1SQXE

Crystal structure analysis of bovine bc1 with stigmatellin a
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
total genus 45
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2004-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1sqxE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1sqxE02
4HM3A 4QDDA 3GOBA 5HL4A 3AZCA 2BMOA 1NDOA 3L71E 3EN1A 2QJKC 3C0DA 3GB4A 1O7MA 2XR8A 4NBCD 2Q3WA 4NBFD 3TGUE 3GTSA 1JM1A 1O7NA 2XSOA 5BOKA 4QDFB 2NUKA 2JZAA 2HMKA 1G8KB 4NBGD 1PP9E 1NTZE 3L75E 1ULIA 2HMNA 2I7FA 2ZYLA 4HM4A 4OGQD 3VMID 3CWBE 1WQLA 4H44D 4HJLA 3DQYA 2XSHA 2XRXA 5AEWA 2BCCE 3GKEA 4HM0A 4U3FE 2D2CD 2CKFA 1BGYE 2NVEA 1SQXE 3EQQA 2DE7D 4P1BH 2FYUE 3D89A 1PPJE 1VF5D 2FYNC 2QJYC 3H1IE 2NUMA 1G8JB 3VCAA 5KLVE 1FQTA 5CXMA 2HMMA 3BCCE 1SJGA 4QUPA 1NYKA 4NBAD 4HM1A 3CX5E 1O7GA 2B1XA 4HM5A 2NWFA 3H1JE 2E76D 2E75D 3CXHE 4NB8D 3FOUA 3H1LE 2DE6D 2ZT9D 4NBHD 1EZVE 2JO6A 3GZYA 2B24A 2HMJA 1O7PA 2HMOA 1O7WA 5KLIC 4AIVA 1VM9A 2QPZA 4QUQA 4HM7A 2E4PA 4QDCA 4NBED 3GL2A 3GTEA 1NTME 3GZXA 2A06E 4H13D 1P84E 2YFLA 2YFIA 1UUWA 1BCCE 3GCEA 2E74D 4EMJB 1RIEA 1EG9A 3H1HE 3L73E 4PV1D 1ZRTE 4D6TE 2YVJB 4QDFA 2NVFA 1L0LE 1SQQE 1RFSA 1SQBE 1VCKA 5AEUA 2YIUC 4PD4E 4HM2A 1O7HA 1KB9E 4NBBD 4HKVA 4HM8A 3VMGD 3VCPA 2NVGA 1UUVA 4AAYB 2QJPC 1KYOE 2BMQA 1NU1E 2DE5D 2YFJA 3GL0A 2E4QA 1SQVE 2GBXA 1NTKE 3VMHD 3H1KE 2BMRA 3L72E 4NBDD 4QURA 2GBWA 3N0QA 4HM6A 4QCKA 3L70E 1BE3E 2HMLA 1SQPE 3L74E 1Q90C 4H0LD 1L0NE 5KKZC 4P1CH 4NB9D 2IBZE 1ULJA
chains in the Genus database with same CATH superfamily
5AVRB 3AZCA 2ITAA 2I1JA 3IAOA 2HODA 1OX3A 1PP9G 3O6QA 3OJAB 1WRGA 3C8VA 3VMXA 2I8DA 4ASVA 2V7QJ 3GMAA 2DW3A 3OW2O 1BE3G 1JM1A 2JZAA 4OGQD 1KB9D 4R4MA 1NVOA 3A0HE 1SFCD 3D6YA 3AE4C 2DE7D 3A7OA 2G8YA 2WQYC 2MJZA 5TISE 3RBZA 2M0BA 1BSHA 1YQ3C 5KLVE 4QUPA 1VL2A 1LTJB 3PHLA 1S9KE 1GK4A 3MZWB 2AXCA 4BXLA 1GU5A 1VQKP 2HMOA 3CCMP 1SVFA 2QPZA 3RL0D 3B8EB 1GU4A 2E76B 4QDCA 2N1TC 1CW5A 1VQLP 1NTME 2WSCH 3L74G 1DX7A 4RKUJ 3Q5PA 3H1IJ 1NTMJ 1URQB 1ZRTE 1M56D 1RE3C 3TGUD 1HF9A 1OVVA 1JB0J 1SQVK 3B5NA 2Y9ZA 1KYOE 1VQ8P 3IFMA 1DEEG 2BMRA 1JY2N 4Y28J 1LP1B 1KYOD 2NPSD 3B5ND 1L2PA 2FXMA 3T97A 4C46A 1RH5B 2JDIH 4JPZB 4CPGA 3CCVP 3R2PA 3L71E 2XZRA 4H0LB 3WUTA 5B66H 4NPFX 4WWIA 2HMKA 1KMIZ 1LP1A 2ZYLA 3CWBE 1NU1G 5CCGA 1QL1A 5GTHE 2XSHA 3JCUE 1PP9J 2E76C 2CKFA 2QSIA 1NU1K 3KZIH 3L72G 1H0TB 2QE7H 1BGYD 1JY2P 2WPVB 3KZIE 2IBZG 1G1IA 3D71A 2B1XA 1GD2E 2J58A 4HKZH 1SQBK 4NB8D 1S4XA 1PGJA 2OYIA 1GW4A 3CPWO 3AE8C 1SQPK 3L71G 5B66E 3KQGA 3B5NC 2N9BA 2M5AB 2HR3A 1JCCA 3GL2A 3L4FA 2E5YA 2VRSA 1YTZT 2PP6A 2AXTH 3H1HE 3L73E 4U3FG 2V7QH 4I7ZB 2P1JA 2JWDA 3QWOC 4U3FD 3CCEP 3P8CE 3AEBC 2YFJA 1A02J 1BCCJ 1L0ND 2HMLA 2YO3A 1VF5C 2Q5UA 1X9VA 1A02F 2QJKC 4N78E 4U3FJ 4QDFB 2IBZD 2YIUB 1ULIA 1KB9H 3CWBG 2W6AA 4H44D 1JMBA 4U3FE 1R8EA 3FX0A 2IYOA 1LT1A 1KQGB 2JP3A 1VQNP 2E74B 1PPJE 3HTKA 2FYNC 1GK6A 1IFPA 1JO5A 2CK3H 3TK1A 1YJNP 2YKPA 1SQXK 3B5NB 2W6JH 1PZQA 3FWLA 2I1KA 1JOCA 1JY3N 2O01J 1FJPA 2Q3IA 4GOFA 3JCUH 3RBXA 3WU2H 5CMZA 4QUQA 1JTHB 3S4RA 1IFNA 2A06E 1OXZA 3GF7A 1GL2C 2YIUC 3HD7B 4HJGH 5AVSB 1O7HA 1L4AD 2JR8A 3VCPA 2ZYAA 2A45H 2OTJP 1OVRA 3S1KA 1ZN5A 3II6A 3M0DA 1IFDA 3KHUA 4HM6A 1KYOH 3CC4P 1SLQA 1IC2A 1NU1J 2ZFCA 1SQBG 4WY4D 4PD4I 1Q90C 3PRJA 4NB9D 4KT0J 3A2AA 2H43A 2BMOA 3G71P 4N6JA 3SSUA 2M3EA 2ZYGA 4XE5B 1PP9E 1NTZE 1OW8A 4JBZA 5CBNA 2HPCB 1KQLA 4XFJA 1J1EB 3CXHH 1PP9D 2NVEA 3AEAC 2BEQD 1IFJA 4C7RA 3CMAP 2LXCB 4PJ0H 3KDPB 3CMEP 5KAIH 4HM1A 2KSJA 2Y0EA 3H1JE 4BRYB 2M3BA 1OFCX 1AVYA 2KI7B 1S3JA 1O7PA 5AW2B 1S1CX 1N86A 4RO0A 1SQXD 5CBOA 1P84I 3H1HJ 3L73J 3G6EP 1FC2C 1AVOA 1P84E 3F5HA 5KLVJ 1UUWA 3GCEA 3H1ID 3VP8A 2K9JA 1T2KC 1KILD 1SQPD 1UUVA 2QJPC 2PGDA 2B89A 2PRRA 5AVWB 4YXDC 2NZ2A 2IFMA 4NBDD 3H1KJ 3L71D 1LGHB 1KILA 3TGUG 2O1KA 1PPJD 4OGQC 1FE6A 2KS1A 1RY3A 5APTA 3BRVB 1PIXA 5KJ7A 3GB4A 1PL5A 1YITP 1J1DC 4HM4A 1L0NK 3AEEC 3CWBJ 1OW6A 3V2NA 2QG4A 3HE5B 5KAFE 2IPPA 3FXDA 3CCUP 3BASA 1FBMA 2IX7C 1SQXG 3IF4A 2BCCJ 3TNUA 5AVZB 1GW3A 2POHA 3PJSK 1LWUA 3GF3A 1RF0C 3BCCJ 1VQ6P 3WMM0 2O01H 2Q9IA 5B5EH 4HM5A 1ZR4A 2YKQA 1M1JA 3BCCD 2FBWC 1RF1C 1N73C 1KQSO 1X0TA 3L35A 4UB8E 3CX5I 2FXOA 3L74J 3NFQA 1D7MA 1N73B 3L70G 1ZXGA 1GL2D 3W67A 1LT9A 4ZKPA 1RFSA 1SQBE 2C0WA 5AVTB 5CCGC 2WSCJ 4NBBD 3MP7B 3L74D 1N8RQ 3HUSA 1GL2A 1NU1E 1FZAA 1NOHA 4BWNA 4WY4B 1BE3E 3O8ZA 2E75B 1PGQA 2JJLA 3GW6A 1FZCB 2HG5D 4QDDA 2YNYA 3VTPC 2WPSA 2NPSA 1L0NG 4NBCD 2XNDH 2KYVA 2NUKA 2MKVA 3RK2C 1K73Q 3I55P 4H13C 3RK3C 1UIXA 1ZV8A 2K9JB 2FFDA 2QJPB 1MZ9A 2RN0A 3LW5H 4H13B 3RK3B 3A3YB 2XNXA 3VCAA 1GMJA 1USDA 4NBAD 3SWKA 2FXPA 1JY2O 1HTLC 2KS1B 3AE6C 2JO1A 4WB4A 3M9QA 2ZT9D 1FDMA 4UB6E 1YHQP 3PTZA 1O7WA 1P84D 1JNMA 2QIWA 4GDOA 2RKLA 4H13D 3RK3D 1FOSF 1FAVA 1WT6A 3H1LG 3V2PA 1HH0A 2AEFA 4PV1D 5BU5A 2R32A 5BVZA 1S2EA 2OYOA 4GOEA 1U7JA 3LIDA 4HKVA 1QVGO 2OTKE 2B87B 1PV3A 2FYUK 2BASA 3GL0A 1ZRTD 4EDFA 1OWAA 2GBXA 4QURA 3P7KA 3U1AA 1H0TA 4GT1A 3VN0A 1FZGA 1NU1D 3RL0g 2Y0CA 1U57A 5APVA 3LW5J 3HD7D 1RHZB 5AVYB 1S5LX 5CCGD 1RE4C 1Y9BA 1FDIA 1J1EC 2I7FA 2E74C 2LXBA 2IZ0A 1SFCB 1N73A 4WVZA 5AVXB 2XRXA 3VMZA 1XTGB 2KIKA 3Q2YA 4P1BH 2V4HA 2FYUE 4TLFA 4IOIH 1VQ7P 4KJMA 4WY4C 3HE4A 3E7KA 1Q7YQ 2OQQA 1IZNB 2CPBA 3L70J 2E75D 3FOUA 4H44C 2B88A 4IL6E 3BVHA 2IBZI 2K1AA 1Q2NA 1X8YA 1FZCC 4QMAA 2ZT9C 3HRNA 3V4WA 1KD1Q 1RQVA 3CLQA 1HGVA 2WWWA 1NTZG 2P7JA 4EI2A 2YFLA 4IFDK 1UIIA 1NAFA 1KILC 2OARA 2YVJB 1SQQE 2FYUG 3I5CA 2Z4EA 3BCCG 4HM8A 1S9KD 1N2DC 3G4SP 1AJYA 1YTZI 1J2JB 3S9OA 3H1LJ 3TF5A 3ITKA 2B9BA 4N3YB 1HJBA 1NAYA 3RK2D 1N7SA 1OW7A 5AW6B 1NTMG 1JY3P 3P32A 1NKZB 2N1TA 1SQQG 1NDOA 2L91A 2JWAA 2OYHC 1OMIA 1PPJG 3D70A 1DH3A 2AXTE 1W2BO 5AVVB 2ZVOB 4UB6H 2WZ7A 3H6PA 4HJLA 2E43A 5KJ7D 3V2RA 1SQXE 3L37A 4IFMA 3SFEC 2J5UA 2B87A 4DJGA 1VF5D 3N4XA 1QEXA 1SQXJ 1KV4A 2ZJSE 1M57D 1YI2P 1G2CA 2P58A 3CX5E 5M1BA 3L72J 3GHGA 2E76D 3FWNA 1E79H 3AE3C 1FS0E 5AVUB 3P8MC 3L75D 5E79E 1VM9A 2D2CB 1URQC 4I2LC 4D6TJ 4EYYQ 1EQ7A 1YIJP 4EIJA 1T8ZA 1G1JA 1L4AA 1DD4A 1JM0A 3M0DC 4EMJB 1KILE 1CZQA 3CD6P 1M1KQ 2WSEH 2NVFA 3GLMA 5AEUA 1QX8A 1QL2A 1KB9E 1E5WA 1QVFO 1RF1A 2WPQA 3RL0B 4HH2A 2XU6A 3AE2C 3E1IA 3A0BH 2E42A 1BGYG 1RQUA 2IYPA 5AW0B 4H0LD 1L0NE 2ZAEB 2Q3EA 2KZIA 1S5LE 1Q81Q 3GOBA 5APUA 4PJ0E 2YKOA 4PV1B 2FFDB 3U59A 3SFDC 4UB8H 1KB9I 3H32A 1EZVD 4OVNF 1NTKJ 2M8RA 2W90A 3H1JG 2A45I 3CL3D 3G9RA 3W68A 4AYCA 2Y0DA 1SFCA 3H1JD 2WMMA 2NPSC 1FQTA 4XA4A 1Y8AA 5AVQB 1SJGA 2KB7P 1NYKA 1O7GA 2KZJA 1K04A 1HVVA 5TISH 4K35A 4L75A 2H89C 2O01N 1SQPG 3OAKA 3CXHI 4W7YA 2WT7A 1SQQD 3A0HH 3AEDC 1BCCE 2OYHB 4DOJA 3RL0C 4H0LC 2R5BA 3ABVC 3V5BA 2XV5A 3B4SA 5TJHA 3VMGD 1HJ0A 2CPSA 4YPCA 2GM4A 1VQ5P 3L36A 1PGOA 2OTLP 1NTKE 1KYOI 1H88A 1JCDA 4QCKA 2ZVNB 1EDJA 3VMYA 2Z5HA 3BRTB 2N9YB 2K9YA 5APWA 1GDTA 3M9HA 3EQQA 3CX5D 1HGZA 1R5LA 1NTMK 1L0NJ 1JY3O 3EN1A 3EFFK 1Q82Q 1KILB 1AV1A 1SFCC 1BGYJ 3TGUE 3GTSA 1GTWA 1LTAC 1Q90D 2XDJA 3V6IA 1AA0A 3L75E 3HD7A 1NYHA 1L0LK 1L4AB 5AEWA 2QM8A 2D2CD 3Q5RA 5AW1B 4YTPC 2JKVA 1L4AC 1ZOYC 2QJYC 3Q1MA 5DJUB 1NWQA 4NPEA 1OVUA 4I7ZC 2JEEA 2FY8A 2KSEA 4D6TG 5CCHA 2O3JA 3L72D 2FFDC 1JMMA 1IK9A 5AW4B 2Q7CA 2HMJA 1Z56A 2XKMA 4C7NB 2P10A 2Q1KA 2A45G 5APYA 3GTEA 1ZW0A 2H88C 1DD3A 3AE5C 2YFIA 1CI6B 1LTIC 3CCJP 2R3CA 1OIPA 4D6TE 2N1TB 5EFWB 1N7SB 4JQ0D 4JF7A 1SQBJ 3JC22 2WTYA 1HBWA 2BMQA 5E79H 2C9NY 3F89A 3L72E 2WITA 3OA7A 2QJYB 5APXA 3L74E 1QGKB 2K3RA 4B86A 1JEKA 4MN4C 1LTTC 3CX5H 2BEZF 2WSFJ 2QRXA 5KLVG 1NGMB 3D6ZA 4WY4A 1O7MA 3H1JJ 4NBFD 1O7NA 3IR9A 1G8KB 3GG2A 3EWKA 2KOGA 2W27A 1SS1A 3A5TA 2BCCE 1NTMD 2A06D 2LR2A 3AE9C 2QA4P 4HYTB 3WUUA 1AFOA 1LJ2A 1BCCG 1FDOA 2H7HA 1NJIQ 3D89A 2OYHA 2NUMA 1EDIA 3CCSP 1BDCA 4DZOA 4DT0A 1IO4A 3KXDA 3M0AA 1KC8Q 1KZUB 2YXQB 5APSA 1MKMA 1CSBA 2KK7A 4LGDE 4K3AA 4EOTA 2Z5IA 3BATA 2HYNA 1VF5B 4HM7A 5KAFH 3CXHD 2SPZA 1LT9C 4GKGA 1W2EA 3P8CD 1EG9A 1VQPP 2FYUJ 1LWUB 5KTBA 1NTKD 3CC7P 4OH8B 1JTHA 4W80A 4TT3H 2IZ1A 2E4QA 3H32B 1SQVE 3L75J 2Y9YA 4HB1A 3H1KG 4IL6H 3N0QA 3L70E 3Q5SA 4H44B 1FZBA 1SQQK 2QEXP 1IFIA 3CCRP 3ZDMA 2KLUA 2ZT9B 3L70D 1KFNA 2RMZA 3CCLP 2ZXXA 1L0LJ 3M9BA 1XTCC 1M90Q 3USSA 5BOKA 1M7LA 1P84H 3HUSB 1BGYE 1TU3F 3CWBD 4ZMDA 1KFMA 4GIFA 3EQ2A 5KJ7C 1G8JB 5KLVK 4L73A 2HMMA 5K5GB 2WSFH 1KQFB 2H8PD 2NPSB 2D2CC 2KP8A 2C9LY 3CC2P 3KPEA 3PP5A 3VYIA 1YYCA 2KUBA 3HE4B 3N7NA 2E4PA 2OYIB 4N78D 1FZEA 1T6AA 2WVRA 1T3UA 3NMDA 4BRYA 4RESB 1IK7A 4IFFA 2WSEJ 3KYQA 3U1CA 1VQ4P 2KNCB 3HTKB 1ZR2A 3MHVA 2A06G 4U7JA 1W5CE 2L5GB 1K8AQ 1VDFA 4LC1A 3IN6A 1DEBA 1SQVD 1EXJA 1G2CB 3H25A 2WT7B 3RK2B 3MIWA 1MV8A 1KORA 3AEFC 2Q3WA 1NTKG 3DQYA 2E5TA 3PLNA 1U7MA 3FGAD 5GTIH 3GKEA 4DCKA 3B71A 4WBAA 1Y47A 2OYIC 4R4LA 1T3JA 4Y99B 3T97B 1K05A 4GODA 5CXMA 3WUVA 2E75C 5C39A 1NO4A 2GUSA 2M5AA 1PGPA 5GTIE 1R5SA 3TDKA 2PAJA 2NWFA 1M8OB 3SWYA 1ZMEC 2DE6D 2UWJE 5CJ4A 2QM7A 1EZVE 3JSVC 2O1JA 2G3AA 2PFXA 2RH0A 5CCHD 4NBED 4LLHA 3GZXA 2IDBA 2GUVA 3L75G 1L0LG 5CCHC 2YMYA 2E74D 1L0LE 1VCKA 1ZLLA 5CJ0A 4Z1MH 4I6MC 2J59M 3E1RA 1BE3D 4JYCA 1YJ9P 1YJWP 1NTZJ 1IFMA 3AECC 1FZFA 4W7ZA 1RE4A 2FYNB 3SWFA 3V2QA 5KKZC 2W8ZA 3CCQP 1LT9B 2IBZE 3K5BA 4HM3A 3PH0A 1CI6A 1NTKK 1MUUA 3C0DA 1URQD 2XR8A 2WPRA 2XSOA 4JYBA 4NBGD 2C0XA 3VMID 1EC5A 1QLED 1KN7A 3NXSA 3MGNA 2W83C 2R3SA 1NKNA 1K9MQ 3EFGA 1M1JC 1SQQJ 1ZP0C 2GA1A 3MUDC 2FYZA 4KHXA 3VP9A 1FJKA 4NPDA 4PD4D 3MTUE 2Q6QA 1AQTA 5DJTB 3H1LE 2BCCG 3R4YA 1H89A 4IL6X 3H1KD 3L71J 4NBHD 1BCCD 2B24A 1NTZD 4AIVA 5AW7B 1LTBC 1N7SC 2K88A 1LTJA 2FKWB 5GTHH 1RF1B 1YQ4C 4AQRD 1EZVI 1Q86Q 1AQ5A 4Y99C 4PD4E 2QVAA 3AE7C 4OGQB 3GHGB 1VQOP 3I56P 3VMHD 3TNUB 1IJDB 1FU1A 1VQ9P 1BSNA 4O9BA 1VQMP 1URQA 1YBKA 1LTSC 1RE3A 4L76A 5KAIE 1LTGC 2KXPB 3H1IG 1NH4A 1S72P 1M1JB 3HUSC 2HMNA 1WQLA 4HM0A 3H1HG 3L73G 3TSIA 5AW5B 3MD0A 4AUWA 1GL2B 5AW9B 1KTMA 2YO2A 4ASWA 1L0LD 3HE5A 5L8RJ 3O6QB 1FZCA 5APQA 4RJTA 2W6BA 3AEGC 1S5LH 2HODB 5AW8B 3GZYA 2HPCA 1LNQA 5KKZB 2BCCD 1EDLA 1H8AA 1SQPJ 2KLVA 3NTNA 2R44A 2KNCA 2FYUD 3TGUJ 3GHGC 1OZHA 1NTZK 4QDFA 1J1DB 5KLVD 4HM2A 4M3LA 5AW3B 2NVGA 4AAYB 1HUCA 3LIEA 1X22A 4ZNCA 2HFED 2IFNA 2N1TD 2AEJA 3UIAA 3M06A 3G3ZA 3VOPA 3C1LA 5KLIB 4PV1C 1SQPE 3V4QA 1NHLA 4ZKUA 1BDDA 1EXIA 3CI9A 1WMKA 5HL4A 3WU2E 1EZVG 1N7SD 5BU8B 1T2KD 2ZXEB 3H1LD 1BE3J 1FOSE 1DIPA 1SQBD 2QJKB 4OWFA 1USEA 1RF0A 3QH9A 1LWUC 3RGUA 2P2UA 4A7PA 2P67A 3TYYA 1SQVG 3RK3E 2NRGA 3H1HD 3L73D 5B5EE 3H1IE 5H2FE 1PFIA 2LKMA 3BCCE 2R5DA 4L74A 4C7NA 1SP4A 2AEMA 1X79B 3CXHE 1N7LA 1GZLA 5H2FH 5CHXA 4YXWH 3MUDA 2JO6A 3AE1C 5KLIC 3Q3DA 1MFTA 2OGUA 2K37A 1VPCA 3A0BE 2WSSH 1RIEA 1EDKA 2YMKA 2ZYDA 1LTJC 4I1LA 4D6TD 2DE5D 3HD7C 3H1KE 3FXEA 2YXRB 1JUNA 2GBWA 1SQVJ 1HWTC 3M91A 1MFZA 3C9IA 4P1CH 4PD4H 3VMAA 2HLOA 1ULJA
chains in the Genus database with same CATH topology
4HM3A 4QDDA 3GOBA 5HL4A 3AZCA 2BMOA 1NDOA 3L71E 3EN1A 2QJKC 3C0DA 3GB4A 1O7MA 2XR8A 4NBCD 2Q3WA 4NBFD 3TGUE 3GTSA 1JM1A 1O7NA 2XSOA 5BOKA 4QDFB 2NUKA 2JZAA 2HMKA 1G8KB 4NBGD 1PP9E 1NTZE 3L75E 1ULIA 2HMNA 2I7FA 2ZYLA 4HM4A 4OGQD 3VMID 3CWBE 1WQLA 4H44D 4HJLA 3DQYA 2XSHA 2XRXA 5AEWA 2BCCE 3GKEA 4HM0A 4U3FE 2D2CD 2CKFA 1BGYE 2NVEA 1SQXE 3EQQA 2DE7D 4P1BH 2FYUE 3D89A 1PPJE 1VF5D 2FYNC 2QJYC 3H1IE 2NUMA 1G8JB 3VCAA 5KLVE 1FQTA 5CXMA 2HMMA 3BCCE 1SJGA 4QUPA 1NYKA 4NBAD 4HM1A 3CX5E 1O7GA 2B1XA 4HM5A 2NWFA 3H1JE 2E76D 2E75D 3CXHE 4NB8D 3FOUA 3H1LE 2DE6D 2ZT9D 4NBHD 1EZVE 2JO6A 3GZYA 2B24A 2HMJA 1O7PA 2HMOA 1O7WA 5KLIC 4AIVA 1VM9A 2QPZA 4QUQA 4HM7A 2E4PA 4QDCA 4NBED 3GL2A 3GTEA 1NTME 3GZXA 2A06E 4H13D 1P84E 2YFLA 2YFIA 1UUWA 1BCCE 3GCEA 2E74D 4EMJB 1RIEA 1EG9A 3H1HE 3L73E 4PV1D 1ZRTE 4D6TE 2YVJB 4QDFA 2NVFA 1L0LE 1SQQE 1RFSA 1SQBE 1VCKA 5AEUA 2YIUC 4PD4E 4HM2A 1O7HA 1KB9E 4NBBD 4HKVA 4HM8A 3VMGD 3VCPA 2NVGA 1UUVA 4AAYB 2QJPC 1KYOE 2BMQA 1NU1E 2DE5D 2YFJA 3GL0A 2E4QA 1SQVE 2GBXA 1NTKE 3VMHD 3H1KE 2BMRA 3L72E 4NBDD 4QURA 2GBWA 3N0QA 4HM6A 4QCKA 3L70E 1BE3E 2HMLA 1SQPE 3L74E 1Q90C 4H0LD 1L0NE 5KKZC 4P1CH 4NB9D 2IBZE 1ULJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HM3 A;  4QDD A;  3GOB A;  5HL4 A;  3AZC A;  2BMO A;  1NDO A;  3L71 E;  3EN1 A;  2QJK C;  3C0D A;  3GB4 A;  1O7M A;  2XR8 A;  4NBC D;  2Q3W A;  4NBF D;  3TGU E;  3GTS A;  1JM1 A;  1O7N A;  2XSO A;  5BOK A;  4QDF B;  2NUK A;  2JZA A;  2HMK A;  1G8K B;  4NBG D;  1PP9 E;  1NTZ E;  3L75 E;  1ULI A;  2HMN A;  2I7F A;  2ZYL A;  4HM4 A;  4OGQ D;  3VMI D;  3CWB E;  1WQL A;  4H44 D;  4HJL A;  3DQY A;  2XSH A;  2XRX A;  5AEW A;  2BCC E;  3GKE A;  4HM0 A;  4U3F E;  2D2C D;  2CKF A;  1BGY E;  2NVE A;  1SQX E;  3EQQ A;  2DE7 D;  4P1B H;  2FYU E;  3D89 A;  1PPJ E;  1VF5 D;  2FYN C;  2QJY C;  3H1I E;  2NUM A;  1G8J B;  3VCA A;  5KLV E;  1FQT A;  5CXM A;  2HMM A;  3BCC E;  1SJG A;  4QUP A;  1NYK A;  4NBA D;  4HM1 A;  3CX5 E;  1O7G A;  2B1X A;  4HM5 A;  2NWF A;  3H1J E;  2E76 D;  2E75 D;  3CXH E;  4NB8 D;  3FOU A;  3H1L E;  2DE6 D;  2ZT9 D;  4NBH D;  1EZV E;  2JO6 A;  3GZY A;  2B24 A;  2HMJ A;  1O7P A;  2HMO A;  1O7W A;  5KLI C;  4AIV A;  1VM9 A;  2QPZ A;  4QUQ A;  4HM7 A;  2E4P A;  4QDC A;  4NBE D;  3GL2 A;  3GTE A;  1NTM E;  3GZX A;  2A06 E;  4H13 D;  1P84 E;  2YFL A;  2YFI A;  1UUW A;  1BCC E;  3GCE A;  2E74 D;  4EMJ B;  1RIE A;  1EG9 A;  3H1H E;  3L73 E;  4PV1 D;  1ZRT E;  4D6T E;  2YVJ B;  4QDF A;  2NVF A;  1L0L E;  1SQQ E;  1RFS A;  1SQB E;  1VCK A;  5AEU A;  2YIU C;  4PD4 E;  4HM2 A;  1O7H A;  1KB9 E;  4NBB D;  4HKV A;  4HM8 A;  3VMG D;  3VCP A;  2NVG A;  1UUV A;  4AAY B;  2QJP C;  1KYO E;  2BMQ A;  1NU1 E;  2DE5 D;  2YFJ A;  3GL0 A;  2E4Q A;  1SQV E;  2GBX A;  1NTK E;  3VMH D;  3H1K E;  2BMR A;  3L72 E;  4NBD D;  4QUR A;  2GBW A;  3N0Q A;  4HM6 A;  4QCK A;  3L70 E;  1BE3 E;  2HML A;  1SQP E;  3L74 E;  1Q90 C;  4H0L D;  1L0N E;  5KKZ C;  4P1C H;  4NB9 D;  2IBZ E;  1ULJ A; 
#chains in the Genus database with same CATH topology
 5AVR B;  3AZC A;  2ITA A;  2I1J A;  3IAO A;  2HOD A;  1OX3 A;  1PP9 G;  3O6Q A;  3OJA B;  1WRG A;  3C8V A;  3VMX A;  2I8D A;  4ASV A;  2V7Q J;  3GMA A;  2DW3 A;  3OW2 O;  1BE3 G;  1JM1 A;  2JZA A;  4OGQ D;  1KB9 D;  4R4M A;  1NVO A;  3A0H E;  1SFC D;  3D6Y A;  3AE4 C;  2DE7 D;  3A7O A;  2G8Y A;  2WQY C;  2MJZ A;  5TIS E;  3RBZ A;  2M0B A;  1BSH A;  1YQ3 C;  5KLV E;  4QUP A;  1VL2 A;  1LTJ B;  3PHL A;  1S9K E;  1GK4 A;  3MZW B;  2AXC A;  4BXL A;  1GU5 A;  1VQK P;  2HMO A;  3CCM P;  1SVF A;  2QPZ A;  3RL0 D;  3B8E B;  1GU4 A;  2E76 B;  4QDC A;  2N1T C;  1CW5 A;  1VQL P;  1NTM E;  2WSC H;  3L74 G;  1DX7 A;  4RKU J;  3Q5P A;  3H1I J;  1NTM J;  1URQ B;  1ZRT E;  1M56 D;  1RE3 C;  3TGU D;  1HF9 A;  1OVV A;  1JB0 J;  1SQV K;  3B5N A;  2Y9Z A;  1KYO E;  1VQ8 P;  3IFM A;  1DEE G;  2BMR A;  1JY2 N;  4Y28 J;  1LP1 B;  1KYO D;  2NPS D;  3B5N D;  1L2P A;  2FXM A;  3T97 A;  4C46 A;  1RH5 B;  2JDI H;  4JPZ B;  4CPG A;  3CCV P;  3R2P A;  3L71 E;  2XZR A;  4H0L B;  3WUT A;  5B66 H;  4NPF X;  4WWI A;  2HMK A;  1KMI Z;  1LP1 A;  2ZYL A;  3CWB E;  1NU1 G;  5CCG A;  1QL1 A;  5GTH E;  2XSH A;  3JCU E;  1PP9 J;  2E76 C;  2CKF A;  2QSI A;  1NU1 K;  3KZI H;  3L72 G;  1H0T B;  2QE7 H;  1BGY D;  1JY2 P;  2WPV B;  3KZI E;  2IBZ G;  1G1I A;  3D71 A;  2B1X A;  1GD2 E;  2J58 A;  4HKZ H;  1SQB K;  4NB8 D;  1S4X A;  1PGJ A;  2OYI A;  1GW4 A;  3CPW O;  3AE8 C;  1SQP K;  3L71 G;  5B66 E;  3KQG A;  3B5N C;  2N9B A;  2M5A B;  2HR3 A;  1JCC A;  3GL2 A;  3L4F A;  2E5Y A;  2VRS A;  1YTZ T;  2PP6 A;  2AXT H;  3H1H E;  3L73 E;  4U3F G;  2V7Q H;  4I7Z B;  2P1J A;  2JWD A;  3QWO C;  4U3F D;  3CCE P;  3P8C E;  3AEB C;  2YFJ A;  1A02 J;  1BCC J;  1L0N D;  2HML A;  2YO3 A;  1VF5 C;  2Q5U A;  1X9V A;  1A02 F;  2QJK C;  4N78 E;  4U3F J;  4QDF B;  2IBZ D;  2YIU B;  1ULI A;  1KB9 H;  3CWB G;  2W6A A;  4H44 D;  1JMB A;  4U3F E;  1R8E A;  3FX0 A;  2IYO A;  1LT1 A;  1KQG B;  2JP3 A;  1VQN P;  2E74 B;  1PPJ E;  3HTK A;  2FYN C;  1GK6 A;  1IFP A;  1JO5 A;  2CK3 H;  3TK1 A;  1YJN P;  2YKP A;  1SQX K;  3B5N B;  2W6J H;  1PZQ A;  3FWL A;  2I1K A;  1JOC A;  1JY3 N;  2O01 J;  1FJP A;  2Q3I A;  4GOF A;  3JCU H;  3RBX A;  3WU2 H;  5CMZ A;  4QUQ A;  1JTH B;  3S4R A;  1IFN A;  2A06 E;  1OXZ A;  3GF7 A;  1GL2 C;  2YIU C;  3HD7 B;  4HJG H;  5AVS B;  1O7H A;  1L4A D;  2JR8 A;  3VCP A;  2ZYA A;  2A45 H;  2OTJ P;  1OVR A;  3S1K A;  1ZN5 A;  3II6 A;  3M0D A;  1IFD A;  3KHU A;  4HM6 A;  1KYO H;  3CC4 P;  1SLQ A;  1IC2 A;  1NU1 J;  2ZFC A;  1SQB G;  4WY4 D;  4PD4 I;  1Q90 C;  3PRJ A;  4NB9 D;  4KT0 J;  3A2A A;  2H43 A;  2BMO A;  3G71 P;  4N6J A;  3SSU A;  2M3E A;  2ZYG A;  4XE5 B;  1PP9 E;  1NTZ E;  1OW8 A;  4JBZ A;  5CBN A;  2HPC B;  1KQL A;  4XFJ A;  1J1E B;  3CXH H;  1PP9 D;  2NVE A;  3AEA C;  2BEQ D;  1IFJ A;  4C7R A;  3CMA P;  2LXC B;  4PJ0 H;  3KDP B;  3CME P;  5KAI H;  4HM1 A;  2KSJ A;  2Y0E A;  3H1J E;  4BRY B;  2M3B A;  1OFC X;  1AVY A;  2KI7 B;  1S3J A;  1O7P A;  5AW2 B;  1S1C X;  1N86 A;  4RO0 A;  1SQX D;  5CBO A;  1P84 I;  3H1H J;  3L73 J;  3G6E P;  1FC2 C;  1AVO A;  1P84 E;  3F5H A;  5KLV J;  1UUW A;  3GCE A;  3H1I D;  3VP8 A;  2K9J A;  1T2K C;  1KIL D;  1SQP D;  1UUV A;  2QJP C;  2PGD A;  2B89 A;  2PRR A;  5AVW B;  4YXD C;  2NZ2 A;  2IFM A;  4NBD D;  3H1K J;  3L71 D;  1LGH B;  1KIL A;  3TGU G;  2O1K A;  1PPJ D;  4OGQ C;  1FE6 A;  2KS1 A;  1RY3 A;  5APT A;  3BRV B;  1PIX A;  5KJ7 A;  3GB4 A;  1PL5 A;  1YIT P;  1J1D C;  4HM4 A;  1L0N K;  3AEE C;  3CWB J;  1OW6 A;  3V2N A;  2QG4 A;  3HE5 B;  5KAF E;  2IPP A;  3FXD A;  3CCU P;  3BAS A;  1FBM A;  2IX7 C;  1SQX G;  3IF4 A;  2BCC J;  3TNU A;  5AVZ B;  1GW3 A;  2POH A;  3PJS K;  1LWU A;  3GF3 A;  1RF0 C;  3BCC J;  1VQ6 P;  3WMM 0;  2O01 H;  2Q9I A;  5B5E H;  4HM5 A;  1ZR4 A;  2YKQ A;  1M1J A;  3BCC D;  2FBW C;  1RF1 C;  1N73 C;  1KQS O;  1X0T A;  3L35 A;  4UB8 E;  3CX5 I;  2FXO A;  3L74 J;  3NFQ A;  1D7M A;  1N73 B;  3L70 G;  1ZXG A;  1GL2 D;  3W67 A;  1LT9 A;  4ZKP A;  1RFS A;  1SQB E;  2C0W A;  5AVT B;  5CCG C;  2WSC J;  4NBB D;  3MP7 B;  3L74 D;  1N8R Q;  3HUS A;  1GL2 A;  1NU1 E;  1FZA A;  1NOH A;  4BWN A;  4WY4 B;  1BE3 E;  3O8Z A;  2E75 B;  1PGQ A;  2JJL A;  3GW6 A;  1FZC B;  2HG5 D;  4QDD A;  2YNY A;  3VTP C;  2WPS A;  2NPS A;  1L0N G;  4NBC D;  2XND H;  2KYV A;  2NUK A;  2MKV A;  3RK2 C;  1K73 Q;  3I55 P;  4H13 C;  3RK3 C;  1UIX A;  1ZV8 A;  2K9J B;  2FFD A;  2QJP B;  1MZ9 A;  2RN0 A;  3LW5 H;  4H13 B;  3RK3 B;  3A3Y B;  2XNX A;  3VCA A;  1GMJ A;  1USD A;  4NBA D;  3SWK A;  2FXP A;  1JY2 O;  1HTL C;  2KS1 B;  3AE6 C;  2JO1 A;  4WB4 A;  3M9Q A;  2ZT9 D;  1FDM A;  4UB6 E;  1YHQ P;  3PTZ A;  1O7W A;  1P84 D;  1JNM A;  2QIW A;  4GDO A;  2RKL A;  4H13 D;  3RK3 D;  1FOS F;  1FAV A;  1WT6 A;  3H1L G;  3V2P A;  1HH0 A;  2AEF A;  4PV1 D;  5BU5 A;  2R32 A;  5BVZ A;  1S2E A;  2OYO A;  4GOE A;  1U7J A;  3LID A;  4HKV A;  1QVG O;  2OTK E;  2B87 B;  1PV3 A;  2FYU K;  2BAS A;  3GL0 A;  1ZRT D;  4EDF A;  1OWA A;  2GBX A;  4QUR A;  3P7K A;  3U1A A;  1H0T A;  4GT1 A;  3VN0 A;  1FZG A;  1NU1 D;  3RL0 g;  2Y0C A;  1U57 A;  5APV A;  3LW5 J;  3HD7 D;  1RHZ B;  5AVY B;  1S5L X;  5CCG D;  1RE4 C;  1Y9B A;  1FDI A;  1J1E C;  2I7F A;  2E74 C;  2LXB A;  2IZ0 A;  1SFC B;  1N73 A;  4WVZ A;  5AVX B;  2XRX A;  3VMZ A;  1XTG B;  2KIK A;  3Q2Y A;  4P1B H;  2V4H A;  2FYU E;  4TLF A;  4IOI H;  1VQ7 P;  4KJM A;  4WY4 C;  3HE4 A;  3E7K A;  1Q7Y Q;  2OQQ A;  1IZN B;  2CPB A;  3L70 J;  2E75 D;  3FOU A;  4H44 C;  2B88 A;  4IL6 E;  3BVH A;  2IBZ I;  2K1A A;  1Q2N A;  1X8Y A;  1FZC C;  4QMA A;  2ZT9 C;  3HRN A;  3V4W A;  1KD1 Q;  1RQV A;  3CLQ A;  1HGV A;  2WWW A;  1NTZ G;  2P7J A;  4EI2 A;  2YFL A;  4IFD K;  1UII A;  1NAF A;  1KIL C;  2OAR A;  2YVJ B;  1SQQ E;  2FYU G;  3I5C A;  2Z4E A;  3BCC G;  4HM8 A;  1S9K D;  1N2D C;  3G4S P;  1AJY A;  1YTZ I;  1J2J B;  3S9O A;  3H1L J;  3TF5 A;  3ITK A;  2B9B A;  4N3Y B;  1HJB A;  1NAY A;  3RK2 D;  1N7S A;  1OW7 A;  5AW6 B;  1NTM G;  1JY3 P;  3P32 A;  1NKZ B;  2N1T A;  1SQQ G;  1NDO A;  2L91 A;  2JWA A;  2OYH C;  1OMI A;  1PPJ G;  3D70 A;  1DH3 A;  2AXT E;  1W2B O;  5AVV B;  2ZVO B;  4UB6 H;  2WZ7 A;  3H6P A;  4HJL A;  2E43 A;  5KJ7 D;  3V2R A;  1SQX E;  3L37 A;  4IFM A;  3SFE C;  2J5U A;  2B87 A;  4DJG A;  1VF5 D;  3N4X A;  1QEX A;  1SQX J;  1KV4 A;  2ZJS E;  1M57 D;  1YI2 P;  1G2C A;  2P58 A;  3CX5 E;  5M1B A;  3L72 J;  3GHG A;  2E76 D;  3FWN A;  1E79 H;  3AE3 C;  1FS0 E;  5AVU B;  3P8M C;  3L75 D;  5E79 E;  1VM9 A;  2D2C B;  1URQ C;  4I2L C;  4D6T J;  4EYY Q;  1EQ7 A;  1YIJ P;  4EIJ A;  1T8Z A;  1G1J A;  1L4A A;  1DD4 A;  1JM0 A;  3M0D C;  4EMJ B;  1KIL E;  1CZQ A;  3CD6 P;  1M1K Q;  2WSE H;  2NVF A;  3GLM A;  5AEU A;  1QX8 A;  1QL2 A;  1KB9 E;  1E5W A;  1QVF O;  1RF1 A;  2WPQ A;  3RL0 B;  4HH2 A;  2XU6 A;  3AE2 C;  3E1I A;  3A0B H;  2E42 A;  1BGY G;  1RQU A;  2IYP A;  5AW0 B;  4H0L D;  1L0N E;  2ZAE B;  2Q3E A;  2KZI A;  1S5L E;  1Q81 Q;  3GOB A;  5APU A;  4PJ0 E;  2YKO A;  4PV1 B;  2FFD B;  3U59 A;  3SFD C;  4UB8 H;  1KB9 I;  3H32 A;  1EZV D;  4OVN F;  1NTK J;  2M8R A;  2W90 A;  3H1J G;  2A45 I;  3CL3 D;  3G9R A;  3W68 A;  4AYC A;  2Y0D A;  1SFC A;  3H1J D;  2WMM A;  2NPS C;  1FQT A;  4XA4 A;  1Y8A A;  5AVQ B;  1SJG A;  2KB7 P;  1NYK A;  1O7G A;  2KZJ A;  1K04 A;  1HVV A;  5TIS H;  4K35 A;  4L75 A;  2H89 C;  2O01 N;  1SQP G;  3OAK A;  3CXH I;  4W7Y A;  2WT7 A;  1SQQ D;  3A0H H;  3AED C;  1BCC E;  2OYH B;  4DOJ A;  3RL0 C;  4H0L C;  2R5B A;  3ABV C;  3V5B A;  2XV5 A;  3B4S A;  5TJH A;  3VMG D;  1HJ0 A;  2CPS A;  4YPC A;  2GM4 A;  1VQ5 P;  3L36 A;  1PGO A;  2OTL P;  1NTK E;  1KYO I;  1H88 A;  1JCD A;  4QCK A;  2ZVN B;  1EDJ A;  3VMY A;  2Z5H A;  3BRT B;  2N9Y B;  2K9Y A;  5APW A;  1GDT A;  3M9H A;  3EQQ A;  3CX5 D;  1HGZ A;  1R5L A;  1NTM K;  1L0N J;  1JY3 O;  3EN1 A;  3EFF K;  1Q82 Q;  1KIL B;  1AV1 A;  1SFC C;  1BGY J;  3TGU E;  3GTS A;  1GTW A;  1LTA C;  1Q90 D;  2XDJ A;  3V6I A;  1AA0 A;  3L75 E;  3HD7 A;  1NYH A;  1L0L K;  1L4A B;  5AEW A;  2QM8 A;  2D2C D;  3Q5R A;  5AW1 B;  4YTP C;  2JKV A;  1L4A C;  1ZOY C;  2QJY C;  3Q1M A;  5DJU B;  1NWQ A;  4NPE A;  1OVU A;  4I7Z C;  2JEE A;  2FY8 A;  2KSE A;  4D6T G;  5CCH A;  2O3J A;  3L72 D;  2FFD C;  1JMM A;  1IK9 A;  5AW4 B;  2Q7C A;  2HMJ A;  1Z56 A;  2XKM A;  4C7N B;  2P10 A;  2Q1K A;  2A45 G;  5APY A;  3GTE A;  1ZW0 A;  2H88 C;  1DD3 A;  3AE5 C;  2YFI A;  1CI6 B;  1LTI C;  3CCJ P;  2R3C A;  1OIP A;  4D6T E;  2N1T B;  5EFW B;  1N7S B;  4JQ0 D;  4JF7 A;  1SQB J;  3JC2 2;  2WTY A;  1HBW A;  2BMQ A;  5E79 H;  2C9N Y;  3F89 A;  3L72 E;  2WIT A;  3OA7 A;  2QJY B;  5APX A;  3L74 E;  1QGK B;  2K3R A;  4B86 A;  1JEK A;  4MN4 C;  1LTT C;  3CX5 H;  2BEZ F;  2WSF J;  2QRX A;  5KLV G;  1NGM B;  3D6Z A;  4WY4 A;  1O7M A;  3H1J J;  4NBF D;  1O7N A;  3IR9 A;  1G8K B;  3GG2 A;  3EWK A;  2KOG A;  2W27 A;  1SS1 A;  3A5T A;  2BCC E;  1NTM D;  2A06 D;  2LR2 A;  3AE9 C;  2QA4 P;  4HYT B;  3WUU A;  1AFO A;  1LJ2 A;  1BCC G;  1FDO A;  2H7H A;  1NJI Q;  3D89 A;  2OYH A;  2NUM A;  1EDI A;  3CCS P;  1BDC A;  4DZO A;  4DT0 A;  1IO4 A;  3KXD A;  3M0A A;  1KC8 Q;  1KZU B;  2YXQ B;  5APS A;  1MKM A;  1CSB A;  2KK7 A;  4LGD E;  4K3A A;  4EOT A;  2Z5I A;  3BAT A;  2HYN A;  1VF5 B;  4HM7 A;  5KAF H;  3CXH D;  2SPZ A;  1LT9 C;  4GKG A;  1W2E A;  3P8C D;  1EG9 A;  1VQP P;  2FYU J;  1LWU B;  5KTB A;  1NTK D;  3CC7 P;  4OH8 B;  1JTH A;  4W80 A;  4TT3 H;  2IZ1 A;  2E4Q A;  3H32 B;  1SQV E;  3L75 J;  2Y9Y A;  4HB1 A;  3H1K G;  4IL6 H;  3N0Q A;  3L70 E;  3Q5S A;  4H44 B;  1FZB A;  1SQQ K;  2QEX P;  1IFI A;  3CCR P;  3ZDM A;  2KLU A;  2ZT9 B;  3L70 D;  1KFN A;  2RMZ A;  3CCL P;  2ZXX A;  1L0L J;  3M9B A;  1XTC C;  1M90 Q;  3USS A;  5BOK A;  1M7L A;  1P84 H;  3HUS B;  1BGY E;  1TU3 F;  3CWB D;  4ZMD A;  1KFM A;  4GIF A;  3EQ2 A;  5KJ7 C;  1G8J B;  5KLV K;  4L73 A;  2HMM A;  5K5G B;  2WSF H;  1KQF B;  2H8P D;  2NPS B;  2D2C C;  2KP8 A;  2C9L Y;  3CC2 P;  3KPE A;  3PP5 A;  3VYI A;  1YYC A;  2KUB A;  3HE4 B;  3N7N A;  2E4P A;  2OYI B;  4N78 D;  1FZE A;  1T6A A;  2WVR A;  1T3U A;  3NMD A;  4BRY A;  4RES B;  1IK7 A;  4IFF A;  2WSE J;  3KYQ A;  3U1C A;  1VQ4 P;  2KNC B;  3HTK B;  1ZR2 A;  3MHV A;  2A06 G;  4U7J A;  1W5C E;  2L5G B;  1K8A Q;  1VDF A;  4LC1 A;  3IN6 A;  1DEB A;  1SQV D;  1EXJ A;  1G2C B;  3H25 A;  2WT7 B;  3RK2 B;  3MIW A;  1MV8 A;  1KOR A;  3AEF C;  2Q3W A;  1NTK G;  3DQY A;  2E5T A;  3PLN A;  1U7M A;  3FGA D;  5GTI H;  3GKE A;  4DCK A;  3B71 A;  4WBA A;  1Y47 A;  2OYI C;  4R4L A;  1T3J A;  4Y99 B;  3T97 B;  1K05 A;  4GOD A;  5CXM A;  3WUV A;  2E75 C;  5C39 A;  1NO4 A;  2GUS A;  2M5A A;  1PGP A;  5GTI E;  1R5S A;  3TDK A;  2PAJ A;  2NWF A;  1M8O B;  3SWY A;  1ZME C;  2DE6 D;  2UWJ E;  5CJ4 A;  2QM7 A;  1EZV E;  3JSV C;  2O1J A;  2G3A A;  2PFX A;  2RH0 A;  5CCH D;  4NBE D;  4LLH A;  3GZX A;  2IDB A;  2GUV A;  3L75 G;  1L0L G;  5CCH C;  2YMY A;  2E74 D;  1L0L E;  1VCK A;  1ZLL A;  5CJ0 A;  4Z1M H;  4I6M C;  2J59 M;  3E1R A;  1BE3 D;  4JYC A;  1YJ9 P;  1YJW P;  1NTZ J;  1IFM A;  3AEC C;  1FZF A;  4W7Z A;  1RE4 A;  2FYN B;  3SWF A;  3V2Q A;  5KKZ C;  2W8Z A;  3CCQ P;  1LT9 B;  2IBZ E;  3K5B A;  4HM3 A;  3PH0 A;  1CI6 A;  1NTK K;  1MUU A;  3C0D A;  1URQ D;  2XR8 A;  2WPR A;  2XSO A;  4JYB A;  4NBG D;  2C0X A;  3VMI D;  1EC5 A;  1QLE D;  1KN7 A;  3NXS A;  3MGN A;  2W83 C;  2R3S A;  1NKN A;  1K9M Q;  3EFG A;  1M1J C;  1SQQ J;  1ZP0 C;  2GA1 A;  3MUD C;  2FYZ A;  4KHX A;  3VP9 A;  1FJK A;  4NPD A;  4PD4 D;  3MTU E;  2Q6Q A;  1AQT A;  5DJT B;  3H1L E;  2BCC G;  3R4Y A;  1H89 A;  4IL6 X;  3H1K D;  3L71 J;  4NBH D;  1BCC D;  2B24 A;  1NTZ D;  4AIV A;  5AW7 B;  1LTB C;  1N7S C;  2K88 A;  1LTJ A;  2FKW B;  5GTH H;  1RF1 B;  1YQ4 C;  4AQR D;  1EZV I;  1Q86 Q;  1AQ5 A;  4Y99 C;  4PD4 E;  2QVA A;  3AE7 C;  4OGQ B;  3GHG B;  1VQO P;  3I56 P;  3VMH D;  3TNU B;  1IJD B;  1FU1 A;  1VQ9 P;  1BSN A;  4O9B A;  1VQM P;  1URQ A;  1YBK A;  1LTS C;  1RE3 A;  4L76 A;  5KAI E;  1LTG C;  2KXP B;  3H1I G;  1NH4 A;  1S72 P;  1M1J B;  3HUS C;  2HMN A;  1WQL A;  4HM0 A;  3H1H G;  3L73 G;  3TSI A;  5AW5 B;  3MD0 A;  4AUW A;  1GL2 B;  5AW9 B;  1KTM A;  2YO2 A;  4ASW A;  1L0L D;  3HE5 A;  5L8R J;  3O6Q B;  1FZC A;  5APQ A;  4RJT A;  2W6B A;  3AEG C;  1S5L H;  2HOD B;  5AW8 B;  3GZY A;  2HPC A;  1LNQ A;  5KKZ B;  2BCC D;  1EDL A;  1H8A A;  1SQP J;  2KLV A;  3NTN A;  2R44 A;  2KNC A;  2FYU D;  3TGU J;  3GHG C;  1OZH A;  1NTZ K;  4QDF A;  1J1D B;  5KLV D;  4HM2 A;  4M3L A;  5AW3 B;  2NVG A;  4AAY B;  1HUC A;  3LIE A;  1X22 A;  4ZNC A;  2HFE D;  2IFN A;  2N1T D;  2AEJ A;  3UIA A;  3M06 A;  3G3Z A;  3VOP A;  3C1L A;  5KLI B;  4PV1 C;  1SQP E;  3V4Q A;  1NHL A;  4ZKU A;  1BDD A;  1EXI A;  3CI9 A;  1WMK A;  5HL4 A;  3WU2 E;  1EZV G;  1N7S D;  5BU8 B;  1T2K D;  2ZXE B;  3H1L D;  1BE3 J;  1FOS E;  1DIP A;  1SQB D;  2QJK B;  4OWF A;  1USE A;  1RF0 A;  3QH9 A;  1LWU C;  3RGU A;  2P2U A;  4A7P A;  2P67 A;  3TYY A;  1SQV G;  3RK3 E;  2NRG A;  3H1H D;  3L73 D;  5B5E E;  3H1I E;  5H2F E;  1PFI A;  2LKM A;  3BCC E;  2R5D A;  4L74 A;  4C7N A;  1SP4 A;  2AEM A;  1X79 B;  3CXH E;  1N7L A;  1GZL A;  5H2F H;  5CHX A;  4YXW H;  3MUD A;  2JO6 A;  3AE1 C;  5KLI C;  3Q3D A;  1MFT A;  2OGU A;  2K37 A;  1VPC A;  3A0B E;  2WSS H;  1RIE A;  1EDK A;  2YMK A;  2ZYD A;  1LTJ C;  4I1L A;  4D6T D;  2DE5 D;  3HD7 C;  3H1K E;  3FXE A;  2YXR B;  1JUN A;  2GBW A;  1SQV J;  1HWT C;  3M91 A;  1MFZ A;  3C9I A;  4P1C H;  4PD4 H;  3VMA A;  2HLO A;  1ULJ A; 
#chains in the Genus database with same CATH homology
 4HM3 A;  4QDD A;  3GOB A;  5HL4 A;  3AZC A;  2BMO A;  1NDO A;  3L71 E;  3EN1 A;  2QJK C;  3C0D A;  3GB4 A;  1O7M A;  2XR8 A;  4NBC D;  2Q3W A;  4NBF D;  3TGU E;  3GTS A;  1JM1 A;  1O7N A;  2XSO A;  5BOK A;  4QDF B;  2NUK A;  2JZA A;  2HMK A;  1G8K B;  4NBG D;  1PP9 E;  1NTZ E;  3L75 E;  1ULI A;  2HMN A;  2I7F A;  2ZYL A;  4HM4 A;  4OGQ D;  3VMI D;  3CWB E;  1WQL A;  4H44 D;  4HJL A;  3DQY A;  2XSH A;  2XRX A;  5AEW A;  2BCC E;  3GKE A;  4HM0 A;  4U3F E;  2D2C D;  2CKF A;  1BGY E;  2NVE A;  1SQX E;  3EQQ A;  2DE7 D;  4P1B H;  2FYU E;  3D89 A;  1PPJ E;  1VF5 D;  2FYN C;  2QJY C;  3H1I E;  2NUM A;  1G8J B;  3VCA A;  5KLV E;  1FQT A;  5CXM A;  2HMM A;  3BCC E;  1SJG A;  4QUP A;  1NYK A;  4NBA D;  4HM1 A;  3CX5 E;  1O7G A;  2B1X A;  4HM5 A;  2NWF A;  3H1J E;  2E76 D;  2E75 D;  3CXH E;  4NB8 D;  3FOU A;  3H1L E;  2DE6 D;  2ZT9 D;  4NBH D;  1EZV E;  2JO6 A;  3GZY A;  2B24 A;  2HMJ A;  1O7P A;  2HMO A;  1O7W A;  5KLI C;  4AIV A;  1VM9 A;  2QPZ A;  4QUQ A;  4HM7 A;  2E4P A;  4QDC A;  4NBE D;  3GL2 A;  3GTE A;  1NTM E;  3GZX A;  2A06 E;  4H13 D;  1P84 E;  2YFL A;  2YFI A;  1UUW A;  1BCC E;  3GCE A;  2E74 D;  4EMJ B;  1RIE A;  1EG9 A;  3H1H E;  3L73 E;  4PV1 D;  1ZRT E;  4D6T E;  2YVJ B;  4QDF A;  2NVF A;  1L0L E;  1SQQ E;  1RFS A;  1SQB E;  1VCK A;  5AEU A;  2YIU C;  4PD4 E;  4HM2 A;  1O7H A;  1KB9 E;  4NBB D;  4HKV A;  4HM8 A;  3VMG D;  3VCP A;  2NVG A;  1UUV A;  4AAY B;  2QJP C;  1KYO E;  2BMQ A;  1NU1 E;  2DE5 D;  2YFJ A;  3GL0 A;  2E4Q A;  1SQV E;  2GBX A;  1NTK E;  3VMH D;  3H1K E;  2BMR A;  3L72 E;  4NBD D;  4QUR A;  2GBW A;  3N0Q A;  4HM6 A;  4QCK A;  3L70 E;  1BE3 E;  2HML A;  1SQP E;  3L74 E;  1Q90 C;  4H0L D;  1L0N E;  5KKZ C;  4P1C H;  4NB9 D;  2IBZ E;  1ULJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...