1SQXE

Crystal structure analysis of bovine bc1 with stigmatellin a
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
196
structure length
196
Chain Sequence
b'SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 45
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2004-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1sqxE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1sqxE02
2HMKA 2BMQA 2HMNA 1NU1E 4NBBD 1NTKE 1UUVA 2YFJA 5BOKA 3H1JE 4NB9D 1VF5D 2GBXA 2B1XA 3GOBA 1NDOA 2QPZA 4H13D 2BMRA 1SQVE 4HM2A 4QCKA 1RFSA 1FQTA 4QDFB 1SQBE 1O7WA 2YIUC 1JM1A 3VMID 3EN1A 3GL0A 3GZXA 2YFLA 2DE6D 4AIVA 3L72E 4QDFA 5KLIC 1RIEA 3H1LE 4PD4E 2IBZE 3CX5E 2GBWA 4NBFD 3L73E 3H1HE 5AEWA 2CKFA 2NUKA 4HM1A 1L0NE 4HM5A 4P1BH 4EMJB 4HJLA 3VMGD 2FYUE 3TGUE 1O7GA 4NB8D 1O7PA 2E4QA 1O7HA 2JZAA 2NVGA 2E4PA 1Q90C 1EG9A 2Q3WA 1UUWA 4OGQD 1ULJA 2XSOA 3VMHD 4HM8A 4QURA 1L0LE 4QDCA 1KB9E 1NTME 3L70E 3AZCA 1KYOE 1ULIA 1SQQE 2XSHA 2QJKC 2BCCE 1NTZE 3L71E 1PPJE 1O7MA 2DE5D 1G8JB 1ZRTE 2ZYLA 2JO6A 3GZYA 2QJPC 2NWFA 5CXMA 3GCEA 4NBED 4HKVA 1PP9E 1SQXE 2HMOA 3H1IE 2XRXA 4QUPA 2E76D 2HMMA 4QUQA 1SQPE 3H1KE 5HL4A 3CWBE 1NYKA 3VCAA 4D6TE 2QJYC 3N0QA 2DE7D 3GTEA 3L74E 1BE3E 1VM9A 2D2CD 2NUMA 3BCCE 2XR8A 3VCPA 5KKZC 4HM7A 4U3FE 3EQQA 3GB4A 2HMLA 2ZT9D 3C0DA 2NVFA 2FYNC 1VCKA 3DQYA 3GTSA 2YVJB 5AEUA 3GKEA 1WQLA 4P1CH 1BGYE 2E74D 2E75D 3CXHE 4AAYB 1P84E 1O7NA 2A06E 4PV1D 5KLVE 2BMOA 3D89A 3FOUA 4HM3A 1SJGA 4H0LD 4HM0A 4NBHD 4NBAD 3L75E 4NBCD 4NBDD 1EZVE 4NBGD 1BCCE 2I7FA 4HM6A 4H44D 2HMJA 4HM4A 2B24A 3GL2A 2YFIA 2NVEA 1G8KB 4QDDA
chains in the Genus database with same CATH superfamily
5AW1B 4H44B 4NPEA 3P8MC 3PTZA 1EZVG 2BMRA 1E79H 4ZNCA 4IFFA 2K3RA 3RK2C 3CC2P 1GDTA 3GZXA 1BE3J 5B66E 5H2FE 4MN4C 1RIEA 1M1KQ 1NTZJ 3L73E 2HLOA 3C8VA 3GHGA 1VQNP 5AW9B 2FYUE 5APXA 5CCHC 3IR9A 3CPWO 2NVGA 2E4PA 2OTJP 1R5SA 2AEMA 3VMXA 4QDCA 1ZP0C 4IL6X 1X8YA 5E79E 1NU1J 3Q5PA 1ZXGA 2ZYLA 4HKZH 3GZYA 1PP9E 1VF5C 3CXHI 1IFPA 2N9YB 1Y9BA 2C9NY 1PGQA 1FBMA 2Z5HA 5KKZC 2K9JB 5TISH 1SFCB 5KAIE 1KTMA 2FFDB 5TJHA 2W8ZA 2D2CB 2KB7P 2E75D 4C7RA 3VTPC 1FOSE 1RE3C 3H1LD 1N73B 1AVYA 3RL0B 1BE3G 3G9RA 2W6JH 3H32A 3EWKA 1NTZG 1LTJB 2I7FA 5AW0B 1DEBA 1WMKA 1Y8AA 1SQVD 4QDDA 1W2BO 1GL2D 1LWUA 2HMNA 1URQC 1HWTC 1DIPA 4NPDA 4H13D 1NDOA 1QVFO 3HE5B 1VQ7P 2O01J 2Q3EA 1VQ9P 4GKGA 1FDOA 1RF0C 1Q81Q 2JDIH 3CCVP 1NU1G 4AIVA 3FX0A 3H1LE 3M9HA 3CX5H 5AEWA 3EFFK 2E42A 2FYNB 1OWAA 3H1IJ 1RH5B 4UB8E 4WB4A 2KS1B 1W2EA 2JZAA 1FDIA 4U3FD 1S1CX 1KQLA 3L71D 4OGQD 3MUDC 4PV1C 1YJNP 3GF7A 3G71P 1JY2O 2P10A 2ZVOB 1NTZK 5DJTB 2J5UA 1ZMEC 3AEFC 5CJ0A 1ZR4A 1MKMA 1RHZB 5AW4B 2NWFA 1SQVJ 3VMYA 5L8RJ 1NHLA 2E76D 3A2AA 1NWQA 3VCAA 4GT1A 3SWYA 1NU1K 4UB6H 2XR8A 2H88C 1IFNA 4U3FE 1NTKJ 2CPBA 1FZCA 5AEUA 1IC2A 2MJZA 2MKVA 3AEGC 5CHXA 3HD7D 3HTKB 3CCSP 2OARA 2XU6A 2XZRA 4ASVA 2KLUA 3P8CE 4H44D 3CCQP 2YFIA 3L71J 1S5LX 4NBBD 3H1IG 3H25A 5BOKA 2B9BA 1KFMA 1KZUB 5KJ7A 2HYNA 1SQQD 5CMZA 1FZGA 4R4LA 3GL0A 5APYA 2RKLA 4QDFA 5B66H 5KLIC 2XV5A 1MZ9A 4PD4E 1SQVG 4JYCA 1Q2NA 4D6TD 2IBZI 2WSFJ 2XDJA 5KLVJ 1DX7A 1LT9C 1Q90C 1FZEA 1UUWA 1T2KD 4Y99C 3G3ZA 1NTKG 2G3AA 1SQQE 2KIKA 2IYPA 5E79H 1T8ZA 2GUVA 1G8JB 1M7LA 5CXMA 2WZ7A 1EDLA 2Q9IA 5KAFE 2J58A 1EXIA 1YIJP 1UIIA 2WSCH 2QJYC 4D6TE 3L71G 1SFCD 3T97B 1VM9A 2D2CD 2NUMA 2PFXA 1JB0J 1YJWP 2QJKB 5KAIH 4EIJA 3RL0D 2YVJB 3AE4C 1SQVK 1SLQA 4N78E 2JWDA 3CC4P 2M0BA 1GD2E 2YXQB 3VMAA 4XA4A 4NBCD 3USSA 4AUWA 3B8EB 1PPJG 2Y9YA 2BASA 2FY8A 2HMJA 1N7SB 3PLNA 1FAVA 3OJAB 1NTKK 1QLED 1AQ5A 4GOFA 5KLVG 1L4AD 1K04A 3H1JE 3HD7A 1K05A 1JEKA 1X0TA 2Y0EA 3AEBC 5AVZB 2O1JA 2SPZA 2OYHB 4B86A 1KB9H 1KV4A 3E1IA 1RE4A 4I7ZB 2FXPA 3H1HE 4XE5B 4KT0J 5B5EH 2POHA 3GLMA 3NXSA 2ZYAA 1QGKB 3L70D 3SSUA 3AECC 2QSIA 3I56P 2BCCD 2E75C 1EDKA 2ZYGA 1OMIA 3PJSK 4HYTB 3MD0A 2HG5D 1BGYD 2ZYDA 2A45I 1U7MA 1H8AA 1A02F 1GU5A 1UIXA 1J2JB 2H43A 1Y47A 2FKWB 2WQYC 2QJPC 1HUCA 3M0DA 1GL2C 5KLVK 3Q5SA 4RJTA 3KHUA 4NBED 1SQXE 3VMZA 3E1RA 3L74D 4WY4B 1NYKA 1M56D 3A0HE 2DE7D 2OTKE 3BRTB 4ZKPA 3BCCE 3V2NA 2IX7C 3B5NB 1JY3O 1FS0E 1BGYE 3RL0g 2LKMA 1IFMA 4WVZA 2K9JA 1OIPA 1AJYA 3R4YA 3SFEC 2FFDA 1NAFA 1N73A 4OGQC 4CPGA 3A5TA 3IF4A 1LTJA 1L0NJ 1J1DB 3TGUJ 3M9BA 5APVA 3CX5D 5GTIH 2E43A 3OAKA 1L0LJ 3HE5A 3EN1A 2QEXP 3D71A 1NO4A 3H1KD 2J59M 1OW7A 1GK4A 4HJLA 1N2DC 1RF1C 3CCRP 4IFDK 1IK9A 3L75J 2Q3WA 1QX8A 3MTUE 2YIUB 3D6ZA 2KS1A 3CCUP 4H44C 3HE4B 3Q5RA 1OFCX 1PFIA 1BCCD 1G1IA 3G6EP 5APSA 2K1AA 5KAFH 2GM4A 3H1KE 2R3SA 3CWBE 2BCCG 2IBZG 1JMMA 3U59A 2I1JA 3S1KA 1L0NG 1RY3A 2YKPA 2W27A 1SQBD 1VCKA 2KNCB 4DT0A 3L72D 4AAYB 4GDOA 1L0LG 1OVVA 1ZW0A 4NBAD 4H0LD 1N7SD 2P1JA 1BCCE 1VL2A 3M0DC 1S5LE 3CMAP 1IFIA 2HR3A 1T2KC 3HTKA 5AVQB 1AQTA 5AW5B 3VYIA 1N8RQ 1NTMD 2B1XA 3L75G 1SQPJ 4EDFA 1SQBE 1O7WA 3L73D 4HJGH 3V6IA 1ZRTD 3V4QA 1LGHB 4L76A 1WT6A 2FYUD 2WPVB 3L72E 2Q1KA 2YMKA 1SFCC 2ZVNB 1L0NK 2D2CC 4DOJA 5CCGD 1EQ7A 2ZFCA 3RL0C 3L37A 3RK3E 2OYOA 4OH8B 1L0LK 1FZBA 4IL6H 3BATA 1NTME 2A06D 1PP9D 3CL3D 1GW4A 1NTZE 3C9IA 3WU2E 1LTSC 2JR8A 1ZRTE 2H7HA 3TNUB 2ZT9B 1SVFA 4C46A 1L4AC 2C0WA 3P32A 2P2UA 3A0HH 4HB1A 1KILB 4U7JA 2FYNC 3T97A 3I55P 1SQPG 1AV1A 1LTTC 2K9YA 4Z1MH 2A45G 4ASWA 1O7NA 2A06E 2JO1A 1YTZI 1S4XA 3AE3C 1X9VA 4R4MA 3TYYA 3HUSC 4PD4I 1IFDA 3AEDC 1N7SA 3S4RA 1NKZB 2ZJSE 2K37A 2WMMA 3K5BA 1HVVA 5KJ7D 3TF5A 3VMID 2WPSA 1PZQA 1KQGB 1KYOH 1VQOP 2HPCB 2OYHA 1NKNA 1BSNA 5BVZA 4P1BH 3QWOC 2WTYA 1SQPK 1EC5A 3KXDA 1HF9A 2PP6A 1KMIZ 1SS1A 2YO3A 1KB9E 4IOIH 5CCGA 2Q5UA 2KLVA 2FYUG 4BXLA 1AFOA 1K8AQ 2DE5D 5B5EE 2QIWA 2JWAA 3H1IE 2IDBA 2IPPA 4QUQA 3S9OA 3TSIA 2AXTH 1ZOYC 3H1LJ 4WY4A 1DH3A 2LXCB 1PGPA 1PP9G 5AVXB 3LW5J 3GTSA 2OYIB 2YKQA 2DW3A 3P8CD 1FZFA 1P84E 1USDA 1RQUA 1OVRA 1VF5B 3B5NA 1CI6B 2W6AA 4NBDD 4NBGD 4HM6A 3GHGC 1S5LH 1K9MQ 3CMEP 5KKZB 4AYCA 2OGUA 2LXBA 2V7QJ 1NTKE 2FYUK 3A0BE 3RBZA 5KTBA 2FYZA 3O6QB 4PD4D 1M1JB 4W7YA 1M8OB 4ZMDA 1HJBA 1LJ2A 2N1TA 1M57D 3IFMA 1W5CE 4U3FJ 1LTAC 3L4FA 1CZQA 2CKFA 1R8EA 1URQB 4EMJB 1DEEG 2Q3IA 1PL5A 2P58A 3M06A 1EG9A 3F5HA 3H1LG 5GTIE 3VMHD 4H0LC 4EOTA 1PPJE 3WU2H 3FWLA 4YPCA 2Y0CA 1G1JA 3HE4A 5CBOA 5AVYB 1KILD 2Q7CA 3OA7A 1LWUC 4PV1B 5BU8B 2B89A 1BSHA 1OVUA 4LLHA 3GTEA 4N78D 3D6YA 3VCPA 2O1KA 1PV3A 1S3JA 5CCGC 2R44A 2KNCA 4U3FG 2R3CA 3AEAC 3H1JD 2P67A 1SQQJ 3A7OA 2L5GB 3VP8A 3UIAA 1KILE 2WSEJ 3ZDMA 1CSBA 2IFMA 2M3BA 1QL2A 4QCKA 1GU4A 3H1HD 4D6TJ 1N86A 2KSEA 3GG2A 3HRNA 4RKUJ 2DE6D 4L74A 2L91A 1VQMP 2C9LY 4HM1A 3CX5I 3A3YB 2WT7B 2G8YA 1KQSO 3RK3B 1ZV8A 1O7HA 2O01H 1X22A 2W83C 1FZCC 1QVGO 1ULIA 1SQXD 5KLIB 4JQ0D 1H0TB 1NVOA 3H1JJ 3CCMP 3M91A 1J1DC 2E5TA 4N6JA 2AEFA 5AW8B 3AE6C 1GTWA 3BCCD 2M8RA 3V5BA 1JCDA 1LT9B 1SQQG 3CCLP 2QM8A 3TNUA 2ITAA 3FXDA 4IL6E 3CI9A 2P7JA 4Y99B 2QRXA 5KJ7C 3H1HJ 4GOEA 4L73A 1JY2N 2KUBA 2W6BA 2Y9ZA 3DQYA 1KILA 1Q86Q 3BRVB 4D6TG 3OW2O 1P84H 4YXWH 3Q2YA 2BEZF 2E74B 4H13C 3EQ2A 5AVVB 2QJYB 3NFQA 2OTLP 1VDFA 4EI2A 2BMQA 2V7QH 4RO0A 1EDJA 3A0BH 1HGVA 3GOBA 1PGOA 1RFSA 1J1EC 1HBWA 1JM1A 1FE6A 1SQQK 3L70J 2YXRB 3WUVA 3H1JG 1URQD 2RMZA 2BCCJ 2IBZE 2KOGA 1BGYJ 1MUUA 1L0NE 3JSVC 3GW6A 4BWNA 3TGUE 2HPCA 1O7GA 5GTHE 2RN0A 2N1TB 2YKOA 3Q3DA 1YBKA 2E76C 3H1HG 1L0LE 2QVAA 3M9QA 3L74J 1KYOE 1LT1A 4OWFA 1AVOA 3IAOA 3CWBD 4YXDC 2WSFH 3CXHH 1VQLP 1DD3A 2HMOA 3F89A 2E75B 3AE1C 3I5CA 2AXCA 3HD7C 3E7KA 1SQXG 3ABVC 3KDPB 1WQLA 2I8DA 1GL2B 1G2CB 1JY2P 1D7MA 3MZWB 2Z4EA 4DCKA 1RE4C 5AVTB 2OYIA 3L70G 4HM0A 1JCCA 4BRYB 4C7NA 2PRRA 1EXJA 2AXTE 1EZVE 1T6AA 2JJLA 4K35A 4I6MC 3PHLA 1M90Q 1BGYG 1NYHA 1G8KB 1CI6A 1VQPP 2HMKA 4N3YB 2FBWC 3L35A 1JTHB 1GMJA 4NB9D 3H1KJ 3V4WA 3CWBJ 1FQTA 4DZOA 3L74G 3U1CA 3CLQA 3O6QA 3V2RA 1KILC 1HH0A 1RE3A 1M1JA 4OGQB 1KB9I 2GA1A 1FU1A 2GBWA 3PP5A 4NBFD 3RK3D 4EYYQ 1S9KE 1NOHA 2LR2A 3VN0A 1HGZA 1BE3D 2KXPB 1NTZD 1URQA 1BCCJ 2WITA 3KZIE 2M5AB 1FJKA 3MGNA 1RF0A 3LIDA 5AVSB 2FFDC 3GF3A 1Q90D 2YMYA 1RF1B 1N73C 1SQBJ 4Y28J 1P84I 2B87A 3KPEA 4RESB 1LTJC 4WWIA 2RH0A 3L72J 1K73Q 1GK6A 1BE3E 3MUDA 2HMLA 3AE9C 1KFNA 3H1KG 3CWBG 2E74D 4WY4D 2CK3H 2Q6QA 3AE5C 1RQVA 3D89A 4DJGA 1SJGA 4NBHD 1XTCC 3BVHA 3CD6P 4L75A 2KZJA 1NTMJ 1L2PA 4KHXA 4HM4A 2B24A 3B5ND 3L73J 1NU1E 2FYUJ 1VPCA 1BCCG 1TU3F 1JY3N 3JCUE 1OW8A 1QL1A 3RBXA 1X79B 2Y0DA 3PH0A 5CJ4A 2OYIC 2NRGA 2N1TD 1SQBG 4HM5A 3AEEC 4JYBA 1PP9J 1KB9D 1KN7A 2K88A 3FGAD 5GTHH 2NPSB 3L72G 1NAYA 2KZIA 1XTGB 2WSCJ 2WT7A 1E5WA 3C1LA 1MV8A 3H1ID 5BU5A 2XSHA 2JEEA 2KI7B 2QE7H 1QEXA 5APQA 3P7KA 3MP7B 1WRGA 5APTA 4HKVA 1OX3A 2KP8A 1M1JC 1H0TA 1NTMG 2HMMA 5DJUB 4WBAA 5APWA 3AE2C 4IFMA 2ZAEB 3RK2B 3N0QA 3II6A 3L73G 1FOSF 1P84D 1LTBC 1R5LA 1LT9A 1VQ4P 1LP1B 2HODB 4W80A 3D70A 3GKEA 4P1CH 5AVWB 2PAJA 1SQBK 1L4AB 2BMOA 3FXEA 2WPQA 1NTKD 2BEQD 3PRJA 4LGDE 1JNMA 5M1BA 2A06G 2YFJA 1IJDB 4C7NB 2QPZA 1SQVE 4HM2A 1LTIC 1YITP 1YHQP 2R5BA 1NTMK 3V2QA 1LTGC 1JY3P 2YFLA 3IN6A 2O3JA 2FXMA 3HUSB 1HTLC 1IK7A 1YTZT 3NTNA 4NB8D 3B71A 1O7PA 3NMDA 3AE8C 1FDMA 1PPJD 2E5YA 1ULJA 2A45H 4XFJA 3CCEP 2B88A 2R32A 1YQ3C 2CPSA 2I1KA 3CXHD 2QA4P 3KZIH 5KLVD 2QJKC 3L71E 3GMAA 3CCJP 3W67A 3WUUA 1NJIQ 1FZAA 1JUNA 2C0XA 1T3UA 4QUPA 4AQRD 2GUSA 2WWWA 1KC8Q 5HL4A 3Q1MA 4OVNF 1JM0A 1H88A 2JP3A 1N7SC 3QH9A 1ZN5A 2ZT9D 2KSJA 1S72P 2XKMA 2B87B 3RK3C 3CXHE 5KLVE 4O9BA 4HM3A 1KQFB 2OYHC 1GL2A 2M3EA 1G2CA 3FWNA 1BDCA 1ZLLA 1H89A 4I7ZC 5H2FH 2WSSH 3O8ZA 3W68A 3BASA 4BRYA 2R5DA 1GW3A 2FXOA 1S2EA 5AW6B 2UWJE 4PJ0E 1JTHA 4QMAA 3JCUH 1IZNB 3GHGB 1VQ8P 2N9BA 4YTPC 1KYOI 1Q7YQ 2XNXA 1OW6A 2NPSD 1YYCA 2PGDA 3SWKA 5AW3B 5CBNA 2E74C 4WY4C 3RGUA 1EDIA 2IZ1A 1T3JA 2AEJA 3B5NC 1MFTA 3EFGA 2JO6A 2M5AA 3G4SP 3RK2D 3V2PA 3TDKA 1VQ5P 3AE7C 3KQGA 1DD4A 1RF1A 1IO4A 1N7LA 3L36A 4H0LB 1EZVI 3MHVA 1VQKP 4KJMA 1USEA 2VRSA 4HM7A 3GB4A 1GZLA 5CCHD 1PIXA 3H32B 2IFNA 2N1TC 4JPZB 2H8PD 1LWUB 2XNDH 1SP4A 1HJ0A 1NH4A 2ZXXA 3GL2A 3LW5H 1VF5D 2GBXA 4UB8H 3B4SA 1A02J 4I1LA 2IBZD 4K3AA 2YIUC 5C39A 1L0ND 2Z5IA 3TGUD 3CC7P 5AVRB 5APUA 1IFJA 2NUKA 1L0LD 3VMGD 1SQXJ 2W90A 1KYOD 3WUTA 5EFWB 1KORA 4HM8A 2NPSA 1CW5A 3SWFA 3L70E 3AZCA 2JKVA 2HFED 3WMM0 3BCCJ 1JO5A 1MFZA 2BCCE 1YQ4C 2NZ2A 1O7MA 2YNYA 3L75D 2IYOA 2ZXEB 2KYVA 3GCEA 2IZ0A 1NGMB 1SFCA 4ZKUA 4M3LA 1ZR2A 2XRXA 3U1AA 1KD1Q 4TT3H 2QM7A 2V4HA 1Q82Q 1FZCB 3L74E 5TISE 2QG4A 2WPRA 2NVFA 3R2PA 3VOPA 3KYQA 1EZVD 4PV1D 1LP1A 1Z56A 2HODA 5AW7B 3L75E 3TK1A 1L4AA 5CCHA 5K5GB 4JF7A 4PD4H 2NVEA 4LC1A 4W7ZA 1OZHA 3N7NA 1UUVA 3H6PA 2QJPB 1JMBA 3N4XA 1U57A 4PJ0H 4QDFB 4H13B 3BCCG 1S9KD 1FJPA 2YO2A 3VP9A 3SFDC 4GIFA 1SQPD 3CX5E 1YI2P 1VQ6P 2WSEH 2ZT9C 4A7PA 2E4QA 3HUSA 3JC22 1J1EB 2XSOA 4GODA 4QURA 5AW2B 4I2LC 3TGUG 2O01N 2WVRA 4HH2A 2H89C 1FC2C 1SQXK 1SQPE 4JBZA 1LNQA 2E76B 4UB6E 4NPFX 3EQQA 3ITKA 3C0DA 5AVUB 2NPSC 1AA0A 3LIEA 3FOUA 1OXZA 3MIWA 1NU1D 3M0AA 4TLFA 1PGJA 1YJ9P 2OQQA 1BDDA 2KK7A 1JOCA 1U7JA 3HD7B
chains in the Genus database with same CATH topology
2HMKA 2BMQA 2HMNA 1NU1E 4NBBD 1NTKE 1UUVA 2YFJA 5BOKA 3H1JE 4NB9D 1VF5D 2GBXA 2B1XA 3GOBA 1NDOA 2QPZA 4H13D 2BMRA 1SQVE 4HM2A 4QCKA 1RFSA 1FQTA 4QDFB 1SQBE 1O7WA 2YIUC 1JM1A 3VMID 3EN1A 3GL0A 3GZXA 2YFLA 2DE6D 4AIVA 3L72E 4QDFA 5KLIC 1RIEA 3H1LE 4PD4E 2IBZE 3CX5E 2GBWA 4NBFD 3L73E 3H1HE 5AEWA 2CKFA 2NUKA 4HM1A 1L0NE 4HM5A 4P1BH 4EMJB 4HJLA 3VMGD 2FYUE 3TGUE 1O7GA 4NB8D 1O7PA 2E4QA 1O7HA 2JZAA 2NVGA 2E4PA 1Q90C 1EG9A 2Q3WA 1UUWA 4OGQD 1ULJA 2XSOA 3VMHD 4HM8A 4QURA 1L0LE 4QDCA 1KB9E 1NTME 3L70E 3AZCA 1KYOE 1ULIA 1SQQE 2XSHA 2QJKC 2BCCE 1NTZE 3L71E 1PPJE 1O7MA 2DE5D 1G8JB 1ZRTE 2ZYLA 2JO6A 3GZYA 2QJPC 2NWFA 5CXMA 3GCEA 4NBED 4HKVA 1PP9E 1SQXE 2HMOA 3H1IE 2XRXA 4QUPA 2E76D 2HMMA 4QUQA 1SQPE 3H1KE 5HL4A 3CWBE 1NYKA 3VCAA 4D6TE 2QJYC 3N0QA 2DE7D 3GTEA 3L74E 1BE3E 1VM9A 2D2CD 2NUMA 3BCCE 2XR8A 3VCPA 5KKZC 4HM7A 4U3FE 3EQQA 3GB4A 2HMLA 2ZT9D 3C0DA 2NVFA 2FYNC 1VCKA 3DQYA 3GTSA 2YVJB 5AEUA 3GKEA 1WQLA 4P1CH 1BGYE 2E74D 2E75D 3CXHE 4AAYB 1P84E 1O7NA 2A06E 4PV1D 5KLVE 2BMOA 3D89A 3FOUA 4HM3A 1SJGA 4H0LD 4HM0A 4NBHD 4NBAD 3L75E 4NBCD 4NBDD 1EZVE 4NBGD 1BCCE 2I7FA 4HM6A 4H44D 2HMJA 4HM4A 2B24A 3GL2A 2YFIA 2NVEA 1G8KB 4QDDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HMK A;  2BMQ A;  2HMN A;  1NU1 E;  4NBB D;  1NTK E;  1UUV A;  2YFJ A;  5BOK A;  3H1J E;  4NB9 D;  1VF5 D;  2GBX A;  2B1X A;  3GOB A;  1NDO A;  2QPZ A;  4H13 D;  2BMR A;  1SQV E;  4HM2 A;  4QCK A;  1RFS A;  1FQT A;  4QDF B;  1SQB E;  1O7W A;  2YIU C;  1JM1 A;  3VMI D;  3EN1 A;  3GL0 A;  3GZX A;  2YFL A;  2DE6 D;  4AIV A;  3L72 E;  4QDF A;  5KLI C;  1RIE A;  3H1L E;  4PD4 E;  2IBZ E;  3CX5 E;  2GBW A;  4NBF D;  3L73 E;  3H1H E;  5AEW A;  2CKF A;  2NUK A;  4HM1 A;  1L0N E;  4HM5 A;  4P1B H;  4EMJ B;  4HJL A;  3VMG D;  2FYU E;  3TGU E;  1O7G A;  4NB8 D;  1O7P A;  2E4Q A;  1O7H A;  2JZA A;  2NVG A;  2E4P A;  1Q90 C;  1EG9 A;  2Q3W A;  1UUW A;  4OGQ D;  1ULJ A;  2XSO A;  3VMH D;  4HM8 A;  4QUR A;  1L0L E;  4QDC A;  1KB9 E;  1NTM E;  3L70 E;  3AZC A;  1KYO E;  1ULI A;  1SQQ E;  2XSH A;  2QJK C;  2BCC E;  1NTZ E;  3L71 E;  1PPJ E;  1O7M A;  2DE5 D;  1G8J B;  1ZRT E;  2ZYL A;  2JO6 A;  3GZY A;  2QJP C;  2NWF A;  5CXM A;  3GCE A;  4NBE D;  4HKV A;  1PP9 E;  1SQX E;  2HMO A;  3H1I E;  2XRX A;  4QUP A;  2E76 D;  2HMM A;  4QUQ A;  1SQP E;  3H1K E;  5HL4 A;  3CWB E;  1NYK A;  3VCA A;  4D6T E;  2QJY C;  3N0Q A;  2DE7 D;  3GTE A;  3L74 E;  1BE3 E;  1VM9 A;  2D2C D;  2NUM A;  3BCC E;  2XR8 A;  3VCP A;  5KKZ C;  4HM7 A;  4U3F E;  3EQQ A;  3GB4 A;  2HML A;  2ZT9 D;  3C0D A;  2NVF A;  2FYN C;  1VCK A;  3DQY A;  3GTS A;  2YVJ B;  5AEU A;  3GKE A;  1WQL A;  4P1C H;  1BGY E;  2E74 D;  2E75 D;  3CXH E;  4AAY B;  1P84 E;  1O7N A;  2A06 E;  4PV1 D;  5KLV E;  2BMO A;  3D89 A;  3FOU A;  4HM3 A;  1SJG A;  4H0L D;  4HM0 A;  4NBH D;  4NBA D;  3L75 E;  4NBC D;  4NBD D;  1EZV E;  4NBG D;  1BCC E;  2I7F A;  4HM6 A;  4H44 D;  2HMJ A;  4HM4 A;  2B24 A;  3GL2 A;  2YFI A;  2NVE A;  1G8K B;  4QDD A; 
#chains in the Genus database with same CATH topology
 5AW1 B;  4H44 B;  4NPE A;  3P8M C;  3PTZ A;  1EZV G;  2BMR A;  1E79 H;  4ZNC A;  4IFF A;  2K3R A;  3RK2 C;  3CC2 P;  1GDT A;  3GZX A;  1BE3 J;  5B66 E;  5H2F E;  4MN4 C;  1RIE A;  1M1K Q;  1NTZ J;  3L73 E;  2HLO A;  3C8V A;  3GHG A;  1VQN P;  5AW9 B;  2FYU E;  5APX A;  5CCH C;  3IR9 A;  3CPW O;  2NVG A;  2E4P A;  2OTJ P;  1R5S A;  2AEM A;  3VMX A;  4QDC A;  1ZP0 C;  4IL6 X;  1X8Y A;  5E79 E;  1NU1 J;  3Q5P A;  1ZXG A;  2ZYL A;  4HKZ H;  3GZY A;  1PP9 E;  1VF5 C;  3CXH I;  1IFP A;  2N9Y B;  1Y9B A;  2C9N Y;  1PGQ A;  1FBM A;  2Z5H A;  5KKZ C;  2K9J B;  5TIS H;  1SFC B;  5KAI E;  1KTM A;  2FFD B;  5TJH A;  2W8Z A;  2D2C B;  2KB7 P;  2E75 D;  4C7R A;  3VTP C;  1FOS E;  1RE3 C;  3H1L D;  1N73 B;  1AVY A;  3RL0 B;  1BE3 G;  3G9R A;  2W6J H;  3H32 A;  3EWK A;  1NTZ G;  1LTJ B;  2I7F A;  5AW0 B;  1DEB A;  1WMK A;  1Y8A A;  1SQV D;  4QDD A;  1W2B O;  1GL2 D;  1LWU A;  2HMN A;  1URQ C;  1HWT C;  1DIP A;  4NPD A;  4H13 D;  1NDO A;  1QVF O;  3HE5 B;  1VQ7 P;  2O01 J;  2Q3E A;  1VQ9 P;  4GKG A;  1FDO A;  1RF0 C;  1Q81 Q;  2JDI H;  3CCV P;  1NU1 G;  4AIV A;  3FX0 A;  3H1L E;  3M9H A;  3CX5 H;  5AEW A;  3EFF K;  2E42 A;  2FYN B;  1OWA A;  3H1I J;  1RH5 B;  4UB8 E;  4WB4 A;  2KS1 B;  1W2E A;  2JZA A;  1FDI A;  4U3F D;  1S1C X;  1KQL A;  3L71 D;  4OGQ D;  3MUD C;  4PV1 C;  1YJN P;  3GF7 A;  3G71 P;  1JY2 O;  2P10 A;  2ZVO B;  1NTZ K;  5DJT B;  2J5U A;  1ZME C;  3AEF C;  5CJ0 A;  1ZR4 A;  1MKM A;  1RHZ B;  5AW4 B;  2NWF A;  1SQV J;  3VMY A;  5L8R J;  1NHL A;  2E76 D;  3A2A A;  1NWQ A;  3VCA A;  4GT1 A;  3SWY A;  1NU1 K;  4UB6 H;  2XR8 A;  2H88 C;  1IFN A;  4U3F E;  1NTK J;  2CPB A;  1FZC A;  5AEU A;  1IC2 A;  2MJZ A;  2MKV A;  3AEG C;  5CHX A;  3HD7 D;  3HTK B;  3CCS P;  2OAR A;  2XU6 A;  2XZR A;  4ASV A;  2KLU A;  3P8C E;  4H44 D;  3CCQ P;  2YFI A;  3L71 J;  1S5L X;  4NBB D;  3H1I G;  3H25 A;  5BOK A;  2B9B A;  1KFM A;  1KZU B;  5KJ7 A;  2HYN A;  1SQQ D;  5CMZ A;  1FZG A;  4R4L A;  3GL0 A;  5APY A;  2RKL A;  4QDF A;  5B66 H;  5KLI C;  2XV5 A;  1MZ9 A;  4PD4 E;  1SQV G;  4JYC A;  1Q2N A;  4D6T D;  2IBZ I;  2WSF J;  2XDJ A;  5KLV J;  1DX7 A;  1LT9 C;  1Q90 C;  1FZE A;  1UUW A;  1T2K D;  4Y99 C;  3G3Z A;  1NTK G;  2G3A A;  1SQQ E;  2KIK A;  2IYP A;  5E79 H;  1T8Z A;  2GUV A;  1G8J B;  1M7L A;  5CXM A;  2WZ7 A;  1EDL A;  2Q9I A;  5KAF E;  2J58 A;  1EXI A;  1YIJ P;  1UII A;  2WSC H;  2QJY C;  4D6T E;  3L71 G;  1SFC D;  3T97 B;  1VM9 A;  2D2C D;  2NUM A;  2PFX A;  1JB0 J;  1YJW P;  2QJK B;  5KAI H;  4EIJ A;  3RL0 D;  2YVJ B;  3AE4 C;  1SQV K;  1SLQ A;  4N78 E;  2JWD A;  3CC4 P;  2M0B A;  1GD2 E;  2YXQ B;  3VMA A;  4XA4 A;  4NBC D;  3USS A;  4AUW A;  3B8E B;  1PPJ G;  2Y9Y A;  2BAS A;  2FY8 A;  2HMJ A;  1N7S B;  3PLN A;  1FAV A;  3OJA B;  1NTK K;  1QLE D;  1AQ5 A;  4GOF A;  5KLV G;  1L4A D;  1K04 A;  3H1J E;  3HD7 A;  1K05 A;  1JEK A;  1X0T A;  2Y0E A;  3AEB C;  5AVZ B;  2O1J A;  2SPZ A;  2OYH B;  4B86 A;  1KB9 H;  1KV4 A;  3E1I A;  1RE4 A;  4I7Z B;  2FXP A;  3H1H E;  4XE5 B;  4KT0 J;  5B5E H;  2POH A;  3GLM A;  3NXS A;  2ZYA A;  1QGK B;  3L70 D;  3SSU A;  3AEC C;  2QSI A;  3I56 P;  2BCC D;  2E75 C;  1EDK A;  2ZYG A;  1OMI A;  3PJS K;  4HYT B;  3MD0 A;  2HG5 D;  1BGY D;  2ZYD A;  2A45 I;  1U7M A;  1H8A A;  1A02 F;  1GU5 A;  1UIX A;  1J2J B;  2H43 A;  1Y47 A;  2FKW B;  2WQY C;  2QJP C;  1HUC A;  3M0D A;  1GL2 C;  5KLV K;  3Q5S A;  4RJT A;  3KHU A;  4NBE D;  1SQX E;  3VMZ A;  3E1R A;  3L74 D;  4WY4 B;  1NYK A;  1M56 D;  3A0H E;  2DE7 D;  2OTK E;  3BRT B;  4ZKP A;  3BCC E;  3V2N A;  2IX7 C;  3B5N B;  1JY3 O;  1FS0 E;  1BGY E;  3RL0 g;  2LKM A;  1IFM A;  4WVZ A;  2K9J A;  1OIP A;  1AJY A;  3R4Y A;  3SFE C;  2FFD A;  1NAF A;  1N73 A;  4OGQ C;  4CPG A;  3A5T A;  3IF4 A;  1LTJ A;  1L0N J;  1J1D B;  3TGU J;  3M9B A;  5APV A;  3CX5 D;  5GTI H;  2E43 A;  3OAK A;  1L0L J;  3HE5 A;  3EN1 A;  2QEX P;  3D71 A;  1NO4 A;  3H1K D;  2J59 M;  1OW7 A;  1GK4 A;  4HJL A;  1N2D C;  1RF1 C;  3CCR P;  4IFD K;  1IK9 A;  3L75 J;  2Q3W A;  1QX8 A;  3MTU E;  2YIU B;  3D6Z A;  2KS1 A;  3CCU P;  4H44 C;  3HE4 B;  3Q5R A;  1OFC X;  1PFI A;  1BCC D;  1G1I A;  3G6E P;  5APS A;  2K1A A;  5KAF H;  2GM4 A;  3H1K E;  2R3S A;  3CWB E;  2BCC G;  2IBZ G;  1JMM A;  3U59 A;  2I1J A;  3S1K A;  1L0N G;  1RY3 A;  2YKP A;  2W27 A;  1SQB D;  1VCK A;  2KNC B;  4DT0 A;  3L72 D;  4AAY B;  4GDO A;  1L0L G;  1OVV A;  1ZW0 A;  4NBA D;  4H0L D;  1N7S D;  2P1J A;  1BCC E;  1VL2 A;  3M0D C;  1S5L E;  3CMA P;  1IFI A;  2HR3 A;  1T2K C;  3HTK A;  5AVQ B;  1AQT A;  5AW5 B;  3VYI A;  1N8R Q;  1NTM D;  2B1X A;  3L75 G;  1SQP J;  4EDF A;  1SQB E;  1O7W A;  3L73 D;  4HJG H;  3V6I A;  1ZRT D;  3V4Q A;  1LGH B;  4L76 A;  1WT6 A;  2FYU D;  2WPV B;  3L72 E;  2Q1K A;  2YMK A;  1SFC C;  2ZVN B;  1L0N K;  2D2C C;  4DOJ A;  5CCG D;  1EQ7 A;  2ZFC A;  3RL0 C;  3L37 A;  3RK3 E;  2OYO A;  4OH8 B;  1L0L K;  1FZB A;  4IL6 H;  3BAT A;  1NTM E;  2A06 D;  1PP9 D;  3CL3 D;  1GW4 A;  1NTZ E;  3C9I A;  3WU2 E;  1LTS C;  2JR8 A;  1ZRT E;  2H7H A;  3TNU B;  2ZT9 B;  1SVF A;  4C46 A;  1L4A C;  2C0W A;  3P32 A;  2P2U A;  3A0H H;  4HB1 A;  1KIL B;  4U7J A;  2FYN C;  3T97 A;  3I55 P;  1SQP G;  1AV1 A;  1LTT C;  2K9Y A;  4Z1M H;  2A45 G;  4ASW A;  1O7N A;  2A06 E;  2JO1 A;  1YTZ I;  1S4X A;  3AE3 C;  1X9V A;  4R4M A;  3TYY A;  3HUS C;  4PD4 I;  1IFD A;  3AED C;  1N7S A;  3S4R A;  1NKZ B;  2ZJS E;  2K37 A;  2WMM A;  3K5B A;  1HVV A;  5KJ7 D;  3TF5 A;  3VMI D;  2WPS A;  1PZQ A;  1KQG B;  1KYO H;  1VQO P;  2HPC B;  2OYH A;  1NKN A;  1BSN A;  5BVZ A;  4P1B H;  3QWO C;  2WTY A;  1SQP K;  1EC5 A;  3KXD A;  1HF9 A;  2PP6 A;  1KMI Z;  1SS1 A;  2YO3 A;  1KB9 E;  4IOI H;  5CCG A;  2Q5U A;  2KLV A;  2FYU G;  4BXL A;  1AFO A;  1K8A Q;  2DE5 D;  5B5E E;  2QIW A;  2JWA A;  3H1I E;  2IDB A;  2IPP A;  4QUQ A;  3S9O A;  3TSI A;  2AXT H;  1ZOY C;  3H1L J;  4WY4 A;  1DH3 A;  2LXC B;  1PGP A;  1PP9 G;  5AVX B;  3LW5 J;  3GTS A;  2OYI B;  2YKQ A;  2DW3 A;  3P8C D;  1FZF A;  1P84 E;  1USD A;  1RQU A;  1OVR A;  1VF5 B;  3B5N A;  1CI6 B;  2W6A A;  4NBD D;  4NBG D;  4HM6 A;  3GHG C;  1S5L H;  1K9M Q;  3CME P;  5KKZ B;  4AYC A;  2OGU A;  2LXB A;  2V7Q J;  1NTK E;  2FYU K;  3A0B E;  3RBZ A;  5KTB A;  2FYZ A;  3O6Q B;  4PD4 D;  1M1J B;  4W7Y A;  1M8O B;  4ZMD A;  1HJB A;  1LJ2 A;  2N1T A;  1M57 D;  3IFM A;  1W5C E;  4U3F J;  1LTA C;  3L4F A;  1CZQ A;  2CKF A;  1R8E A;  1URQ B;  4EMJ B;  1DEE G;  2Q3I A;  1PL5 A;  2P58 A;  3M06 A;  1EG9 A;  3F5H A;  3H1L G;  5GTI E;  3VMH D;  4H0L C;  4EOT A;  1PPJ E;  3WU2 H;  3FWL A;  4YPC A;  2Y0C A;  1G1J A;  3HE4 A;  5CBO A;  5AVY B;  1KIL D;  2Q7C A;  3OA7 A;  1LWU C;  4PV1 B;  5BU8 B;  2B89 A;  1BSH A;  1OVU A;  4LLH A;  3GTE A;  4N78 D;  3D6Y A;  3VCP A;  2O1K A;  1PV3 A;  1S3J A;  5CCG C;  2R44 A;  2KNC A;  4U3F G;  2R3C A;  3AEA C;  3H1J D;  2P67 A;  1SQQ J;  3A7O A;  2L5G B;  3VP8 A;  3UIA A;  1KIL E;  2WSE J;  3ZDM A;  1CSB A;  2IFM A;  2M3B A;  1QL2 A;  4QCK A;  1GU4 A;  3H1H D;  4D6T J;  1N86 A;  2KSE A;  3GG2 A;  3HRN A;  4RKU J;  2DE6 D;  4L74 A;  2L91 A;  1VQM P;  2C9L Y;  4HM1 A;  3CX5 I;  3A3Y B;  2WT7 B;  2G8Y A;  1KQS O;  3RK3 B;  1ZV8 A;  1O7H A;  2O01 H;  1X22 A;  2W83 C;  1FZC C;  1QVG O;  1ULI A;  1SQX D;  5KLI B;  4JQ0 D;  1H0T B;  1NVO A;  3H1J J;  3CCM P;  3M91 A;  1J1D C;  2E5T A;  4N6J A;  2AEF A;  5AW8 B;  3AE6 C;  1GTW A;  3BCC D;  2M8R A;  3V5B A;  1JCD A;  1LT9 B;  1SQQ G;  3CCL P;  2QM8 A;  3TNU A;  2ITA A;  3FXD A;  4IL6 E;  3CI9 A;  2P7J A;  4Y99 B;  2QRX A;  5KJ7 C;  3H1H J;  4GOE A;  4L73 A;  1JY2 N;  2KUB A;  2W6B A;  2Y9Z A;  3DQY A;  1KIL A;  1Q86 Q;  3BRV B;  4D6T G;  3OW2 O;  1P84 H;  4YXW H;  3Q2Y A;  2BEZ F;  2E74 B;  4H13 C;  3EQ2 A;  5AVV B;  2QJY B;  3NFQ A;  2OTL P;  1VDF A;  4EI2 A;  2BMQ A;  2V7Q H;  4RO0 A;  1EDJ A;  3A0B H;  1HGV A;  3GOB A;  1PGO A;  1RFS A;  1J1E C;  1HBW A;  1JM1 A;  1FE6 A;  1SQQ K;  3L70 J;  2YXR B;  3WUV A;  3H1J G;  1URQ D;  2RMZ A;  2BCC J;  2IBZ E;  2KOG A;  1BGY J;  1MUU A;  1L0N E;  3JSV C;  3GW6 A;  4BWN A;  3TGU E;  2HPC A;  1O7G A;  5GTH E;  2RN0 A;  2N1T B;  2YKO A;  3Q3D A;  1YBK A;  2E76 C;  3H1H G;  1L0L E;  2QVA A;  3M9Q A;  3L74 J;  1KYO E;  1LT1 A;  4OWF A;  1AVO A;  3IAO A;  3CWB D;  4YXD C;  2WSF H;  3CXH H;  1VQL P;  1DD3 A;  2HMO A;  3F89 A;  2E75 B;  3AE1 C;  3I5C A;  2AXC A;  3HD7 C;  3E7K A;  1SQX G;  3ABV C;  3KDP B;  1WQL A;  2I8D A;  1GL2 B;  1G2C B;  1JY2 P;  1D7M A;  3MZW B;  2Z4E A;  4DCK A;  1RE4 C;  5AVT B;  2OYI A;  3L70 G;  4HM0 A;  1JCC A;  4BRY B;  4C7N A;  2PRR A;  1EXJ A;  2AXT E;  1EZV E;  1T6A A;  2JJL A;  4K35 A;  4I6M C;  3PHL A;  1M90 Q;  1BGY G;  1NYH A;  1G8K B;  1CI6 A;  1VQP P;  2HMK A;  4N3Y B;  2FBW C;  3L35 A;  1JTH B;  1GMJ A;  4NB9 D;  3H1K J;  3V4W A;  3CWB J;  1FQT A;  4DZO A;  3L74 G;  3U1C A;  3CLQ A;  3O6Q A;  3V2R A;  1KIL C;  1HH0 A;  1RE3 A;  1M1J A;  4OGQ B;  1KB9 I;  2GA1 A;  1FU1 A;  2GBW A;  3PP5 A;  4NBF D;  3RK3 D;  4EYY Q;  1S9K E;  1NOH A;  2LR2 A;  3VN0 A;  1HGZ A;  1BE3 D;  2KXP B;  1NTZ D;  1URQ A;  1BCC J;  2WIT A;  3KZI E;  2M5A B;  1FJK A;  3MGN A;  1RF0 A;  3LID A;  5AVS B;  2FFD C;  3GF3 A;  1Q90 D;  2YMY A;  1RF1 B;  1N73 C;  1SQB J;  4Y28 J;  1P84 I;  2B87 A;  3KPE A;  4RES B;  1LTJ C;  4WWI A;  2RH0 A;  3L72 J;  1K73 Q;  1GK6 A;  1BE3 E;  3MUD A;  2HML A;  3AE9 C;  1KFN A;  3H1K G;  3CWB G;  2E74 D;  4WY4 D;  2CK3 H;  2Q6Q A;  3AE5 C;  1RQV A;  3D89 A;  4DJG A;  1SJG A;  4NBH D;  1XTC C;  3BVH A;  3CD6 P;  4L75 A;  2KZJ A;  1NTM J;  1L2P A;  4KHX A;  4HM4 A;  2B24 A;  3B5N D;  3L73 J;  1NU1 E;  2FYU J;  1VPC A;  1BCC G;  1TU3 F;  1JY3 N;  3JCU E;  1OW8 A;  1QL1 A;  3RBX A;  1X79 B;  2Y0D A;  3PH0 A;  5CJ4 A;  2OYI C;  2NRG A;  2N1T D;  1SQB G;  4HM5 A;  3AEE C;  4JYB A;  1PP9 J;  1KB9 D;  1KN7 A;  2K88 A;  3FGA D;  5GTH H;  2NPS B;  3L72 G;  1NAY A;  2KZI A;  1XTG B;  2WSC J;  2WT7 A;  1E5W A;  3C1L A;  1MV8 A;  3H1I D;  5BU5 A;  2XSH A;  2JEE A;  2KI7 B;  2QE7 H;  1QEX A;  5APQ A;  3P7K A;  3MP7 B;  1WRG A;  5APT A;  4HKV A;  1OX3 A;  2KP8 A;  1M1J C;  1H0T A;  1NTM G;  2HMM A;  5DJU B;  4WBA A;  5APW A;  3AE2 C;  4IFM A;  2ZAE B;  3RK2 B;  3N0Q A;  3II6 A;  3L73 G;  1FOS F;  1P84 D;  1LTB C;  1R5L A;  1LT9 A;  1VQ4 P;  1LP1 B;  2HOD B;  4W80 A;  3D70 A;  3GKE A;  4P1C H;  5AVW B;  2PAJ A;  1SQB K;  1L4A B;  2BMO A;  3FXE A;  2WPQ A;  1NTK D;  2BEQ D;  3PRJ A;  4LGD E;  1JNM A;  5M1B A;  2A06 G;  2YFJ A;  1IJD B;  4C7N B;  2QPZ A;  1SQV E;  4HM2 A;  1LTI C;  1YIT P;  1YHQ P;  2R5B A;  1NTM K;  3V2Q A;  1LTG C;  1JY3 P;  2YFL A;  3IN6 A;  2O3J A;  2FXM A;  3HUS B;  1HTL C;  1IK7 A;  1YTZ T;  3NTN A;  4NB8 D;  3B71 A;  1O7P A;  3NMD A;  3AE8 C;  1FDM A;  1PPJ D;  2E5Y A;  1ULJ A;  2A45 H;  4XFJ A;  3CCE P;  2B88 A;  2R32 A;  1YQ3 C;  2CPS A;  2I1K A;  3CXH D;  2QA4 P;  3KZI H;  5KLV D;  2QJK C;  3L71 E;  3GMA A;  3CCJ P;  3W67 A;  3WUU A;  1NJI Q;  1FZA A;  1JUN A;  2C0X A;  1T3U A;  4QUP A;  4AQR D;  2GUS A;  2WWW A;  1KC8 Q;  5HL4 A;  3Q1M A;  4OVN F;  1JM0 A;  1H88 A;  2JP3 A;  1N7S C;  3QH9 A;  1ZN5 A;  2ZT9 D;  2KSJ A;  1S72 P;  2XKM A;  2B87 B;  3RK3 C;  3CXH E;  5KLV E;  4O9B A;  4HM3 A;  1KQF B;  2OYH C;  1GL2 A;  2M3E A;  1G2C A;  3FWN A;  1BDC A;  1ZLL A;  1H89 A;  4I7Z C;  5H2F H;  2WSS H;  3O8Z A;  3W68 A;  3BAS A;  4BRY A;  2R5D A;  1GW3 A;  2FXO A;  1S2E A;  5AW6 B;  2UWJ E;  4PJ0 E;  1JTH A;  4QMA A;  3JCU H;  1IZN B;  3GHG B;  1VQ8 P;  2N9B A;  4YTP C;  1KYO I;  1Q7Y Q;  2XNX A;  1OW6 A;  2NPS D;  1YYC A;  2PGD A;  3SWK A;  5AW3 B;  5CBN A;  2E74 C;  4WY4 C;  3RGU A;  1EDI A;  2IZ1 A;  1T3J A;  2AEJ A;  3B5N C;  1MFT A;  3EFG A;  2JO6 A;  2M5A A;  3G4S P;  3RK2 D;  3V2P A;  3TDK A;  1VQ5 P;  3AE7 C;  3KQG A;  1DD4 A;  1RF1 A;  1IO4 A;  1N7L A;  3L36 A;  4H0L B;  1EZV I;  3MHV A;  1VQK P;  4KJM A;  1USE A;  2VRS A;  4HM7 A;  3GB4 A;  1GZL A;  5CCH D;  1PIX A;  3H32 B;  2IFN A;  2N1T C;  4JPZ B;  2H8P D;  1LWU B;  2XND H;  1SP4 A;  1HJ0 A;  1NH4 A;  2ZXX A;  3GL2 A;  3LW5 H;  1VF5 D;  2GBX A;  4UB8 H;  3B4S A;  1A02 J;  4I1L A;  2IBZ D;  4K3A A;  2YIU C;  5C39 A;  1L0N D;  2Z5I A;  3TGU D;  3CC7 P;  5AVR B;  5APU A;  1IFJ A;  2NUK A;  1L0L D;  3VMG D;  1SQX J;  2W90 A;  1KYO D;  3WUT A;  5EFW B;  1KOR A;  4HM8 A;  2NPS A;  1CW5 A;  3SWF A;  3L70 E;  3AZC A;  2JKV A;  2HFE D;  3WMM 0;  3BCC J;  1JO5 A;  1MFZ A;  2BCC E;  1YQ4 C;  2NZ2 A;  1O7M A;  2YNY A;  3L75 D;  2IYO A;  2ZXE B;  2KYV A;  3GCE A;  2IZ0 A;  1NGM B;  1SFC A;  4ZKU A;  4M3L A;  1ZR2 A;  2XRX A;  3U1A A;  1KD1 Q;  4TT3 H;  2QM7 A;  2V4H A;  1Q82 Q;  1FZC B;  3L74 E;  5TIS E;  2QG4 A;  2WPR A;  2NVF A;  3R2P A;  3VOP A;  3KYQ A;  1EZV D;  4PV1 D;  1LP1 A;  1Z56 A;  2HOD A;  5AW7 B;  3L75 E;  3TK1 A;  1L4A A;  5CCH A;  5K5G B;  4JF7 A;  4PD4 H;  2NVE A;  4LC1 A;  4W7Z A;  1OZH A;  3N7N A;  1UUV A;  3H6P A;  2QJP B;  1JMB A;  3N4X A;  1U57 A;  4PJ0 H;  4QDF B;  4H13 B;  3BCC G;  1S9K D;  1FJP A;  2YO2 A;  3VP9 A;  3SFD C;  4GIF A;  1SQP D;  3CX5 E;  1YI2 P;  1VQ6 P;  2WSE H;  2ZT9 C;  4A7P A;  2E4Q A;  3HUS A;  3JC2 2;  1J1E B;  2XSO A;  4GOD A;  4QUR A;  5AW2 B;  4I2L C;  3TGU G;  2O01 N;  2WVR A;  4HH2 A;  2H89 C;  1FC2 C;  1SQX K;  1SQP E;  4JBZ A;  1LNQ A;  2E76 B;  4UB6 E;  4NPF X;  3EQQ A;  3ITK A;  3C0D A;  5AVU B;  2NPS C;  1AA0 A;  3LIE A;  3FOU A;  1OXZ A;  3MIW A;  1NU1 D;  3M0A A;  4TLF A;  1PGJ A;  1YJ9 P;  2OQQ A;  1BDD A;  2KK7 A;  1JOC A;  1U7J A;  3HD7 B; 
#chains in the Genus database with same CATH homology
 2HMK A;  2BMQ A;  2HMN A;  1NU1 E;  4NBB D;  1NTK E;  1UUV A;  2YFJ A;  5BOK A;  3H1J E;  4NB9 D;  1VF5 D;  2GBX A;  2B1X A;  3GOB A;  1NDO A;  2QPZ A;  4H13 D;  2BMR A;  1SQV E;  4HM2 A;  4QCK A;  1RFS A;  1FQT A;  4QDF B;  1SQB E;  1O7W A;  2YIU C;  1JM1 A;  3VMI D;  3EN1 A;  3GL0 A;  3GZX A;  2YFL A;  2DE6 D;  4AIV A;  3L72 E;  4QDF A;  5KLI C;  1RIE A;  3H1L E;  4PD4 E;  2IBZ E;  3CX5 E;  2GBW A;  4NBF D;  3L73 E;  3H1H E;  5AEW A;  2CKF A;  2NUK A;  4HM1 A;  1L0N E;  4HM5 A;  4P1B H;  4EMJ B;  4HJL A;  3VMG D;  2FYU E;  3TGU E;  1O7G A;  4NB8 D;  1O7P A;  2E4Q A;  1O7H A;  2JZA A;  2NVG A;  2E4P A;  1Q90 C;  1EG9 A;  2Q3W A;  1UUW A;  4OGQ D;  1ULJ A;  2XSO A;  3VMH D;  4HM8 A;  4QUR A;  1L0L E;  4QDC A;  1KB9 E;  1NTM E;  3L70 E;  3AZC A;  1KYO E;  1ULI A;  1SQQ E;  2XSH A;  2QJK C;  2BCC E;  1NTZ E;  3L71 E;  1PPJ E;  1O7M A;  2DE5 D;  1G8J B;  1ZRT E;  2ZYL A;  2JO6 A;  3GZY A;  2QJP C;  2NWF A;  5CXM A;  3GCE A;  4NBE D;  4HKV A;  1PP9 E;  1SQX E;  2HMO A;  3H1I E;  2XRX A;  4QUP A;  2E76 D;  2HMM A;  4QUQ A;  1SQP E;  3H1K E;  5HL4 A;  3CWB E;  1NYK A;  3VCA A;  4D6T E;  2QJY C;  3N0Q A;  2DE7 D;  3GTE A;  3L74 E;  1BE3 E;  1VM9 A;  2D2C D;  2NUM A;  3BCC E;  2XR8 A;  3VCP A;  5KKZ C;  4HM7 A;  4U3F E;  3EQQ A;  3GB4 A;  2HML A;  2ZT9 D;  3C0D A;  2NVF A;  2FYN C;  1VCK A;  3DQY A;  3GTS A;  2YVJ B;  5AEU A;  3GKE A;  1WQL A;  4P1C H;  1BGY E;  2E74 D;  2E75 D;  3CXH E;  4AAY B;  1P84 E;  1O7N A;  2A06 E;  4PV1 D;  5KLV E;  2BMO A;  3D89 A;  3FOU A;  4HM3 A;  1SJG A;  4H0L D;  4HM0 A;  4NBH D;  4NBA D;  3L75 E;  4NBC D;  4NBD D;  1EZV E;  4NBG D;  1BCC E;  2I7F A;  4HM6 A;  4H44 D;  2HMJ A;  4HM4 A;  2B24 A;  3GL2 A;  2YFI A;  2NVE A;  1G8K B;  4QDD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...