 1KYOE 1NU1E 4HM6A 1SJGA 2DE7D 1EZVE 3BCCE 2D2CD 2YFIA 2YIUC 3L74E 2BMOA 3CXHE 2XR8A 4HM1A 3EQQA 2NUMA 1O7HA 4AAYB 3CWBE 2HMJA 1BGYE 3GZXA 2E4PA 2E76D 4QDFA 5KLIC 2BMRA 2HMKA 3H1KE 4QUPA 1SQVE 2QJKC 2FYNC 2JZAA 4H44D 2YVJB 2CKFA 3VMID 2XSOA 2ZT9D 1VCKA 4NBFD 4HKVA 1KB9E 3GOBA 4HM5A 1O7MA 3EN1A 1O7NA 1VM9A 3VMHD 1SQXE 1NTZE 2QJPC 4QCKA 2Q3WA 3GL0A 4H13D 1EG9A 3H1HE 4NBBD 4QURA 4AIVA 2XRXA 4HM2A 3L73E 4HM7A 3GL2A 1UUWA 3FOUA 4PD4E 2GBXA 2QPZA 1ZRTE 5HL4A 2B24A 1RIEA 4D6TE 4HM8A 4NBGD 1NTKE 3H1IE 1NYKA 3GTEA 2BCCE 2HMLA 3H1JE 4NB8D 1WQLA 3C0DA 1PPJE 4HJLA 4NBED 3VCAA 1SQQE 5KLVE 3DQYA 4PV1D 2ZYLA 4P1CH 2I7FA 1O7PA 4H0LD 1O7WA 1G8KB 4QDDA 4QUQA 1NTME 2NVEA 1RFSA 5KKZC 5CXMA 2E74D 2NUKA 1L0NE 4U3FE 3L70E 3TGUE 4QDCA 3N0QA 1JM1A 3VMGD 1SQBE 4NBAD 1G8JB 4NBCD 2IBZE 1BE3E 2YFJA 5BOKA 1SQPE 4OGQD 2DE6D 3L71E 1VF5D 1P84E 3GTSA 4HM4A 2HMOA 3GB4A 3H1LE 3L75E 1O7GA 3GCEA 2NVGA 4NBDD 3VCPA 2DE5D 2JO6A 4HM3A 3L72E 4QDFB 3AZCA 2FYUE 2QJYC 2HMMA 1L0LE 2BMQA 2A06E 3CX5E 1NDOA 1UUVA 2NWFA 3GKEA 1ULIA 2XSHA 5AEUA 2HMNA 1PP9E 2B1XA 4EMJB 5AEWA
chains in the Genus database with same CATH superfamily
1T2KD 3H1HG 2E4QA 1PL5A 5H2FH 1SQPD 1RH5B 1R8EA 2QM7A 2K9YA 1KILD 1DEEG 5E79H 2JZAA 2LR2A 1KORA 4H13B 3IR9A 3L71G 1NKZB 4HKVA 3GOBA 1SQQG 4IL6E 2CPSA 1PP9J 1JB0J 2ZJSE 1NTMG 1X9VA 1N7SB 3L73E 3TGUG 3A0HH 2OYOA 1LTSC 3BRVB 3CWBJ 1R5SA 5AW5B 2NPSA 1JY2N 2V4HA 3GHGC 3KYQA 1RY3A 2E74B 2NZ2A 3MIWA 2M3EA 2QEXP 1SFCC 1SQXJ 1IFJA 3F89A 3RGUA 5KAFH 1VDFA 1W2BO 1EDIA 3AE1C 4ZKUA 3RK3D 1SQVK 4NBCD 3EQ2A 1LP1A 3L73G 1RE3A 2I1KA 1SQPE 1KQFB 2MKVA 5TJHA 1CW5A 2P7JA 3MUDC 1M7LA 3RL0D 1CSBA 4OWFA 4XE5B 1UUVA 1NDOA 2XSHA 1GK6A 5AEWA 3NMDA 1ULJA 1KILB 2Y9ZA 2YMYA 4HYTB 1BE3D 2WSEH 4DCKA 1LT9A 2WT7A 1BSNA 1GD2E 2K3RA 1T3UA 3OW2O 1IFNA 2QJKC 3L72D 1L0LD 5AVRB 1CI6A 5DJTB 3Q5SA 1BCCD 1HWTC 1Y9BA 1LTTC 1OFCX 3H32A 3CXHD 3FOUA 2ZT9C 3A7OA 3RK3E 1RIEA 2Y0CA 1URQD 2IBZG 2WQYC 3EWKA 4HJGH 4GT1A 3L36A 2K1AA 1AJYA 1IZNB 1M1JC 3H1JD 1LNQA 3G6EP 1Q7YQ 1PGJA 5GTHH 3G3ZA 1NU1K 2I7FA 5M1BA 1A02J 3H1HJ 5AVWB 1SLQA 3M0DC 2R5BA 3PHLA 3H1ID 4HB1A 3RL0B 1BE3E 1W5CE 5BOKA 2R3CA 3USSA 4H0LC 2H7HA 3GTSA 3SWYA 2DW3A 3HE4A 3L71J 3QH9A 1X8YA 3L72E 2QJYC 1SQQJ 1L0LE 2HMMA 5B5EH 1G2CA 1NTMJ 1NTZG 1ZLLA 3U1AA 1BCCE 1CZQA 4P1BH 1Q90C 1LTBC 3TGUJ 5KAFE 2HLOA 4HM0A 1LJ2A 3CXHE 1QL2A 3EQQA 3CC4P 2O01J 1DH3A 1ZXGA 1OX3A 4M3LA 1HF9A 2P58A 1ZW0A 2E75C 2M5AA 2CKFA 2O01N 5CCGD 1O7MA 1IK9A 2PRRA 3L72G 4QCKA 1KN7A 1URQB 1ZR2A 4UB6H 2JP3A 4HM2A 1L0NG 3KPEA 1L4AD 1BCCG 2FFDA 3L73J 3IN6A 2XDJA 2YXQB 1OMIA 1RF0C 2GA1A 1NTMK 2JR8A 3H1IE 3D71A 1NYKA 1FZGA 2PP6A 1NWQA 2N1TA 3LIEA 4XFJA 1YJWP 2WMMA 4PV1D 3S1KA 2NVEA 1KQGB 1LWUB 1H8AA 1J1EC 1NTKD 2BCCD 1VF5D 2QM8A 1IC2A 2IPPA 1QLED 2HMOA 1MFTA 1YQ3C 1KTMA 5CCHD 3EFFK 1FZCA 1HBWA 1YBKA 1ULIA 5APSA 1QL1A 2WZ7A 3CLQA 3HUSB 1NO4A 1AVOA 3AE5C 3D89A 1N73A 2YIUC 2BMOA 2RH0A 1M1KQ 3LW5J 4AAYB 4RESB 1K73Q 3SFDC 3BASA 2E4PA 3L75D 4H44D 3VOPA 1VPCA 2XSOA 4GIFA 1ZR4A 1L4AB 2WPQA 2AEJA 3GMAA 4WVZA 3CL3D 3CCVP 1NHLA 3FGAD 1SQPK 1KD1Q 1RQVA 3C8VA 2B87A 1KMIZ 3D70A 3V2RA 1NTKE 3GTEA 1USEA 4PV1B 5TISH 2BCCE 1VQOP 2BEZF 5AVSB 1FZAA 2C9LY 1NTZJ 1NOHA 1G8KB 1KFMA 1GL2D 2BEQD 4JQ0D 1FS0E 1VQLP 1VF5B 2W83C 2W6BA 2Y0EA 2W90A 1S2EA 1DIPA 2ZXXA 4C7NB 1NH4A 1SQVG 5KLIB 3IF4A 3L75E 3GCEA 3CCUP 3WUUA 2M3BA 4HM3A 4A7PA 4ASWA 5GTIH 4YPCA 3L72J 4Y99C 1EDJA 1NAYA 4C46A 1LTJC 5AW9B 1GMJA 1DD4A 1L0NJ 3HD7C 5AW8B 2WTYA 1BCCJ 1RE4A 4H44B 4HH2A 4HM1A 1AQ5A 3S9OA 1NTZK 3R4YA 1FOSF 1S5LX 1JCCA 2RMZA 3E7KA 2HPCB 2UWJE 2M8RA 1EDLA 2KK7A 2FYUD 3VMID 2HFED 1H0TA 3ITKA 1IFDA 3L75G 2OTKE 1O7NA 3CX5H 1YI2P 1OVUA 3AEDC 3GL0A 1EG9A 2XRXA 3BCCD 4CPGA 2GBXA 1SFCD 3HTKB 4B86A 2QIWA 4WY4A 1L0LK 1D7MA 2HMLA 1GL2B 2GM4A 2QRXA 1SS1A 3D6ZA 1H89A 2OYHB 4DZOA 1BSHA 2A06G 3JCUE 1K04A 4IFFA 1O7PA 1N7LA 2B9BA 5CXMA 2HODB 4QMAA 1KYOH 5C39A 3MTUE 1NU1G 4DT0A 2Q5UA 2G8YA 2OYIA 4NBAD 1AV1A 2YKPA 1LTGC 3Q3DA 1TU3F 5AW2B 1Q81Q 2HR3A 2ZFCA 2FYUE 3CCEP 2Q6QA 1RF1C 1NYHA 3Q2YA 5AVVB 2P67A 4U3FD 3L70D 3A0BH 3SFEC 3TF5A 1S5LE 3GF3A 2KP8A 4OVNF 3BCCE 2NUMA 2OYHC 2HMJA 4NPEA 2O1JA 3LW5H 2HMKA 3O6QB 2Z4EA 3Q5PA 1P84H 3GHGB 3B5NC 2ZT9D 1T3JA 1SFCB 5APQA 2WPSA 2P10A 2G3AA 1KYOD 1HGVA 1YJNP 1L2PA 2JWDA 5APTA 4EOTA 1VQ4P 4LLHA 1X79B 4HM8A 3RBZA 3BCCG 5AW3B 1K9MQ 1SQVJ 5AVZB 2W6JH 2WPRA 2H43A 5KJ7C 1GW4A 2OTLP 3IFMA 2XZRA 2KZJA 1N7SA 3VCAA 4PJ0H 4QDDA 3N7NA 4H0LD 1O7WA 3WUVA 1KFNA 4JBZA 1A02F 4U3FE 1FJKA 3L70E 1ZN5A 1JM1A 2Y0DA 4I1LA 2IZ1A 1MKMA 3AE9C 3TYYA 1Q90D 1VL2A 2QJKB 1LT1A 2WSFJ 1X0TA 3AEGC 1VQ6P 3GKEA 3NXSA 3KQGA 2C0WA 1VQMP 2HMNA 2YKOA 3P7KA 2A45H 4OGQC 1NTKK 2E75D 2FYZA 1YYCA 3B71A 1KYOE 1YTZI 2XR8A 1KILE 2ZT9B 1JTHB 1IFIA 2QVAA 3H1LD 3I55P 2FYNC 3AECC 2AXTH 1M1JB 2K9JB 1G1IA 2RKLA 4BXLA 1KILA 1J1DC 1HTLC 1Q82Q 1NU1J 1UUWA 1XTGB 3II6A 3CCSP 5CJ4A 2KZIA 1SQPG 5KAIE 4H0LB 1IO4A 2NPSC 1FDOA 2W8ZA 4GDOA 1N2DC 2QJYB 3UIAA 4NPDA 1KC8Q 5AVXB 5H2FE 4D6TD 5CBOA 2MJZA 2ZYAA 5E79E 3TNUB 1RE3C 4GOEA 2V7QH 3H1LE 3C1LA 3NTNA 2JO6A 1MFZA 2E75B 2HYNA 2ZVNB 1S72P 4PJ0E 2FXPA 4NB9D 3A0HE 4RO0A 2OTJP 1SQBD 2YFIA 1SP4A 3CD6P 1LT9C 3PJSK 3BCCJ 3Q5RA 2CPBA 3M91A 1JEKA 3VMAA 3CMEP 3RK2B 3CCRP 4WWIA 1J1EB 5AW7B 2VRSA 3TDKA 3FWLA 3L37A 4D6TE 1UIIA 1BE3G 3KZIH 2PFXA 2FYUK 3PP5A 3E1RA 3FX0A 3H1JE 3B4SA 1S9KD 2KLUA 3L4FA 1QX8A 1YJ9P 3C0DA 2AXTE 1L0LG 1URQA 1J2JB 1BDCA 1KB9H 1KZUB 1GTWA 1SQBE 2L5GB 3A2AA 1WMKA 2JEEA 3M9HA 4TLFA 2YIUB 5APVA 2DE6D 3RK2C 1R5LA 3HD7D 2KLVA 3HE5A 1VQ5P 4NBDD 2Q7CA 3D6YA 2WSCJ 3H1JG 1DEBA 1LWUA 4EMJB 1EXJA 2YO2A 3KHUA 3V4QA 1OW6A 2KIKA 3MP7B 4RKUJ 4GOFA 3GZYA 2H89C 3A5TA 3P8MC 1SQPJ 1K05A 1OVRA 2PAJA 2I8DA 3H1IG 2FKWB 3WU2H 1VQ8P 3CX5I 3C9IA 1FDIA 4YXDC 5GTHE 1S9KE 3IAOA 1PZQA 1PP9D 1RQUA 3HUSA 3OA7A 2QJPC 1JOCA 4C7RA 2RN0A 2E76C 4LC1A 5CCGA 3CWBD 4UB8H 2FFDC 1AVYA 3H1KD 5B66H 4N6JA 1YTZT 1JM0A 3P8CD 1WQLA 3AE3C 5B5EE 1L4AA 2N1TC 4K35A 2YO3A 4EYYQ 1SQXD 1KYOI 3DQYA 1QVFO 2KS1B 1HJBA 4Y99B 1RFSA 1LTJB 2NUKA 1HGZA 3AEAC 1ZRTD 3HD7B 3SWKA 3FWNA 2J5UA 1FOSE 4PD4H 1EDKA 4AYCA 2Q9IA 4LGDE 3M0AA 1KQSO 1O7GA 1MUUA 2DE5D 3VCPA 2E5YA 3AZCA 1IFPA 4UB6E 1PP9E 1FZCC 4ASVA 2R32A 2GBWA 3M9QA 1M90Q 2KUBA 3PH0A 3B5ND 3GW6A 5CCHA 1SJGA 2O3JA 3CCQP 5AW1B 1BE3J 4C7NA 4L76A 3H25A 3CWBE 1NTKG 3N4XA 2KB7P 1JY3P 3OJAB 2HG5D 2CK3H 2BCCG 3H1KE 2I1JA 5BU8B 3CPWO 3P8CE 1L0LJ 1JY2O 1LGHB 3HRNA 1VQ7P 1VM9A 1SQXE 2Q3WA 2GUVA 1NAFA 3VP9A 1FU1A 5KJ7D 1WRGA 4AQRD 2SPZA 2HPCA 5HL4A 1ZRTE 1EC5A 1WT6A 2O01H 3KXDA 4DOJA 2KNCA 2Q3EA 3WU2E 2QE7H 4YXWH 4NB8D 1LTIC 3H1JJ 1OW7A 3H1KG 2QSIA 2L91A 3H1HD 4IL6H 3GF7A 1RF1B 2PGDA 3HTKA 3SSUA 1HVVA 1IK7A 5L8RJ 2Q1KA 1G8JB 2BASA 3H1IJ 1GL2A 4OGQD 3AE2C 1JY2P 4UB8E 2N9YB 1ZOYC 2E43A 4HM4A 1PPJD 5B66E 4Y28J 2A45I 1G1JA 2E5TA 1SQQD 4QDFB 3AE8C 2HODA 3B5NB 1NTMD 2JO1A 4I6MC 2Z5IA 2WSCH 1GU5A 4WBAA 3KDPB 4U7JA 3TGUD 4ZMDA 4GODA 2WPVB 2YMKA 3FXDA 1S3JA 5APWA 3WUTA 3CMAP 4TT3H 2DE7D 3MD0A 4IL6X 3VMXA 4OH8B 5AW0B 1RE4C 1RHZB 5TISE 1VQKP 1ZP0C 4QUPA 1DX7A 2YVJB 2W27A 2YKQA 3CX5D 1U7MA 1VCKA 3U59A 3EN1A 4I2LC 4BRYB 3T97B 1SQBK 3H1HE 2NPSD 3L73D 1LTAC 1Z56A 3ZDMA 2YNYA 3O6QA 3GLMA 3GHGA 4WY4C 5GTIE 2C9NY 2XKMA 5CHXA 4EDFA 1PPJE 1SFCA 2LXCB 3LIDA 2J59M 2FYUG 4IFDK 1SQQE 3EFGA 3MZWB 1NTME 5KKZC 4OGQB 1PV3A 3TGUE 2Y9YA 4QDCA 5KTBA 2YFJA 1NTKJ 2OYIC 1U57A 3MUDA 2BCCJ 2ITAA 2FYNB 3BVHA 4W7YA 2GUSA 3CX5E 3CCJP 1PPJG 4K3AA 1GDTA 3AEBC 4L73A 1AA0A 5APXA 3W68A 1FZEA 1JO5A 2ZYDA 1J1DB 2KSEA 1KQLA 3I56P 2IBZD 1HUCA 1O7HA 2W6AA 1P84D 5AVUB 4N3YB 1M56D 5AW4B 1FZFA 2WVRA 3L75J 1XTCC 1PGOA 2NPSB 3H1KJ 4NBFD 1N86A 3I5CA 2D2CC 2IZ0A 1N8RQ 1OZHA 3VMHD 2ZYGA 1GZLA 2H8PD 1EZVI 1H88A 4U3FG 2KYVA 3L70G 1JTHA 2AEMA 1M57D 3VYIA 3CC7P 1ZMEC 2C0XA 3CXHH 1M1JA 4JF7A 2K9JA 4KT0J 1LP1B 1OWAA 4H13C 1KB9I 1Q86Q 4Z1MH 3OAKA 4ZKPA 1M8OB 1NTZD 4MN4C 3K5BA 2ZYLA 1N7SC 3A0BE 3RK2D 3M0DA 3G4SP 2JDIH 2KSJA 4JPZB 3N0QA 1E79H 2IBZE 3VTPC 3Q1MA 1LT9B 1P84E 2WT7B 1SQXK 2E74C 5K5GB 4JYBA 2M0BA 5KLVD 1VQ9P 3PLNA 1CI6B 1E5WA 1L0ND 4NBHD 2H88C 3QWOC 3TNUA 3H32B 1SVFA 1FAVA 2E42A 1JCDA 2E76D 2BMRA 1T2KC 2Z5HA 3O8ZA 2FYUJ 2IDBA 1Y47A 2N9BA 1NTZE 1KILC 2IYPA 3RK3B 2K37A 1JMMA 2N1TD 3L74D 2QG4A 5CMZA 1GU4A 1RF0A 1BGYD 3V5BA 1T6AA 2FBWC 3H1LG 4XA4A 3V2PA 3HE4B 1EXIA 5KLVE 5AVYB 4P1CH 3ABVC 2R3SA 4PD4I 1G2CB 3F5HA 2B88A 2ZAEB 3R2PA 1L0NE 1UIXA 1BDDA 1DD3A 3AE6C 3V2QA 1EQ7A 4IFMA 3CCLP 3RK3C 3U1CA 1QVGO 2M5AB 2FXOA 5AEUA 2QJPB 2YFLA 2A45G 5KLVG 2LXBA 3RL0g 2NRGA 2E76B 2XNXA 3L70J 4U3FJ 5CBNA 2IX7C 3PRJA 3A3YB 3RL0C 3L74E 5BVZA 4WB4A 4D6TG 2J58A 1BGYE 3GZXA 2FFDB 1SQQK 2FY8A 2WSSH 2WSFH 4I7ZB 2N1TB 2K88A 3AE7C 3CC2P 2WITA 4HM5A 1Q2NA 3G9RA 3HE5B 2OQQA 4NBBD 4QURA 5AVQB 1HJ0A 4HM7A 1EZVD 2R5DA 2QPZA 2P2UA 3L35A 1QGKB 1SQBG 1T8ZA 3SWFA 1W2EA 3BATA 4L74A 3VN0A 2ZXEB 5BU5A 1SQVD 3FXEA 3L74G 3JSVC 1BGYG 1MV8A 1OVVA 1KB9D 5APUA 3V6IA 3V4WA 2KI7B 1AQTA 1URQC 1FJPA 3VMYA 2B89A 4EI2A 1FZCB 2YXRB 2IYOA 2XU6A 2IFNA 2O1KA 2LKMA 1GW3A 1GK4A 1VQNP 1N73B 3BRTB 4I7ZC 4RJTA 1OIPA 1JY3O 4DJGA 4BWNA 2FXMA 3PTZA 1YIJP 2KS1A 3AE4C 3VMZA 5AW6B 2NWFA 1LTJA 3P32A 1U7JA 4AUWA 1LWUC 3JCUH 3HD7A 1FZBA 1ZV8A 1PGQA 1FQTA 4HM6A 3KZIE 1JNMA 1EZVE 1K8AQ 2IFMA 1MZ9A 2B87B 3H1LJ 1SQVE 4R4LA 2A06D 1NVOA 2AEFA 2Q3IA 1KB9E 2IBZI 1X22A 3HUSC 4WY4D 4AIVA 1P84I 1NU1D 1JUNA 3MGNA 1N73C 2JWAA 1YHQP 2KXPB 1S5LH 5CCGC 4KJMA 4NBGD 5DJUB 1EZVG 1YITP 3JC22 2P1JA 4KHXA 1FDMA 1OW8A 1L4AC 2KOGA 3CCMP 4QUQA 1PP9G 1Y8AA 1NKNA 5KLVJ 5CJ0A 4PD4D 4YTPC 4N78D 4D6TJ 1OXZA 1PFIA 3NFQA 3CWBG 4PV1C 4EIJA 5EFWB 4JYCA 3GB4A 4HKZH 5AVTB 4ZNCA 1VQPP 2JKVA 2NVGA 2WWWA 1RF1A 2A06E 1HH0A 1FC2C 3B8EB 1SQXG 1QEXA 2KNCB 3GG2A 2XNDH 2B1XA 1H0TB 1JMBA 1VF5C 2NVFA 2WSEJ 1FE6A 1PGPA 1NU1E 3TK1A 1SQBJ 2D2CD 2OYHA 5CCHC 3L71D 3S4RA 3L74J 4QDFA 5KLIC 5KLVK 3CI9A 3M9BA 1BGYJ 1PIXA 3B5NA 4WY4B 1KV4A 1S1CX 2OGUA 1L0NK 3V2NA 3M06A 2AXCA 2OARA 1FBMA 2QA4P 4R4MA 4H13D 5KKZB 4GKGA 3CXHI 3GL2A 1IFMA 4H44C 4PD4E 2R44A 2B24A 1N7SD 3AEEC 4W7ZA 4N78E 3MHVA 1IJDB 2OYIB 4IOIH 5KJ7A 2V7QJ 3E1IA 3AEFC 2POHA 4BRYA 4HJLA 4NBED 3TSIA 3T97A 3G71P 2E74D 4O9BA 2XV5A 1NJIQ 1AFOA 3VMGD 1YQ4C 1USDA 3RBXA 4L75A 5APYA 3L71E 1JY3N 1GL2C 5KAIH 1S4XA 1NGMB 4NPFX 3VP8A 4W80A 3H6PA 2BMQA 2ZVOB 2D2CB 3W67A 2JJLA 3WMM0
chains in the Genus database with same CATH topology
1ULJA 2GBWA 4NB9D 4NBHD 2E4QA 2YFLA 1BCCE 2NVFA 1FQTA 4P1BH 1Q90C 2E75D 3GZYA 3D89A 4HM0A 1KYOE 1NU1E 4HM6A 1SJGA 2DE7D 1EZVE 3BCCE 2D2CD 2YFIA 2YIUC 3L74E 2BMOA 3CXHE 2XR8A 4HM1A 3EQQA 2NUMA 1O7HA 4AAYB 3CWBE 2HMJA 1BGYE 3GZXA 2E4PA 2E76D 4QDFA 5KLIC 2BMRA 2HMKA 3H1KE 4QUPA 1SQVE 2QJKC 2FYNC 2JZAA 4H44D 2YVJB 2CKFA 3VMID 2XSOA 2ZT9D 1VCKA 4NBFD 4HKVA 1KB9E 3GOBA 4HM5A 1O7MA 3EN1A 1O7NA 1VM9A 3VMHD 1SQXE 1NTZE 2QJPC 4QCKA 2Q3WA 3GL0A 4H13D 1EG9A 3H1HE 4NBBD 4QURA 4AIVA 2XRXA 4HM2A 3L73E 4HM7A 3GL2A 1UUWA 3FOUA 4PD4E 2GBXA 2QPZA 1ZRTE 5HL4A 2B24A 1RIEA 4D6TE 4HM8A 4NBGD 1NTKE 3H1IE 1NYKA 3GTEA 2BCCE 2HMLA 3H1JE 4NB8D 1WQLA 3C0DA 1PPJE 4HJLA 4NBED 3VCAA 1SQQE 5KLVE 3DQYA 4PV1D 2ZYLA 4P1CH 2I7FA 1O7PA 4H0LD 1O7WA 1G8KB 4QDDA 4QUQA 1NTME 2NVEA 1RFSA 5KKZC 5CXMA 2E74D 2NUKA 1L0NE 4U3FE 3L70E 3TGUE 4QDCA 3N0QA 1JM1A 3VMGD 1SQBE 4NBAD 1G8JB 4NBCD 2IBZE 1BE3E 2YFJA 5BOKA 1SQPE 4OGQD 2DE6D 3L71E 1VF5D 1P84E 3GTSA 4HM4A 2HMOA 3GB4A 3H1LE 3L75E 1O7GA 3GCEA 2NVGA 4NBDD 3VCPA 2DE5D 2JO6A 4HM3A 3L72E 4QDFB 3AZCA 2FYUE 2QJYC 2HMMA 1L0LE 2BMQA 2A06E 3CX5E 1NDOA 1UUVA 2NWFA 3GKEA 1ULIA 2XSHA 5AEUA 2HMNA 1PP9E 2B1XA 4EMJB 5AEWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ULJ A;  2GBW A;  4NB9 D;  4NBH D;  2E4Q A;  2YFL A;  1BCC E;  2NVF A;  1FQT A;  4P1B H;  1Q90 C;  2E75 D;  3GZY A;  3D89 A;  4HM0 A;  1KYO E;  1NU1 E;  4HM6 A;  1SJG A;  2DE7 D;  1EZV E;  3BCC E;  2D2C D;  2YFI A;  2YIU C;  3L74 E;  2BMO A;  3CXH E;  2XR8 A;  4HM1 A;  3EQQ A;  2NUM A;  1O7H A;  4AAY B;  3CWB E;  2HMJ A;  1BGY E;  3GZX A;  2E4P A;  2E76 D;  4QDF A;  5KLI C;  2BMR A;  2HMK A;  3H1K E;  4QUP A;  1SQV E;  2QJK C;  2FYN C;  2JZA A;  4H44 D;  2YVJ B;  2CKF A;  3VMI D;  2XSO A;  2ZT9 D;  1VCK A;  4NBF D;  4HKV A;  1KB9 E;  3GOB A;  4HM5 A;  1O7M A;  3EN1 A;  1O7N A;  1VM9 A;  3VMH D;  1SQX E;  1NTZ E;  2QJP C;  4QCK A;  2Q3W A;  3GL0 A;  4H13 D;  1EG9 A;  3H1H E;  4NBB D;  4QUR A;  4AIV A;  2XRX A;  4HM2 A;  3L73 E;  4HM7 A;  3GL2 A;  1UUW A;  3FOU A;  4PD4 E;  2GBX A;  2QPZ A;  1ZRT E;  5HL4 A;  2B24 A;  1RIE A;  4D6T E;  4HM8 A;  4NBG D;  1NTK E;  3H1I E;  1NYK A;  3GTE A;  2BCC E;  2HML A;  3H1J E;  4NB8 D;  1WQL A;  3C0D A;  1PPJ E;  4HJL A;  4NBE D;  3VCA A;  1SQQ E;  5KLV E;  3DQY A;  4PV1 D;  2ZYL A;  4P1C H;  2I7F A;  1O7P A;  4H0L D;  1O7W A;  1G8K B;  4QDD A;  4QUQ A;  1NTM E;  2NVE A;  1RFS A;  5KKZ C;  5CXM A;  2E74 D;  2NUK A;  1L0N E;  4U3F E;  3L70 E;  3TGU E;  4QDC A;  3N0Q A;  1JM1 A;  3VMG D;  1SQB E;  4NBA D;  1G8J B;  4NBC D;  2IBZ E;  1BE3 E;  2YFJ A;  5BOK A;  1SQP E;  4OGQ D;  2DE6 D;  3L71 E;  1VF5 D;  1P84 E;  3GTS A;  4HM4 A;  2HMO A;  3GB4 A;  3H1L E;  3L75 E;  1O7G A;  3GCE A;  2NVG A;  4NBD D;  3VCP A;  2DE5 D;  2JO6 A;  4HM3 A;  3L72 E;  4QDF B;  3AZC A;  2FYU E;  2QJY C;  2HMM A;  1L0L E;  2BMQ A;  2A06 E;  3CX5 E;  1NDO A;  1UUV A;  2NWF A;  3GKE A;  1ULI A;  2XSH A;  5AEU A;  2HMN A;  1PP9 E;  2B1X A;  4EMJ B;  5AEW A; 
#chains in the Genus database with same CATH topology
 1T2K D;  3H1H G;  2E4Q A;  1PL5 A;  5H2F H;  1SQP D;  1RH5 B;  1R8E A;  2QM7 A;  2K9Y A;  1KIL D;  1DEE G;  5E79 H;  2JZA A;  2LR2 A;  1KOR A;  4H13 B;  3IR9 A;  3L71 G;  1NKZ B;  4HKV A;  3GOB A;  1SQQ G;  4IL6 E;  2CPS A;  1PP9 J;  1JB0 J;  2ZJS E;  1NTM G;  1X9V A;  1N7S B;  3L73 E;  3TGU G;  3A0H H;  2OYO A;  1LTS C;  3BRV B;  3CWB J;  1R5S A;  5AW5 B;  2NPS A;  1JY2 N;  2V4H A;  3GHG C;  3KYQ A;  1RY3 A;  2E74 B;  2NZ2 A;  3MIW A;  2M3E A;  2QEX P;  1SFC C;  1SQX J;  1IFJ A;  3F89 A;  3RGU A;  5KAF H;  1VDF A;  1W2B O;  1EDI A;  3AE1 C;  4ZKU A;  3RK3 D;  1SQV K;  4NBC D;  3EQ2 A;  1LP1 A;  3L73 G;  1RE3 A;  2I1K A;  1SQP E;  1KQF B;  2MKV A;  5TJH A;  1CW5 A;  2P7J A;  3MUD C;  1M7L A;  3RL0 D;  1CSB A;  4OWF A;  4XE5 B;  1UUV A;  1NDO A;  2XSH A;  1GK6 A;  5AEW A;  3NMD A;  1ULJ A;  1KIL B;  2Y9Z A;  2YMY A;  4HYT B;  1BE3 D;  2WSE H;  4DCK A;  1LT9 A;  2WT7 A;  1BSN A;  1GD2 E;  2K3R A;  1T3U A;  3OW2 O;  1IFN A;  2QJK C;  3L72 D;  1L0L D;  5AVR B;  1CI6 A;  5DJT B;  3Q5S A;  1BCC D;  1HWT C;  1Y9B A;  1LTT C;  1OFC X;  3H32 A;  3CXH D;  3FOU A;  2ZT9 C;  3A7O A;  3RK3 E;  1RIE A;  2Y0C A;  1URQ D;  2IBZ G;  2WQY C;  3EWK A;  4HJG H;  4GT1 A;  3L36 A;  2K1A A;  1AJY A;  1IZN B;  1M1J C;  3H1J D;  1LNQ A;  3G6E P;  1Q7Y Q;  1PGJ A;  5GTH H;  3G3Z A;  1NU1 K;  2I7F A;  5M1B A;  1A02 J;  3H1H J;  5AVW B;  1SLQ A;  3M0D C;  2R5B A;  3PHL A;  3H1I D;  4HB1 A;  3RL0 B;  1BE3 E;  1W5C E;  5BOK A;  2R3C A;  3USS A;  4H0L C;  2H7H A;  3GTS A;  3SWY A;  2DW3 A;  3HE4 A;  3L71 J;  3QH9 A;  1X8Y A;  3L72 E;  2QJY C;  1SQQ J;  1L0L E;  2HMM A;  5B5E H;  1G2C A;  1NTM J;  1NTZ G;  1ZLL A;  3U1A A;  1BCC E;  1CZQ A;  4P1B H;  1Q90 C;  1LTB C;  3TGU J;  5KAF E;  2HLO A;  4HM0 A;  1LJ2 A;  3CXH E;  1QL2 A;  3EQQ A;  3CC4 P;  2O01 J;  1DH3 A;  1ZXG A;  1OX3 A;  4M3L A;  1HF9 A;  2P58 A;  1ZW0 A;  2E75 C;  2M5A A;  2CKF A;  2O01 N;  5CCG D;  1O7M A;  1IK9 A;  2PRR A;  3L72 G;  4QCK A;  1KN7 A;  1URQ B;  1ZR2 A;  4UB6 H;  2JP3 A;  4HM2 A;  1L0N G;  3KPE A;  1L4A D;  1BCC G;  2FFD A;  3L73 J;  3IN6 A;  2XDJ A;  2YXQ B;  1OMI A;  1RF0 C;  2GA1 A;  1NTM K;  2JR8 A;  3H1I E;  3D71 A;  1NYK A;  1FZG A;  2PP6 A;  1NWQ A;  2N1T A;  3LIE A;  4XFJ A;  1YJW P;  2WMM A;  4PV1 D;  3S1K A;  2NVE A;  1KQG B;  1LWU B;  1H8A A;  1J1E C;  1NTK D;  2BCC D;  1VF5 D;  2QM8 A;  1IC2 A;  2IPP A;  1QLE D;  2HMO A;  1MFT A;  1YQ3 C;  1KTM A;  5CCH D;  3EFF K;  1FZC A;  1HBW A;  1YBK A;  1ULI A;  5APS A;  1QL1 A;  2WZ7 A;  3CLQ A;  3HUS B;  1NO4 A;  1AVO A;  3AE5 C;  3D89 A;  1N73 A;  2YIU C;  2BMO A;  2RH0 A;  1M1K Q;  3LW5 J;  4AAY B;  4RES B;  1K73 Q;  3SFD C;  3BAS A;  2E4P A;  3L75 D;  4H44 D;  3VOP A;  1VPC A;  2XSO A;  4GIF A;  1ZR4 A;  1L4A B;  2WPQ A;  2AEJ A;  3GMA A;  4WVZ A;  3CL3 D;  3CCV P;  1NHL A;  3FGA D;  1SQP K;  1KD1 Q;  1RQV A;  3C8V A;  2B87 A;  1KMI Z;  3D70 A;  3V2R A;  1NTK E;  3GTE A;  1USE A;  4PV1 B;  5TIS H;  2BCC E;  1VQO P;  2BEZ F;  5AVS B;  1FZA A;  2C9L Y;  1NTZ J;  1NOH A;  1G8K B;  1KFM A;  1GL2 D;  2BEQ D;  4JQ0 D;  1FS0 E;  1VQL P;  1VF5 B;  2W83 C;  2W6B A;  2Y0E A;  2W90 A;  1S2E A;  1DIP A;  2ZXX A;  4C7N B;  1NH4 A;  1SQV G;  5KLI B;  3IF4 A;  3L75 E;  3GCE A;  3CCU P;  3WUU A;  2M3B A;  4HM3 A;  4A7P A;  4ASW A;  5GTI H;  4YPC A;  3L72 J;  4Y99 C;  1EDJ A;  1NAY A;  4C46 A;  1LTJ C;  5AW9 B;  1GMJ A;  1DD4 A;  1L0N J;  3HD7 C;  5AW8 B;  2WTY A;  1BCC J;  1RE4 A;  4H44 B;  4HH2 A;  4HM1 A;  1AQ5 A;  3S9O A;  1NTZ K;  3R4Y A;  1FOS F;  1S5L X;  1JCC A;  2RMZ A;  3E7K A;  2HPC B;  2UWJ E;  2M8R A;  1EDL A;  2KK7 A;  2FYU D;  3VMI D;  2HFE D;  1H0T A;  3ITK A;  1IFD A;  3L75 G;  2OTK E;  1O7N A;  3CX5 H;  1YI2 P;  1OVU A;  3AED C;  3GL0 A;  1EG9 A;  2XRX A;  3BCC D;  4CPG A;  2GBX A;  1SFC D;  3HTK B;  4B86 A;  2QIW A;  4WY4 A;  1L0L K;  1D7M A;  2HML A;  1GL2 B;  2GM4 A;  2QRX A;  1SS1 A;  3D6Z A;  1H89 A;  2OYH B;  4DZO A;  1BSH A;  2A06 G;  3JCU E;  1K04 A;  4IFF A;  1O7P A;  1N7L A;  2B9B A;  5CXM A;  2HOD B;  4QMA A;  1KYO H;  5C39 A;  3MTU E;  1NU1 G;  4DT0 A;  2Q5U A;  2G8Y A;  2OYI A;  4NBA D;  1AV1 A;  2YKP A;  1LTG C;  3Q3D A;  1TU3 F;  5AW2 B;  1Q81 Q;  2HR3 A;  2ZFC A;  2FYU E;  3CCE P;  2Q6Q A;  1RF1 C;  1NYH A;  3Q2Y A;  5AVV B;  2P67 A;  4U3F D;  3L70 D;  3A0B H;  3SFE C;  3TF5 A;  1S5L E;  3GF3 A;  2KP8 A;  4OVN F;  3BCC E;  2NUM A;  2OYH C;  2HMJ A;  4NPE A;  2O1J A;  3LW5 H;  2HMK A;  3O6Q B;  2Z4E A;  3Q5P A;  1P84 H;  3GHG B;  3B5N C;  2ZT9 D;  1T3J A;  1SFC B;  5APQ A;  2WPS A;  2P10 A;  2G3A A;  1KYO D;  1HGV A;  1YJN P;  1L2P A;  2JWD A;  5APT A;  4EOT A;  1VQ4 P;  4LLH A;  1X79 B;  4HM8 A;  3RBZ A;  3BCC G;  5AW3 B;  1K9M Q;  1SQV J;  5AVZ B;  2W6J H;  2WPR A;  2H43 A;  5KJ7 C;  1GW4 A;  2OTL P;  3IFM A;  2XZR A;  2KZJ A;  1N7S A;  3VCA A;  4PJ0 H;  4QDD A;  3N7N A;  4H0L D;  1O7W A;  3WUV A;  1KFN A;  4JBZ A;  1A02 F;  4U3F E;  1FJK A;  3L70 E;  1ZN5 A;  1JM1 A;  2Y0D A;  4I1L A;  2IZ1 A;  1MKM A;  3AE9 C;  3TYY A;  1Q90 D;  1VL2 A;  2QJK B;  1LT1 A;  2WSF J;  1X0T A;  3AEG C;  1VQ6 P;  3GKE A;  3NXS A;  3KQG A;  2C0W A;  1VQM P;  2HMN A;  2YKO A;  3P7K A;  2A45 H;  4OGQ C;  1NTK K;  2E75 D;  2FYZ A;  1YYC A;  3B71 A;  1KYO E;  1YTZ I;  2XR8 A;  1KIL E;  2ZT9 B;  1JTH B;  1IFI A;  2QVA A;  3H1L D;  3I55 P;  2FYN C;  3AEC C;  2AXT H;  1M1J B;  2K9J B;  1G1I A;  2RKL A;  4BXL A;  1KIL A;  1J1D C;  1HTL C;  1Q82 Q;  1NU1 J;  1UUW A;  1XTG B;  3II6 A;  3CCS P;  5CJ4 A;  2KZI A;  1SQP G;  5KAI E;  4H0L B;  1IO4 A;  2NPS C;  1FDO A;  2W8Z A;  4GDO A;  1N2D C;  2QJY B;  3UIA A;  4NPD A;  1KC8 Q;  5AVX B;  5H2F E;  4D6T D;  5CBO A;  2MJZ A;  2ZYA A;  5E79 E;  3TNU B;  1RE3 C;  4GOE A;  2V7Q H;  3H1L E;  3C1L A;  3NTN A;  2JO6 A;  1MFZ A;  2E75 B;  2HYN A;  2ZVN B;  1S72 P;  4PJ0 E;  2FXP A;  4NB9 D;  3A0H E;  4RO0 A;  2OTJ P;  1SQB D;  2YFI A;  1SP4 A;  3CD6 P;  1LT9 C;  3PJS K;  3BCC J;  3Q5R A;  2CPB A;  3M91 A;  1JEK A;  3VMA A;  3CME P;  3RK2 B;  3CCR P;  4WWI A;  1J1E B;  5AW7 B;  2VRS A;  3TDK A;  3FWL A;  3L37 A;  4D6T E;  1UII A;  1BE3 G;  3KZI H;  2PFX A;  2FYU K;  3PP5 A;  3E1R A;  3FX0 A;  3H1J E;  3B4S A;  1S9K D;  2KLU A;  3L4F A;  1QX8 A;  1YJ9 P;  3C0D A;  2AXT E;  1L0L G;  1URQ A;  1J2J B;  1BDC A;  1KB9 H;  1KZU B;  1GTW A;  1SQB E;  2L5G B;  3A2A A;  1WMK A;  2JEE A;  3M9H A;  4TLF A;  2YIU B;  5APV A;  2DE6 D;  3RK2 C;  1R5L A;  3HD7 D;  2KLV A;  3HE5 A;  1VQ5 P;  4NBD D;  2Q7C A;  3D6Y A;  2WSC J;  3H1J G;  1DEB A;  1LWU A;  4EMJ B;  1EXJ A;  2YO2 A;  3KHU A;  3V4Q A;  1OW6 A;  2KIK A;  3MP7 B;  4RKU J;  4GOF A;  3GZY A;  2H89 C;  3A5T A;  3P8M C;  1SQP J;  1K05 A;  1OVR A;  2PAJ A;  2I8D A;  3H1I G;  2FKW B;  3WU2 H;  1VQ8 P;  3CX5 I;  3C9I A;  1FDI A;  4YXD C;  5GTH E;  1S9K E;  3IAO A;  1PZQ A;  1PP9 D;  1RQU A;  3HUS A;  3OA7 A;  2QJP C;  1JOC A;  4C7R A;  2RN0 A;  2E76 C;  4LC1 A;  5CCG A;  3CWB D;  4UB8 H;  2FFD C;  1AVY A;  3H1K D;  5B66 H;  4N6J A;  1YTZ T;  1JM0 A;  3P8C D;  1WQL A;  3AE3 C;  5B5E E;  1L4A A;  2N1T C;  4K35 A;  2YO3 A;  4EYY Q;  1SQX D;  1KYO I;  3DQY A;  1QVF O;  2KS1 B;  1HJB A;  4Y99 B;  1RFS A;  1LTJ B;  2NUK A;  1HGZ A;  3AEA C;  1ZRT D;  3HD7 B;  3SWK A;  3FWN A;  2J5U A;  1FOS E;  4PD4 H;  1EDK A;  4AYC A;  2Q9I A;  4LGD E;  3M0A A;  1KQS O;  1O7G A;  1MUU A;  2DE5 D;  3VCP A;  2E5Y A;  3AZC A;  1IFP A;  4UB6 E;  1PP9 E;  1FZC C;  4ASV A;  2R32 A;  2GBW A;  3M9Q A;  1M90 Q;  2KUB A;  3PH0 A;  3B5N D;  3GW6 A;  5CCH A;  1SJG A;  2O3J A;  3CCQ P;  5AW1 B;  1BE3 J;  4C7N A;  4L76 A;  3H25 A;  3CWB E;  1NTK G;  3N4X A;  2KB7 P;  1JY3 P;  3OJA B;  2HG5 D;  2CK3 H;  2BCC G;  3H1K E;  2I1J A;  5BU8 B;  3CPW O;  3P8C E;  1L0L J;  1JY2 O;  1LGH B;  3HRN A;  1VQ7 P;  1VM9 A;  1SQX E;  2Q3W A;  2GUV A;  1NAF A;  3VP9 A;  1FU1 A;  5KJ7 D;  1WRG A;  4AQR D;  2SPZ A;  2HPC A;  5HL4 A;  1ZRT E;  1EC5 A;  1WT6 A;  2O01 H;  3KXD A;  4DOJ A;  2KNC A;  2Q3E A;  3WU2 E;  2QE7 H;  4YXW H;  4NB8 D;  1LTI C;  3H1J J;  1OW7 A;  3H1K G;  2QSI A;  2L91 A;  3H1H D;  4IL6 H;  3GF7 A;  1RF1 B;  2PGD A;  3HTK A;  3SSU A;  1HVV A;  1IK7 A;  5L8R J;  2Q1K A;  1G8J B;  2BAS A;  3H1I J;  1GL2 A;  4OGQ D;  3AE2 C;  1JY2 P;  4UB8 E;  2N9Y B;  1ZOY C;  2E43 A;  4HM4 A;  1PPJ D;  5B66 E;  4Y28 J;  2A45 I;  1G1J A;  2E5T A;  1SQQ D;  4QDF B;  3AE8 C;  2HOD A;  3B5N B;  1NTM D;  2JO1 A;  4I6M C;  2Z5I A;  2WSC H;  1GU5 A;  4WBA A;  3KDP B;  4U7J A;  3TGU D;  4ZMD A;  4GOD A;  2WPV B;  2YMK A;  3FXD A;  1S3J A;  5APW A;  3WUT A;  3CMA P;  4TT3 H;  2DE7 D;  3MD0 A;  4IL6 X;  3VMX A;  4OH8 B;  5AW0 B;  1RE4 C;  1RHZ B;  5TIS E;  1VQK P;  1ZP0 C;  4QUP A;  1DX7 A;  2YVJ B;  2W27 A;  2YKQ A;  3CX5 D;  1U7M A;  1VCK A;  3U59 A;  3EN1 A;  4I2L C;  4BRY B;  3T97 B;  1SQB K;  3H1H E;  2NPS D;  3L73 D;  1LTA C;  1Z56 A;  3ZDM A;  2YNY A;  3O6Q A;  3GLM A;  3GHG A;  4WY4 C;  5GTI E;  2C9N Y;  2XKM A;  5CHX A;  4EDF A;  1PPJ E;  1SFC A;  2LXC B;  3LID A;  2J59 M;  2FYU G;  4IFD K;  1SQQ E;  3EFG A;  3MZW B;  1NTM E;  5KKZ C;  4OGQ B;  1PV3 A;  3TGU E;  2Y9Y A;  4QDC A;  5KTB A;  2YFJ A;  1NTK J;  2OYI C;  1U57 A;  3MUD A;  2BCC J;  2ITA A;  2FYN B;  3BVH A;  4W7Y A;  2GUS A;  3CX5 E;  3CCJ P;  1PPJ G;  4K3A A;  1GDT A;  3AEB C;  4L73 A;  1AA0 A;  5APX A;  3W68 A;  1FZE A;  1JO5 A;  2ZYD A;  1J1D B;  2KSE A;  1KQL A;  3I56 P;  2IBZ D;  1HUC A;  1O7H A;  2W6A A;  1P84 D;  5AVU B;  4N3Y B;  1M56 D;  5AW4 B;  1FZF A;  2WVR A;  3L75 J;  1XTC C;  1PGO A;  2NPS B;  3H1K J;  4NBF D;  1N86 A;  3I5C A;  2D2C C;  2IZ0 A;  1N8R Q;  1OZH A;  3VMH D;  2ZYG A;  1GZL A;  2H8P D;  1EZV I;  1H88 A;  4U3F G;  2KYV A;  3L70 G;  1JTH A;  2AEM A;  1M57 D;  3VYI A;  3CC7 P;  1ZME C;  2C0X A;  3CXH H;  1M1J A;  4JF7 A;  2K9J A;  4KT0 J;  1LP1 B;  1OWA A;  4H13 C;  1KB9 I;  1Q86 Q;  4Z1M H;  3OAK A;  4ZKP A;  1M8O B;  1NTZ D;  4MN4 C;  3K5B A;  2ZYL A;  1N7S C;  3A0B E;  3RK2 D;  3M0D A;  3G4S P;  2JDI H;  2KSJ A;  4JPZ B;  3N0Q A;  1E79 H;  2IBZ E;  3VTP C;  3Q1M A;  1LT9 B;  1P84 E;  2WT7 B;  1SQX K;  2E74 C;  5K5G B;  4JYB A;  2M0B A;  5KLV D;  1VQ9 P;  3PLN A;  1CI6 B;  1E5W A;  1L0N D;  4NBH D;  2H88 C;  3QWO C;  3TNU A;  3H32 B;  1SVF A;  1FAV A;  2E42 A;  1JCD A;  2E76 D;  2BMR A;  1T2K C;  2Z5H A;  3O8Z A;  2FYU J;  2IDB A;  1Y47 A;  2N9B A;  1NTZ E;  1KIL C;  2IYP A;  3RK3 B;  2K37 A;  1JMM A;  2N1T D;  3L74 D;  2QG4 A;  5CMZ A;  1GU4 A;  1RF0 A;  1BGY D;  3V5B A;  1T6A A;  2FBW C;  3H1L G;  4XA4 A;  3V2P A;  3HE4 B;  1EXI A;  5KLV E;  5AVY B;  4P1C H;  3ABV C;  2R3S A;  4PD4 I;  1G2C B;  3F5H A;  2B88 A;  2ZAE B;  3R2P A;  1L0N E;  1UIX A;  1BDD A;  1DD3 A;  3AE6 C;  3V2Q A;  1EQ7 A;  4IFM A;  3CCL P;  3RK3 C;  3U1C A;  1QVG O;  2M5A B;  2FXO A;  5AEU A;  2QJP B;  2YFL A;  2A45 G;  5KLV G;  2LXB A;  3RL0 g;  2NRG A;  2E76 B;  2XNX A;  3L70 J;  4U3F J;  5CBN A;  2IX7 C;  3PRJ A;  3A3Y B;  3RL0 C;  3L74 E;  5BVZ A;  4WB4 A;  4D6T G;  2J58 A;  1BGY E;  3GZX A;  2FFD B;  1SQQ K;  2FY8 A;  2WSS H;  2WSF H;  4I7Z B;  2N1T B;  2K88 A;  3AE7 C;  3CC2 P;  2WIT A;  4HM5 A;  1Q2N A;  3G9R A;  3HE5 B;  2OQQ A;  4NBB D;  4QUR A;  5AVQ B;  1HJ0 A;  4HM7 A;  1EZV D;  2R5D A;  2QPZ A;  2P2U A;  3L35 A;  1QGK B;  1SQB G;  1T8Z A;  3SWF A;  1W2E A;  3BAT A;  4L74 A;  3VN0 A;  2ZXE B;  5BU5 A;  1SQV D;  3FXE A;  3L74 G;  3JSV C;  1BGY G;  1MV8 A;  1OVV A;  1KB9 D;  5APU A;  3V6I A;  3V4W A;  2KI7 B;  1AQT A;  1URQ C;  1FJP A;  3VMY A;  2B89 A;  4EI2 A;  1FZC B;  2YXR B;  2IYO A;  2XU6 A;  2IFN A;  2O1K A;  2LKM A;  1GW3 A;  1GK4 A;  1VQN P;  1N73 B;  3BRT B;  4I7Z C;  4RJT A;  1OIP A;  1JY3 O;  4DJG A;  4BWN A;  2FXM A;  3PTZ A;  1YIJ P;  2KS1 A;  3AE4 C;  3VMZ A;  5AW6 B;  2NWF A;  1LTJ A;  3P32 A;  1U7J A;  4AUW A;  1LWU C;  3JCU H;  3HD7 A;  1FZB A;  1ZV8 A;  1PGQ A;  1FQT A;  4HM6 A;  3KZI E;  1JNM A;  1EZV E;  1K8A Q;  2IFM A;  1MZ9 A;  2B87 B;  3H1L J;  1SQV E;  4R4L A;  2A06 D;  1NVO A;  2AEF A;  2Q3I A;  1KB9 E;  2IBZ I;  1X22 A;  3HUS C;  4WY4 D;  4AIV A;  1P84 I;  1NU1 D;  1JUN A;  3MGN A;  1N73 C;  2JWA A;  1YHQ P;  2KXP B;  1S5L H;  5CCG C;  4KJM A;  4NBG D;  5DJU B;  1EZV G;  1YIT P;  3JC2 2;  2P1J A;  4KHX A;  1FDM A;  1OW8 A;  1L4A C;  2KOG A;  3CCM P;  4QUQ A;  1PP9 G;  1Y8A A;  1NKN A;  5KLV J;  5CJ0 A;  4PD4 D;  4YTP C;  4N78 D;  4D6T J;  1OXZ A;  1PFI A;  3NFQ A;  3CWB G;  4PV1 C;  4EIJ A;  5EFW B;  4JYC A;  3GB4 A;  4HKZ H;  5AVT B;  4ZNC A;  1VQP P;  2JKV A;  2NVG A;  2WWW A;  1RF1 A;  2A06 E;  1HH0 A;  1FC2 C;  3B8E B;  1SQX G;  1QEX A;  2KNC B;  3GG2 A;  2XND H;  2B1X A;  1H0T B;  1JMB A;  1VF5 C;  2NVF A;  2WSE J;  1FE6 A;  1PGP A;  1NU1 E;  3TK1 A;  1SQB J;  2D2C D;  2OYH A;  5CCH C;  3L71 D;  3S4R A;  3L74 J;  4QDF A;  5KLI C;  5KLV K;  3CI9 A;  3M9B A;  1BGY J;  1PIX A;  3B5N A;  4WY4 B;  1KV4 A;  1S1C X;  2OGU A;  1L0N K;  3V2N A;  3M06 A;  2AXC A;  2OAR A;  1FBM A;  2QA4 P;  4R4M A;  4H13 D;  5KKZ B;  4GKG A;  3CXH I;  3GL2 A;  1IFM A;  4H44 C;  4PD4 E;  2R44 A;  2B24 A;  1N7S D;  3AEE C;  4W7Z A;  4N78 E;  3MHV A;  1IJD B;  2OYI B;  4IOI H;  5KJ7 A;  2V7Q J;  3E1I A;  3AEF C;  2POH A;  4BRY A;  4HJL A;  4NBE D;  3TSI A;  3T97 A;  3G71 P;  2E74 D;  4O9B A;  2XV5 A;  1NJI Q;  1AFO A;  3VMG D;  1YQ4 C;  1USD A;  3RBX A;  4L75 A;  5APY A;  3L71 E;  1JY3 N;  1GL2 C;  5KAI H;  1S4X A;  1NGM B;  4NPF X;  3VP8 A;  4W80 A;  3H6P A;  2BMQ A;  2ZVO B;  2D2C B;  3W67 A;  2JJL A;  3WMM 0; 
#chains in the Genus database with same CATH homology
 1ULJ A;  2GBW A;  4NB9 D;  4NBH D;  2E4Q A;  2YFL A;  1BCC E;  2NVF A;  1FQT A;  4P1B H;  1Q90 C;  2E75 D;  3GZY A;  3D89 A;  4HM0 A;  1KYO E;  1NU1 E;  4HM6 A;  1SJG A;  2DE7 D;  1EZV E;  3BCC E;  2D2C D;  2YFI A;  2YIU C;  3L74 E;  2BMO A;  3CXH E;  2XR8 A;  4HM1 A;  3EQQ A;  2NUM A;  1O7H A;  4AAY B;  3CWB E;  2HMJ A;  1BGY E;  3GZX A;  2E4P A;  2E76 D;  4QDF A;  5KLI C;  2BMR A;  2HMK A;  3H1K E;  4QUP A;  1SQV E;  2QJK C;  2FYN C;  2JZA A;  4H44 D;  2YVJ B;  2CKF A;  3VMI D;  2XSO A;  2ZT9 D;  1VCK A;  4NBF D;  4HKV A;  1KB9 E;  3GOB A;  4HM5 A;  1O7M A;  3EN1 A;  1O7N A;  1VM9 A;  3VMH D;  1SQX E;  1NTZ E;  2QJP C;  4QCK A;  2Q3W A;  3GL0 A;  4H13 D;  1EG9 A;  3H1H E;  4NBB D;  4QUR A;  4AIV A;  2XRX A;  4HM2 A;  3L73 E;  4HM7 A;  3GL2 A;  1UUW A;  3FOU A;  4PD4 E;  2GBX A;  2QPZ A;  1ZRT E;  5HL4 A;  2B24 A;  1RIE A;  4D6T E;  4HM8 A;  4NBG D;  1NTK E;  3H1I E;  1NYK A;  3GTE A;  2BCC E;  2HML A;  3H1J E;  4NB8 D;  1WQL A;  3C0D A;  1PPJ E;  4HJL A;  4NBE D;  3VCA A;  1SQQ E;  5KLV E;  3DQY A;  4PV1 D;  2ZYL A;  4P1C H;  2I7F A;  1O7P A;  4H0L D;  1O7W A;  1G8K B;  4QDD A;  4QUQ A;  1NTM E;  2NVE A;  1RFS A;  5KKZ C;  5CXM A;  2E74 D;  2NUK A;  1L0N E;  4U3F E;  3L70 E;  3TGU E;  4QDC A;  3N0Q A;  1JM1 A;  3VMG D;  1SQB E;  4NBA D;  1G8J B;  4NBC D;  2IBZ E;  1BE3 E;  2YFJ A;  5BOK A;  1SQP E;  4OGQ D;  2DE6 D;  3L71 E;  1VF5 D;  1P84 E;  3GTS A;  4HM4 A;  2HMO A;  3GB4 A;  3H1L E;  3L75 E;  1O7G A;  3GCE A;  2NVG A;  4NBD D;  3VCP A;  2DE5 D;  2JO6 A;  4HM3 A;  3L72 E;  4QDF B;  3AZC A;  2FYU E;  2QJY C;  2HMM A;  1L0L E;  2BMQ A;  2A06 E;  3CX5 E;  1NDO A;  1UUV A;  2NWF A;  3GKE A;  1ULI A;  2XSH A;  5AEU A;  2HMN A;  1PP9 E;  2B1X A;  4EMJ B;  5AEW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...