1SQXE

Crystal structure analysis of bovine bc1 with stigmatellin a
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 45
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2004-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1sqxE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1sqxE02
1EZVE 4NB8D 2BMOA 4HM2A 4HM0A 3GKEA 2IBZE 2QJPC 3H1IE 3VCPA 2QPZA 2E4QA 1BCCE 4HJLA 5KLIC 1EG9A 3TGUE 3AZCA 3H1HE 1ULIA 1G8KB 3GCEA 2HMNA 1VM9A 5AEWA 3EN1A 3N0QA 4HKVA 3GTEA 2NVFA 4EMJB 2E76D 1L0NE 2NUKA 1NDOA 4QDDA 1O7WA 1UUVA 4H13D 1Q90C 1SQXE 5HL4A 3L73E 4HM8A 2E4PA 3GB4A 4PV1D 3GL0A 4NBED 5CXMA 2JO6A 1BE3E 1L0LE 4HM4A 2BMQA 4QDFB 2CKFA 4U3FE 4NBBD 4QDFA 3GTSA 4QUQA 2YIUC 4NBDD 4QURA 2HMOA 1JM1A 4D6TE 3CXHE 1KYOE 2DE5D 1RFSA 1VCKA 2YFIA 1VF5D 2Q3WA 2XSHA 3VMGD 4PD4E 5KKZC 5AEUA 1KB9E 2E75D 2HMMA 3VMID 2BCCE 2I7FA 2NVEA 2XSOA 2NUMA 4NB9D 3EQQA 1SQBE 3GOBA 4HM7A 3H1LE 2XR8A 2ZYLA 3CX5E 2YVJB 4NBAD 1NTZE 1PPJE 1BGYE 2QJYC 5BOKA 3L74E 3GZXA 2E74D 2GBXA 2HMLA 3L70E 4NBHD 3H1JE 3L75E 4H0LD 4QUPA 4AAYB 2NVGA 1WQLA 2JZAA 3CWBE 3L71E 2A06E 2BMRA 3GL2A 2FYNC 1NYKA 4NBGD 4QCKA 1NTME 1P84E 4HM6A 4H44D 2D2CD 2QJKC 1SQQE 2NWFA 1SQVE 4OGQD 3DQYA 4HM5A 4NBCD 4P1CH 4NBFD 3GZYA 3H1KE 5KLVE 2HMJA 4AIVA 1NU1E 4HM3A 1O7PA 1ZRTE 3VCAA 1O7HA 2YFJA 1ULJA 2GBWA 1SQPE 2DE7D 4QDCA 4P1BH 2B1XA 1O7NA 1SJGA 1PP9E 2DE6D 1O7MA 2ZT9D 1O7GA 2HMKA 3L72E 2YFLA 3VMHD 1UUWA 1FQTA 2B24A 3FOUA 3BCCE 2XRXA 1RIEA 3C0DA 1NTKE 1G8JB 4HM1A 3D89A 2FYUE
chains in the Genus database with same CATH superfamily
2PGDA 3HUSC 4BRYA 2Q5UA 1SQQG 2B9BA 2Q3EA 2H8PD 2N1TC 3H1IJ 3IN6A 1NTKD 1W2EA 3TNUB 1VF5B 1SQXD 1HWTC 5AVYB 1FE6A 4H0LC 4H13D 3ABVC 3Q1MA 1SQXJ 2HPCB 4ZMDA 1L0LE 2WVRA 3HE5B 2XU6A 1LTIC 4NBDD 1D7MA 1T3JA 1S3JA 1R5SA 3B71A 3TF5A 2Y0EA 3R4YA 2IBZI 3WUVA 1PV3A 1LP1A 2O1KA 2YKPA 3EQ2A 4I1LA 3L70E 4D6TD 1USDA 4DJGA 1NTMD 1NAYA 3H1JE 1BGYG 4H0LD 3TDKA 4R4LA 1KB9D 2W6BA 1VDFA 2HODA 3L71E 3PHLA 4K3AA 2P2UA 3RK3E 1NTMJ 4IOIH 4C7NA 3CWBG 1RE3C 1YJNP 1S2EA 2QVAA 3MHVA 3CD6P 1Q81Q 4PJ0H 3FXEA 4XA4A 3AEEC 2N1TB 4Z1MH 1J2JB 1G8JB 3L72G 2YMYA 2FYUE 2W6AA 4NPEA 4TLFA 1MKMA 1K04A 2FYZA 4PD4I 3D70A 2E4QA 3SWKA 1LTBC 1MZ9A 2L91A 2WT7A 1A02J 1ZR2A 3KZIE 2NVFA 3RK2C 3PLNA 2OQQA 2RH0A 4PV1D 4GT1A 3L73J 1URQA 3N7NA 2WPSA 3AECC 3GTSA 4QURA 5AW9B 3JCUH 1HGVA 2JDIH 2E75D 1GW3A 1KILD 5AW0B 1FOSE 2LXCB 1H0TB 3MGNA 3CX5E 4EI2A 1LTAC 1BGYE 2QJYC 1HTLC 2KZJA 3RL0C 2WPRA 3TSIA 5KAFE 1JB0J 4OGQC 1KFMA 3CWBE 3M9BA 4NBGD 2FFDA 4U3FG 2V7QJ 3AEDC 2XDJA 3H6PA 3VMAA 3CLQA 4AUWA 4WY4C 3R2PA 1BSNA 1OMIA 5GTHH 2DE7D 1UIIA 2KI7B 1SVFA 5CBNA 3L72E 1LTJB 1KN7A 1FZAA 3AEGC 4TT3H 3CCJP 1Y9BA 1RQUA 3PH0A 3GLMA 3IFMA 3CXHI 1L0LK 4HM0A 2KNCA 1QVFO 5AW7B 1SFCD 3C1LA 2E42A 1OVUA 2ZFCA 4WY4D 3EN1A 1AVYA 5TISE 3HUSA 2ZVNB 2IX7C 1IZNB 2W8ZA 1P84I 1JEKA 3AE8C 1L0LJ 2H7HA 1LJ2A 3O8ZA 2YFIA 2XNXA 2QJYB 1EZVI 3RL0B 3H32A 2C0WA 3HD7B 4N3YB 2Y9ZA 4OGQB 3B5NB 3L70D 2JO1A 3V2NA 3H1JD 2BCCG 2KUBA 2KS1B 3WU2H 2JWAA 2RN0A 3H1LG 2IYPA 1KQSO 5AVVB 1RF1C 2A45H 3L70J 3RK3D 3A0BE 3H1JJ 2JJLA 4ASVA 3ZDMA 5B66H 5CCHC 2MKVA 1ZR4A 3L71J 2I1KA 4LLHA 4NPDA 2NPSC 2K88A 3A5TA 1N73A 2FYUK 3V2QA 3FX0A 1N7SD 2QIWA 1O7HA 2AEFA 1EDKA 1SS1A 1YTZT 2A06D 2IDBA 4IFMA 4GDOA 3SSUA 4IL6E 3L36A 2W6JH 1SQQD 1G1JA 3TGUJ 1L4AB 3P7KA 2GM4A 2Z5HA 3FOUA 1H8AA 4NPFX 3D89A 3OA7A 1XTCC 2I8DA 1NOHA 2FYUJ 1FJPA 2Z4EA 5CCHD 1DIPA 3HRNA 1VQ8P 4HJLA 5KLIC 1W2BO 5H2FH 4ZKPA 2OYIB 2HMNA 2E74C 3F89A 2WZ7A 2QSIA 1RY3A 2ZYAA 2ZYGA 2AXTH 2MJZA 1IO4A 1DD3A 4OWFA 2PAJA 1K05A 2RMZA 3CI9A 1Q86Q 3KDPB 1VQ9P 1Q90D 1LNQA 2KYVA 3CX5D 1MFTA 5AVXB 2BCCE 1BGYD 3HTKB 1IC2A 2SPZA 3SWYA 1RF1B 3H1LE 3PJSK 1KB9H 2E74D 1KYOD 3L75E 4BWNA 3L73G 2KP8A 4JBZA 3VP9A 3L4FA 2R5DA 3CWBJ 1HBWA 2ZT9B 1LT9B 2NWFA 2Q3IA 2O01J 4DZOA 2YXQB 3H1KE 1OX3A 5KLVE 2YO3A 3QWOC 2Q1KA 3L72D 4P1BH 3MUDC 2JP3A 2QRXA 2DE6D 1PGOA 5GTIH 4AQRD 1SFCA 1WMKA 1SQBK 2QM8A 2XZRA 3LW5J 4WY4A 2OYHA 4BRYB 1YQ3C 3I55P 3CCLP 2J58A 1YITP 1PGJA 5AVRB 1ZP0C 3AZCA 1KQLA 1T2KD 2R3CA 1M57D 1SQBJ 2AEJA 3TK1A 3CPWO 1KV4A 1LWUA 3FXDA 2R32A 1RE4C 1K9MQ 2P7JA 1VCKA 4PD4E 2HMMA 1L2PA 5E79E 1LP1B 1IFDA 4U3FD 3NXSA 3W68A 1N7SA 2HODB 4QCKA 2I1JA 2JWDA 1L0LG 4C7NB 3OJAB 2D2CD 2OARA 1NKNA 2WMMA 2YXRB 2FFDC 3AEBC 3F5HA 3HE4A 1EC5A 1RF0A 2WSEH 5CCHA 4XFJA 1NWQA 1SJGA 4EOTA 4JPZB 1GDTA 1O7GA 2YFLA 5CCGD 1RIEA 1PP9G 4RJTA 3L71G 5CJ0A 3VMXA 3AEAC 4UB8E 4JF7A 4GIFA 2QJPC 2WSCH 2Y0DA 2WT7B 3USSA 4H13C 1HUCA 2A45I 1GU4A 3CMEP 1ULIA 4WBAA 1KTMA 3GTEA 4EMJB 2G8YA 1L0NE 2V4HA 3TGUG 1MFZA 3G4SP 1URQB 3S4RA 1SQPK 4HKZH 2WITA 4YXDC 3AE5C 3LIDA 2FYUG 1FC2C 2YIUC 2BCCD 2G3AA 3CXHE 2KIKA 1JO5A 2Q3WA 2XSHA 3H1LD 4I2LC 1FZGA 5AEUA 2YKOA 1LTTC 2QG4A 2BCCJ 5KLVK 3H1LJ 3GZXA 3D71A 2FKWB 2WQYC 1GU5A 2BEQD 1YYCA 4N6JA 3L75J 5CJ4A 2ZXXA 2FFDB 3GL2A 4N78E 1ZMEC 1P84E 4R4MA 3JSVC 4YTPC 3II6A 2NRGA 1PPJD 1HJ0A 3DQYA 4NBCD 5BVZA 3H1KJ 1O7PA 1FU1A 5KLVJ 3A7OA 1N73C 1X22A 5AW8B 2E76C 3KPEA 1N8RQ 1LT1A 2C9LY 4EIJA 1PP9E 1OW6A 2M8RA 1PFIA 3G6EP 1G2CA 3VTPC 2QJPB 4H13B 3M0AA 2KNCB 3KZIH 2JEEA 3RL0g 3MUDA 3VCPA 1KB9I 3T97A 3FGAD 1YJWP 3TGUE 4HJGH 3V4WA 3KQGA 1FDOA 4PV1C 2LKMA 3HUSB 2M5AA 2E76D 1U57A 1S9KE 3VOPA 1A02F 2YIUB 3TYYA 2E4PA 2KLUA 4IFDK 1AQTA 2E75C 4RESB 1BE3E 1KILC 3BRVB 3CX5H 4H0LB 2O3JA 4U7JA 3H32B 5KAFH 1M8OB 1KC8Q 4K35A 3GOBA 3L73D 2XR8A 3CCQP 3JC22 1KYOH 2OTLP 5B5EE 1SQBG 2K1AA 1RE4A 3SFDC 1XTGB 5APVA 3L74G 1CI6A 3N4XA 2ZXEB 2ZVOB 2W90A 1PGQA 1N73B 1SQVE 4RO0A 4NBFD 5CCGA 2Y0CA 1NU1E 3M9HA 2OYOA 3BRTB 2B1XA 4GODA 2UWJE 1L0NK 3CCVP 5TJHA 1TU3F 3GW6A 1NTZK 1SFCC 1S5LH 1ZRTD 3EFFK 3A0HH 2PRRA 4NB8D 1MV8A 2OYHC 4PV1B 3G9RA 4QMAA 2XV5A 2N9YB 3ITKA 2NUKA 2E75B 1YQ4C 1L0NJ 4I6MC 3JCUE 1NTZJ 3I5CA 1GK4A 1QL2A 3RBXA 4NBBD 2H43A 1FZEA 2WSFJ 3LIEA 3RK2B 3CC7P 1NYHA 1LWUC 1GTWA 1QEXA 1VQLP 1SQBE 1JUNA 3A0BH 1RQVA 3RK3C 1L0LD 1X79B 2Q7CA 3L74E 4OVNF 4N78D 4YPCA 4QUPA 4L74A 1S5LX 1N7SC 3BASA 5GTHE 4XE5B 5KJ7D 4HM5A 1VQ5P 3AE4C 2XKMA 1JMBA 1VQ7P 1PP9D 3VN0A 1OFCX 3L71D 1RF0C 4QDCA 1L4AD 5AW5B 1SFCB 4M3LA 3IAOA 1PP9J 1SQPG 1FQTA 3L75G 4WY4B 2M3BA 3GMAA 3B8EB 3BCCG 3B4SA 3NFQA 3TGUD 3P8CE 1BCCE 3H1KG 3OW2O 5KLVG 4BXLA 4JQ0D 2IBZG 4HKVA 3AE6C 1JY2P 1Y8AA 2FYUD 1UUVA 2L5GB 1IJDB 1H0TA 1Q90C 4UB6E 1HF9A 3Q5RA 5CXMA 1LWUB 2CKFA 4HB1A 2HG5D 1BE3J 4QDFA 1NJIQ 2HMOA 1PIXA 1VQ6P 1IFNA 3CCSP 2WTYA 4W7ZA 1SQVK 3PRJA 2ZYLA 1SP4A 5BOKA 1NU1K 3Q2YA 1KILA 4JYCA 5B66E 1CZQA 1EQ7A 1FOSF 5KTBA 3GF3A 3AE1C 1JTHA 1VQMP 2BMRA 5C39A 2J59M 3CCEP 3G71P 4GOFA 3D6ZA 2JR8A 3HE4B 4P1CH 1SQVJ 2KB7P 1FDMA 3O6QA 4KHXA 1EDJA 3VMZA 1NU1J 2YFJA 1ULJA 1SQPE 3CWBD 2NPSB 2P1JA 3CX5I 3H1HJ 2OGUA 2FXMA 4JYBA 5CBOA 3BCCE 1NTKE 1X9VA 2LR2A 1T2KC 1GW4A 1KYOI 2OTKE 4KT0J 3GKEA 2IBZE 2QPZA 2ZYDA 5DJTB 3M0DA 2AXTE 1ZW0A 1X8YA 2ITAA 1M1JC 4L75A 3Q3DA 1FDIA 3EFGA 1NDOA 1FZFA 3CCMP 3MIWA 5KLIB 1Q7YQ 1QGKB 4NBED 1FZBA 1J1EC 2J5UA 2E74B 5E79H 1Y47A 1J1DC 4D6TE 1RFSA 1SQBD 4B86A 1KB9E 2C0XA 4EDFA 3L74D 4I7ZC 4Y99C 2YVJB 1WT6A 4KJMA 1L0NG 3L74J 4HYTB 2D2CC 2BEZF 1GL2C 5BU8B 1NTZG 2LXBA 2R3SA 3QH9A 2FYNC 2O1JA 1NYKA 5AW4B 3GHGA 3A2AA 4H44D 1VL2A 3AE2C 1R5LA 3C9IA 2WWWA 1K8AQ 1E5WA 5KAIH 5AVWB 2V7QH 2KSEA 1FAVA 3VMYA 5CCGC 1OZHA 1E79H 1NAFA 1S4XA 1O7MA 2HMKA 1G2CB 4GKGA 3VMHD 1JY3O 1GL2D 1ZOYC 5AVTB 1VF5C 4C7RA 1QX8A 1NKZB 3D6YA 5AW3B 3T97B 2IFNA 1EZVG 1FZCA 1BCCJ 3GCEA 2GUSA 2KSJA 2W27A 2E5YA 2IZ0A 1DD4A 5AVZB 3KXDA 1O7WA 1FBMA 3AE9C 3VP8A 3GL0A 2JO6A 1M90Q 4RKUJ 2YMKA 3BATA 4Y99B 1VQPP 3MZWB 1VF5D 2KLVA 5KKZC 1DEEG 3Q5PA 2NVEA 2D2CB 3V2PA 1NTZE 3EWKA 2FY8A 1RH5B 2GBXA 1X0TA 1Q2NA 1ZXGA 2K9JA 4WWIA 1N2DC 1CI6B 4LC1A 1GK6A 1OVRA 3GF7A 1EDIA 1BE3G 1KFNA 1NTKK 1SQXK 5APQA 3GZYA 2Q6QA 3WUUA 1SQPD 4AIVA 1AFOA 3L75D 3V6IA 2B89A 2KK7A 1IK9A 1N7LA 5AVSB 1SQPJ 1O7NA 3BCCD 1AJYA 1LTSC 1IFPA 1GZLA 1BDDA 1IK7A 3H1KD 5KLVD 3KYQA 5APYA 3BCCJ 2IBZD 1NTKJ 2DW3A 1EZVE 4DOJA 4IFFA 4HM2A 5APTA 4HH2A 1EXIA 1SQVG 1UIXA 1Z56A 3U1CA 1NTMK 1NU1G 1ZV8A 1YTZI 1G8KB 2N1TD 2YNYA 3H1HG 5CHXA 4QDDA 3V2RA 2JKVA 2H89C 1QVGO 5KKZB 3PTZA 2QA4P 2HR3A 1YI2P 4A7PA 1M1JA 1OXZA 4ZKUA 1T6AA 3V4QA 5B5EH 4D6TJ 4OH8B 2I7FA 2NUMA 3OAKA 1YHQP 3MTUE 4HM7A 1FJKA 2WPVB 2ZAEB 4NBHD 2B87A 4PD4D 2P10A 5K5GB 2A06E 4GOEA 1T8ZA 4WVZA 1HJBA 1JY3P 2QJKC 1SQQE 1JY2O 1H89A 1SLQA 4L73A 1LTJC 1DH3A 5BU5A 1GL2A 2PP6A 3M9QA 2O01H 3E7KA 3S9OA 1OWAA 2QEXP 2FBWC 3PP5A 3A3YB 1KMIZ 2AEMA 1UUWA 2E76B 5L8RJ 4PJ0E 3LW5H 4MN4C 3H1HE 1DX7A 4LGDE 3TNUA 3M0DC 3C8VA 1T3UA 2YO2A 5HL4A 1G1IA 1OVVA 2WPQA 3HD7C 4QDFB 4HM4A 5APWA 1IFMA 3RK2D 5TISH 2HPCA 3B5NC 3HE5A 1MUUA 1KYOE 5APUA 1L0ND 3FWLA 2IPPA 1NTZD 1JCDA 4WB4A 1BCCG 2Q9IA 1M1KQ 1KILB 2HFED 2R44A 3CXHD 2QJKB 3U59A 5KJ7C 1JTHB 2B88A 4W80A 1WQLA 2JZAA 1ZN5A 3MP7B 3RL0D 1CW5A 2KOGA 3HD7D 2CPSA 1KORA 2WSEJ 3K5BA 2WSSH 4OGQD 3B5ND 3GHGC 1L4AC 3O6QB 1N86A 3G3ZA 2HMJA 1NH4A 3VCAA 2A45G 2GBWA 1AVOA 1USEA 1P84D 1S5LE 3A0HE 1JY3N 2K3RA 1JOCA 1PL5A 1S1CX 1EZVD 3C0DA 2QM7A 1R8EA 2XNDH 4IL6H 2OYIC 2N1TA 5AW1B 2WSCJ 4CPGA 5AVQB 2BMOA 2M3EA 2HLOA 1JCCA 1PGPA 1YBKA 4UB6H 3FWNA 3H1IG 1PZQA 5AEWA 1FZCC 3H25A 2OYHB 3NMDA 2OTJP 1GD2E 2ZJSE 4HM8A 1NTKG 4U3FE 1SQXG 2GUVA 4QUQA 1QLED 4Y28J 1YIJP 2Y9YA 4ZNCA 3VMGD 1SQQK 2QE7H 1S9KD 2K37A 1S72P 4NB9D 4O9BA 1HVVA 5AW6B 1BE3D 2IZ1A 2ZT9C 1HH0A 1LT9C 1VQ4P 1IFIA 4DT0A 2VRSA 1QL1A 3M91A 1PPJG 2Z5IA 3L35A 2E43A 1ZLLA 4C46A 3GHGB 4IL6X 3RK3B 5APSA 1RE3A 3WU2E 4D6TG 1SQQJ 1NTMG 4EYYQ 2BASA 1DEBA 2R5BA 1N7SB 2NPSD 3RBZA 1U7JA 3I56P 1JMMA 3WMM0 2ZT9D 5EFWB 1SQVD 3AE7C 1HGZA 2XRXA 1LTJA 3S1KA 1NU1D 3CL3D 5CMZA 3H1HD 3H1IE 3SWFA 1U7MA 1FZCB 3RGUA 3P32A 1EG9A 2CPBA 1VQOP 3BVHA 2IFMA 1KQFB 1LTGC 1SQXE 1M56D 1NHLA 1EDLA 1BGYJ 3P8MC 3GB4A 5H2FE 2IYOA 1VPCA 3M06A 1NGMB 3KHUA 3IF4A 3U1AA 2GA1A 1W5CE 1AQ5A 2DE5D 3L37A 5DJUB 3VMID 2XSOA 3HD7A 1RHZB 2P58A 4L76A 4NBAD 3V5BA 1PPJE 1M7LA 1GMJA 1EXJA 3B5NA 2K9JB 4PD4H 3NTNA 4YXWH 4H44C 2KS1A 2P67A 2M0BA 2CK3H 2NVGA 1JY2N 1NTME 1OIPA 4HM6A 1K73Q 3L72J 2K9YA 3AE3C 5KJ7A 3AEFC 1VQKP 2KZIA 1BSHA 1Q82Q 1BDCA 5APXA 1L4AA 3MD0A 3UIAA 2FXPA 2E5TA 3SFEC 3CC2P 4HM1A 1H88A 1CSBA 5AVUB 5GTIE 1WRGA 4DCKA 4AYCA 3CCRP 1URQC 1LGHB 1VM9A 4UB8H 2FXOA 3N0QA 2AXCA 2OYIA 1JM0A 3CCUP 1FS0E 3IR9A 2N9BA 3L73E 3P8CD 1YJ9P 2NZ2A 1BCCD 2PFXA 5AW2B 2BMQA 1M1JB 4U3FJ 1JNMA 1JM1A 1OW7A 1IFJA 4W7YA 3E1RA 2KXPB 2M5AB 4H44B 2WSFH 3EQQA 1J1EB 3VYIA 3HTKA 1URQD 3CXHH 1RF1A 1J1DB 1KILE 2C9NY 3CC4P 2HMLA 1AV1A 2B87B 2YKQA 4AAYB 4I7ZB 1OW8A 2NPSA 5KAIE 2O01N 3L70G 3H1JG 1KQGB 3W67A 1LT9A 1GL2B 2W83C 2HYNA 1P84H 4HM3A 3Q5SA 1ZRTE 2FYNB 3CMAP 2RKLA 2POHA 1VQNP 1KZUB 1AA0A 3GG2A 2H88C 3WUTA 1NO4A 2B24A 3E1IA 4ASWA 1KD1Q 1NVOA 2A06G 5M1BA 3H1ID
chains in the Genus database with same CATH topology
1EZVE 4NB8D 2BMOA 4HM2A 4HM0A 3GKEA 2IBZE 2QJPC 3H1IE 3VCPA 2QPZA 2E4QA 1BCCE 4HJLA 5KLIC 1EG9A 3TGUE 3AZCA 3H1HE 1ULIA 1G8KB 3GCEA 2HMNA 1VM9A 5AEWA 3EN1A 3N0QA 4HKVA 3GTEA 2NVFA 4EMJB 2E76D 1L0NE 2NUKA 1NDOA 4QDDA 1O7WA 1UUVA 4H13D 1Q90C 1SQXE 5HL4A 3L73E 4HM8A 2E4PA 3GB4A 4PV1D 3GL0A 4NBED 5CXMA 2JO6A 1BE3E 1L0LE 4HM4A 2BMQA 4QDFB 2CKFA 4U3FE 4NBBD 4QDFA 3GTSA 4QUQA 2YIUC 4NBDD 4QURA 2HMOA 1JM1A 4D6TE 3CXHE 1KYOE 2DE5D 1RFSA 1VCKA 2YFIA 1VF5D 2Q3WA 2XSHA 3VMGD 4PD4E 5KKZC 5AEUA 1KB9E 2E75D 2HMMA 3VMID 2BCCE 2I7FA 2NVEA 2XSOA 2NUMA 4NB9D 3EQQA 1SQBE 3GOBA 4HM7A 3H1LE 2XR8A 2ZYLA 3CX5E 2YVJB 4NBAD 1NTZE 1PPJE 1BGYE 2QJYC 5BOKA 3L74E 3GZXA 2E74D 2GBXA 2HMLA 3L70E 4NBHD 3H1JE 3L75E 4H0LD 4QUPA 4AAYB 2NVGA 1WQLA 2JZAA 3CWBE 3L71E 2A06E 2BMRA 3GL2A 2FYNC 1NYKA 4NBGD 4QCKA 1NTME 1P84E 4HM6A 4H44D 2D2CD 2QJKC 1SQQE 2NWFA 1SQVE 4OGQD 3DQYA 4HM5A 4NBCD 4P1CH 4NBFD 3GZYA 3H1KE 5KLVE 2HMJA 4AIVA 1NU1E 4HM3A 1O7PA 1ZRTE 3VCAA 1O7HA 2YFJA 1ULJA 2GBWA 1SQPE 2DE7D 4QDCA 4P1BH 2B1XA 1O7NA 1SJGA 1PP9E 2DE6D 1O7MA 2ZT9D 1O7GA 2HMKA 3L72E 2YFLA 3VMHD 1UUWA 1FQTA 2B24A 3FOUA 3BCCE 2XRXA 1RIEA 3C0DA 1NTKE 1G8JB 4HM1A 3D89A 2FYUE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EZV E;  4NB8 D;  2BMO A;  4HM2 A;  4HM0 A;  3GKE A;  2IBZ E;  2QJP C;  3H1I E;  3VCP A;  2QPZ A;  2E4Q A;  1BCC E;  4HJL A;  5KLI C;  1EG9 A;  3TGU E;  3AZC A;  3H1H E;  1ULI A;  1G8K B;  3GCE A;  2HMN A;  1VM9 A;  5AEW A;  3EN1 A;  3N0Q A;  4HKV A;  3GTE A;  2NVF A;  4EMJ B;  2E76 D;  1L0N E;  2NUK A;  1NDO A;  4QDD A;  1O7W A;  1UUV A;  4H13 D;  1Q90 C;  1SQX E;  5HL4 A;  3L73 E;  4HM8 A;  2E4P A;  3GB4 A;  4PV1 D;  3GL0 A;  4NBE D;  5CXM A;  2JO6 A;  1BE3 E;  1L0L E;  4HM4 A;  2BMQ A;  4QDF B;  2CKF A;  4U3F E;  4NBB D;  4QDF A;  3GTS A;  4QUQ A;  2YIU C;  4NBD D;  4QUR A;  2HMO A;  1JM1 A;  4D6T E;  3CXH E;  1KYO E;  2DE5 D;  1RFS A;  1VCK A;  2YFI A;  1VF5 D;  2Q3W A;  2XSH A;  3VMG D;  4PD4 E;  5KKZ C;  5AEU A;  1KB9 E;  2E75 D;  2HMM A;  3VMI D;  2BCC E;  2I7F A;  2NVE A;  2XSO A;  2NUM A;  4NB9 D;  3EQQ A;  1SQB E;  3GOB A;  4HM7 A;  3H1L E;  2XR8 A;  2ZYL A;  3CX5 E;  2YVJ B;  4NBA D;  1NTZ E;  1PPJ E;  1BGY E;  2QJY C;  5BOK A;  3L74 E;  3GZX A;  2E74 D;  2GBX A;  2HML A;  3L70 E;  4NBH D;  3H1J E;  3L75 E;  4H0L D;  4QUP A;  4AAY B;  2NVG A;  1WQL A;  2JZA A;  3CWB E;  3L71 E;  2A06 E;  2BMR A;  3GL2 A;  2FYN C;  1NYK A;  4NBG D;  4QCK A;  1NTM E;  1P84 E;  4HM6 A;  4H44 D;  2D2C D;  2QJK C;  1SQQ E;  2NWF A;  1SQV E;  4OGQ D;  3DQY A;  4HM5 A;  4NBC D;  4P1C H;  4NBF D;  3GZY A;  3H1K E;  5KLV E;  2HMJ A;  4AIV A;  1NU1 E;  4HM3 A;  1O7P A;  1ZRT E;  3VCA A;  1O7H A;  2YFJ A;  1ULJ A;  2GBW A;  1SQP E;  2DE7 D;  4QDC A;  4P1B H;  2B1X A;  1O7N A;  1SJG A;  1PP9 E;  2DE6 D;  1O7M A;  2ZT9 D;  1O7G A;  2HMK A;  3L72 E;  2YFL A;  3VMH D;  1UUW A;  1FQT A;  2B24 A;  3FOU A;  3BCC E;  2XRX A;  1RIE A;  3C0D A;  1NTK E;  1G8J B;  4HM1 A;  3D89 A;  2FYU E; 
#chains in the Genus database with same CATH topology
 2PGD A;  3HUS C;  4BRY A;  2Q5U A;  1SQQ G;  2B9B A;  2Q3E A;  2H8P D;  2N1T C;  3H1I J;  3IN6 A;  1NTK D;  1W2E A;  3TNU B;  1VF5 B;  1SQX D;  1HWT C;  5AVY B;  1FE6 A;  4H0L C;  4H13 D;  3ABV C;  3Q1M A;  1SQX J;  2HPC B;  4ZMD A;  1L0L E;  2WVR A;  3HE5 B;  2XU6 A;  1LTI C;  4NBD D;  1D7M A;  1T3J A;  1S3J A;  1R5S A;  3B71 A;  3TF5 A;  2Y0E A;  3R4Y A;  2IBZ I;  3WUV A;  1PV3 A;  1LP1 A;  2O1K A;  2YKP A;  3EQ2 A;  4I1L A;  3L70 E;  4D6T D;  1USD A;  4DJG A;  1NTM D;  1NAY A;  3H1J E;  1BGY G;  4H0L D;  3TDK A;  4R4L A;  1KB9 D;  2W6B A;  1VDF A;  2HOD A;  3L71 E;  3PHL A;  4K3A A;  2P2U A;  3RK3 E;  1NTM J;  4IOI H;  4C7N A;  3CWB G;  1RE3 C;  1YJN P;  1S2E A;  2QVA A;  3MHV A;  3CD6 P;  1Q81 Q;  4PJ0 H;  3FXE A;  4XA4 A;  3AEE C;  2N1T B;  4Z1M H;  1J2J B;  1G8J B;  3L72 G;  2YMY A;  2FYU E;  2W6A A;  4NPE A;  4TLF A;  1MKM A;  1K04 A;  2FYZ A;  4PD4 I;  3D70 A;  2E4Q A;  3SWK A;  1LTB C;  1MZ9 A;  2L91 A;  2WT7 A;  1A02 J;  1ZR2 A;  3KZI E;  2NVF A;  3RK2 C;  3PLN A;  2OQQ A;  2RH0 A;  4PV1 D;  4GT1 A;  3L73 J;  1URQ A;  3N7N A;  2WPS A;  3AEC C;  3GTS A;  4QUR A;  5AW9 B;  3JCU H;  1HGV A;  2JDI H;  2E75 D;  1GW3 A;  1KIL D;  5AW0 B;  1FOS E;  2LXC B;  1H0T B;  3MGN A;  3CX5 E;  4EI2 A;  1LTA C;  1BGY E;  2QJY C;  1HTL C;  2KZJ A;  3RL0 C;  2WPR A;  3TSI A;  5KAF E;  1JB0 J;  4OGQ C;  1KFM A;  3CWB E;  3M9B A;  4NBG D;  2FFD A;  4U3F G;  2V7Q J;  3AED C;  2XDJ A;  3H6P A;  3VMA A;  3CLQ A;  4AUW A;  4WY4 C;  3R2P A;  1BSN A;  1OMI A;  5GTH H;  2DE7 D;  1UII A;  2KI7 B;  1SVF A;  5CBN A;  3L72 E;  1LTJ B;  1KN7 A;  1FZA A;  3AEG C;  4TT3 H;  3CCJ P;  1Y9B A;  1RQU A;  3PH0 A;  3GLM A;  3IFM A;  3CXH I;  1L0L K;  4HM0 A;  2KNC A;  1QVF O;  5AW7 B;  1SFC D;  3C1L A;  2E42 A;  1OVU A;  2ZFC A;  4WY4 D;  3EN1 A;  1AVY A;  5TIS E;  3HUS A;  2ZVN B;  2IX7 C;  1IZN B;  2W8Z A;  1P84 I;  1JEK A;  3AE8 C;  1L0L J;  2H7H A;  1LJ2 A;  3O8Z A;  2YFI A;  2XNX A;  2QJY B;  1EZV I;  3RL0 B;  3H32 A;  2C0W A;  3HD7 B;  4N3Y B;  2Y9Z A;  4OGQ B;  3B5N B;  3L70 D;  2JO1 A;  3V2N A;  3H1J D;  2BCC G;  2KUB A;  2KS1 B;  3WU2 H;  2JWA A;  2RN0 A;  3H1L G;  2IYP A;  1KQS O;  5AVV B;  1RF1 C;  2A45 H;  3L70 J;  3RK3 D;  3A0B E;  3H1J J;  2JJL A;  4ASV A;  3ZDM A;  5B66 H;  5CCH C;  2MKV A;  1ZR4 A;  3L71 J;  2I1K A;  4LLH A;  4NPD A;  2NPS C;  2K88 A;  3A5T A;  1N73 A;  2FYU K;  3V2Q A;  3FX0 A;  1N7S D;  2QIW A;  1O7H A;  2AEF A;  1EDK A;  1SS1 A;  1YTZ T;  2A06 D;  2IDB A;  4IFM A;  4GDO A;  3SSU A;  4IL6 E;  3L36 A;  2W6J H;  1SQQ D;  1G1J A;  3TGU J;  1L4A B;  3P7K A;  2GM4 A;  2Z5H A;  3FOU A;  1H8A A;  4NPF X;  3D89 A;  3OA7 A;  1XTC C;  2I8D A;  1NOH A;  2FYU J;  1FJP A;  2Z4E A;  5CCH D;  1DIP A;  3HRN A;  1VQ8 P;  4HJL A;  5KLI C;  1W2B O;  5H2F H;  4ZKP A;  2OYI B;  2HMN A;  2E74 C;  3F89 A;  2WZ7 A;  2QSI A;  1RY3 A;  2ZYA A;  2ZYG A;  2AXT H;  2MJZ A;  1IO4 A;  1DD3 A;  4OWF A;  2PAJ A;  1K05 A;  2RMZ A;  3CI9 A;  1Q86 Q;  3KDP B;  1VQ9 P;  1Q90 D;  1LNQ A;  2KYV A;  3CX5 D;  1MFT A;  5AVX B;  2BCC E;  1BGY D;  3HTK B;  1IC2 A;  2SPZ A;  3SWY A;  1RF1 B;  3H1L E;  3PJS K;  1KB9 H;  2E74 D;  1KYO D;  3L75 E;  4BWN A;  3L73 G;  2KP8 A;  4JBZ A;  3VP9 A;  3L4F A;  2R5D A;  3CWB J;  1HBW A;  2ZT9 B;  1LT9 B;  2NWF A;  2Q3I A;  2O01 J;  4DZO A;  2YXQ B;  3H1K E;  1OX3 A;  5KLV E;  2YO3 A;  3QWO C;  2Q1K A;  3L72 D;  4P1B H;  3MUD C;  2JP3 A;  2QRX A;  2DE6 D;  1PGO A;  5GTI H;  4AQR D;  1SFC A;  1WMK A;  1SQB K;  2QM8 A;  2XZR A;  3LW5 J;  4WY4 A;  2OYH A;  4BRY B;  1YQ3 C;  3I55 P;  3CCL P;  2J58 A;  1YIT P;  1PGJ A;  5AVR B;  1ZP0 C;  3AZC A;  1KQL A;  1T2K D;  2R3C A;  1M57 D;  1SQB J;  2AEJ A;  3TK1 A;  3CPW O;  1KV4 A;  1LWU A;  3FXD A;  2R32 A;  1RE4 C;  1K9M Q;  2P7J A;  1VCK A;  4PD4 E;  2HMM A;  1L2P A;  5E79 E;  1LP1 B;  1IFD A;  4U3F D;  3NXS A;  3W68 A;  1N7S A;  2HOD B;  4QCK A;  2I1J A;  2JWD A;  1L0L G;  4C7N B;  3OJA B;  2D2C D;  2OAR A;  1NKN A;  2WMM A;  2YXR B;  2FFD C;  3AEB C;  3F5H A;  3HE4 A;  1EC5 A;  1RF0 A;  2WSE H;  5CCH A;  4XFJ A;  1NWQ A;  1SJG A;  4EOT A;  4JPZ B;  1GDT A;  1O7G A;  2YFL A;  5CCG D;  1RIE A;  1PP9 G;  4RJT A;  3L71 G;  5CJ0 A;  3VMX A;  3AEA C;  4UB8 E;  4JF7 A;  4GIF A;  2QJP C;  2WSC H;  2Y0D A;  2WT7 B;  3USS A;  4H13 C;  1HUC A;  2A45 I;  1GU4 A;  3CME P;  1ULI A;  4WBA A;  1KTM A;  3GTE A;  4EMJ B;  2G8Y A;  1L0N E;  2V4H A;  3TGU G;  1MFZ A;  3G4S P;  1URQ B;  3S4R A;  1SQP K;  4HKZ H;  2WIT A;  4YXD C;  3AE5 C;  3LID A;  2FYU G;  1FC2 C;  2YIU C;  2BCC D;  2G3A A;  3CXH E;  2KIK A;  1JO5 A;  2Q3W A;  2XSH A;  3H1L D;  4I2L C;  1FZG A;  5AEU A;  2YKO A;  1LTT C;  2QG4 A;  2BCC J;  5KLV K;  3H1L J;  3GZX A;  3D71 A;  2FKW B;  2WQY C;  1GU5 A;  2BEQ D;  1YYC A;  4N6J A;  3L75 J;  5CJ4 A;  2ZXX A;  2FFD B;  3GL2 A;  4N78 E;  1ZME C;  1P84 E;  4R4M A;  3JSV C;  4YTP C;  3II6 A;  2NRG A;  1PPJ D;  1HJ0 A;  3DQY A;  4NBC D;  5BVZ A;  3H1K J;  1O7P A;  1FU1 A;  5KLV J;  3A7O A;  1N73 C;  1X22 A;  5AW8 B;  2E76 C;  3KPE A;  1N8R Q;  1LT1 A;  2C9L Y;  4EIJ A;  1PP9 E;  1OW6 A;  2M8R A;  1PFI A;  3G6E P;  1G2C A;  3VTP C;  2QJP B;  4H13 B;  3M0A A;  2KNC B;  3KZI H;  2JEE A;  3RL0 g;  3MUD A;  3VCP A;  1KB9 I;  3T97 A;  3FGA D;  1YJW P;  3TGU E;  4HJG H;  3V4W A;  3KQG A;  1FDO A;  4PV1 C;  2LKM A;  3HUS B;  2M5A A;  2E76 D;  1U57 A;  1S9K E;  3VOP A;  1A02 F;  2YIU B;  3TYY A;  2E4P A;  2KLU A;  4IFD K;  1AQT A;  2E75 C;  4RES B;  1BE3 E;  1KIL C;  3BRV B;  3CX5 H;  4H0L B;  2O3J A;  4U7J A;  3H32 B;  5KAF H;  1M8O B;  1KC8 Q;  4K35 A;  3GOB A;  3L73 D;  2XR8 A;  3CCQ P;  3JC2 2;  1KYO H;  2OTL P;  5B5E E;  1SQB G;  2K1A A;  1RE4 A;  3SFD C;  1XTG B;  5APV A;  3L74 G;  1CI6 A;  3N4X A;  2ZXE B;  2ZVO B;  2W90 A;  1PGQ A;  1N73 B;  1SQV E;  4RO0 A;  4NBF D;  5CCG A;  2Y0C A;  1NU1 E;  3M9H A;  2OYO A;  3BRT B;  2B1X A;  4GOD A;  2UWJ E;  1L0N K;  3CCV P;  5TJH A;  1TU3 F;  3GW6 A;  1NTZ K;  1SFC C;  1S5L H;  1ZRT D;  3EFF K;  3A0H H;  2PRR A;  4NB8 D;  1MV8 A;  2OYH C;  4PV1 B;  3G9R A;  4QMA A;  2XV5 A;  2N9Y B;  3ITK A;  2NUK A;  2E75 B;  1YQ4 C;  1L0N J;  4I6M C;  3JCU E;  1NTZ J;  3I5C A;  1GK4 A;  1QL2 A;  3RBX A;  4NBB D;  2H43 A;  1FZE A;  2WSF J;  3LIE A;  3RK2 B;  3CC7 P;  1NYH A;  1LWU C;  1GTW A;  1QEX A;  1VQL P;  1SQB E;  1JUN A;  3A0B H;  1RQV A;  3RK3 C;  1L0L D;  1X79 B;  2Q7C A;  3L74 E;  4OVN F;  4N78 D;  4YPC A;  4QUP A;  4L74 A;  1S5L X;  1N7S C;  3BAS A;  5GTH E;  4XE5 B;  5KJ7 D;  4HM5 A;  1VQ5 P;  3AE4 C;  2XKM A;  1JMB A;  1VQ7 P;  1PP9 D;  3VN0 A;  1OFC X;  3L71 D;  1RF0 C;  4QDC A;  1L4A D;  5AW5 B;  1SFC B;  4M3L A;  3IAO A;  1PP9 J;  1SQP G;  1FQT A;  3L75 G;  4WY4 B;  2M3B A;  3GMA A;  3B8E B;  3BCC G;  3B4S A;  3NFQ A;  3TGU D;  3P8C E;  1BCC E;  3H1K G;  3OW2 O;  5KLV G;  4BXL A;  4JQ0 D;  2IBZ G;  4HKV A;  3AE6 C;  1JY2 P;  1Y8A A;  2FYU D;  1UUV A;  2L5G B;  1IJD B;  1H0T A;  1Q90 C;  4UB6 E;  1HF9 A;  3Q5R A;  5CXM A;  1LWU B;  2CKF A;  4HB1 A;  2HG5 D;  1BE3 J;  4QDF A;  1NJI Q;  2HMO A;  1PIX A;  1VQ6 P;  1IFN A;  3CCS P;  2WTY A;  4W7Z A;  1SQV K;  3PRJ A;  2ZYL A;  1SP4 A;  5BOK A;  1NU1 K;  3Q2Y A;  1KIL A;  4JYC A;  5B66 E;  1CZQ A;  1EQ7 A;  1FOS F;  5KTB A;  3GF3 A;  3AE1 C;  1JTH A;  1VQM P;  2BMR A;  5C39 A;  2J59 M;  3CCE P;  3G71 P;  4GOF A;  3D6Z A;  2JR8 A;  3HE4 B;  4P1C H;  1SQV J;  2KB7 P;  1FDM A;  3O6Q A;  4KHX A;  1EDJ A;  3VMZ A;  1NU1 J;  2YFJ A;  1ULJ A;  1SQP E;  3CWB D;  2NPS B;  2P1J A;  3CX5 I;  3H1H J;  2OGU A;  2FXM A;  4JYB A;  5CBO A;  3BCC E;  1NTK E;  1X9V A;  2LR2 A;  1T2K C;  1GW4 A;  1KYO I;  2OTK E;  4KT0 J;  3GKE A;  2IBZ E;  2QPZ A;  2ZYD A;  5DJT B;  3M0D A;  2AXT E;  1ZW0 A;  1X8Y A;  2ITA A;  1M1J C;  4L75 A;  3Q3D A;  1FDI A;  3EFG A;  1NDO A;  1FZF A;  3CCM P;  3MIW A;  5KLI B;  1Q7Y Q;  1QGK B;  4NBE D;  1FZB A;  1J1E C;  2J5U A;  2E74 B;  5E79 H;  1Y47 A;  1J1D C;  4D6T E;  1RFS A;  1SQB D;  4B86 A;  1KB9 E;  2C0X A;  4EDF A;  3L74 D;  4I7Z C;  4Y99 C;  2YVJ B;  1WT6 A;  4KJM A;  1L0N G;  3L74 J;  4HYT B;  2D2C C;  2BEZ F;  1GL2 C;  5BU8 B;  1NTZ G;  2LXB A;  2R3S A;  3QH9 A;  2FYN C;  2O1J A;  1NYK A;  5AW4 B;  3GHG A;  3A2A A;  4H44 D;  1VL2 A;  3AE2 C;  1R5L A;  3C9I A;  2WWW A;  1K8A Q;  1E5W A;  5KAI H;  5AVW B;  2V7Q H;  2KSE A;  1FAV A;  3VMY A;  5CCG C;  1OZH A;  1E79 H;  1NAF A;  1S4X A;  1O7M A;  2HMK A;  1G2C B;  4GKG A;  3VMH D;  1JY3 O;  1GL2 D;  1ZOY C;  5AVT B;  1VF5 C;  4C7R A;  1QX8 A;  1NKZ B;  3D6Y A;  5AW3 B;  3T97 B;  2IFN A;  1EZV G;  1FZC A;  1BCC J;  3GCE A;  2GUS A;  2KSJ A;  2W27 A;  2E5Y A;  2IZ0 A;  1DD4 A;  5AVZ B;  3KXD A;  1O7W A;  1FBM A;  3AE9 C;  3VP8 A;  3GL0 A;  2JO6 A;  1M90 Q;  4RKU J;  2YMK A;  3BAT A;  4Y99 B;  1VQP P;  3MZW B;  1VF5 D;  2KLV A;  5KKZ C;  1DEE G;  3Q5P A;  2NVE A;  2D2C B;  3V2P A;  1NTZ E;  3EWK A;  2FY8 A;  1RH5 B;  2GBX A;  1X0T A;  1Q2N A;  1ZXG A;  2K9J A;  4WWI A;  1N2D C;  1CI6 B;  4LC1 A;  1GK6 A;  1OVR A;  3GF7 A;  1EDI A;  1BE3 G;  1KFN A;  1NTK K;  1SQX K;  5APQ A;  3GZY A;  2Q6Q A;  3WUU A;  1SQP D;  4AIV A;  1AFO A;  3L75 D;  3V6I A;  2B89 A;  2KK7 A;  1IK9 A;  1N7L A;  5AVS B;  1SQP J;  1O7N A;  3BCC D;  1AJY A;  1LTS C;  1IFP A;  1GZL A;  1BDD A;  1IK7 A;  3H1K D;  5KLV D;  3KYQ A;  5APY A;  3BCC J;  2IBZ D;  1NTK J;  2DW3 A;  1EZV E;  4DOJ A;  4IFF A;  4HM2 A;  5APT A;  4HH2 A;  1EXI A;  1SQV G;  1UIX A;  1Z56 A;  3U1C A;  1NTM K;  1NU1 G;  1ZV8 A;  1YTZ I;  1G8K B;  2N1T D;  2YNY A;  3H1H G;  5CHX A;  4QDD A;  3V2R A;  2JKV A;  2H89 C;  1QVG O;  5KKZ B;  3PTZ A;  2QA4 P;  2HR3 A;  1YI2 P;  4A7P A;  1M1J A;  1OXZ A;  4ZKU A;  1T6A A;  3V4Q A;  5B5E H;  4D6T J;  4OH8 B;  2I7F A;  2NUM A;  3OAK A;  1YHQ P;  3MTU E;  4HM7 A;  1FJK A;  2WPV B;  2ZAE B;  4NBH D;  2B87 A;  4PD4 D;  2P10 A;  5K5G B;  2A06 E;  4GOE A;  1T8Z A;  4WVZ A;  1HJB A;  1JY3 P;  2QJK C;  1SQQ E;  1JY2 O;  1H89 A;  1SLQ A;  4L73 A;  1LTJ C;  1DH3 A;  5BU5 A;  1GL2 A;  2PP6 A;  3M9Q A;  2O01 H;  3E7K A;  3S9O A;  1OWA A;  2QEX P;  2FBW C;  3PP5 A;  3A3Y B;  1KMI Z;  2AEM A;  1UUW A;  2E76 B;  5L8R J;  4PJ0 E;  3LW5 H;  4MN4 C;  3H1H E;  1DX7 A;  4LGD E;  3TNU A;  3M0D C;  3C8V A;  1T3U A;  2YO2 A;  5HL4 A;  1G1I A;  1OVV A;  2WPQ A;  3HD7 C;  4QDF B;  4HM4 A;  5APW A;  1IFM A;  3RK2 D;  5TIS H;  2HPC A;  3B5N C;  3HE5 A;  1MUU A;  1KYO E;  5APU A;  1L0N D;  3FWL A;  2IPP A;  1NTZ D;  1JCD A;  4WB4 A;  1BCC G;  2Q9I A;  1M1K Q;  1KIL B;  2HFE D;  2R44 A;  3CXH D;  2QJK B;  3U59 A;  5KJ7 C;  1JTH B;  2B88 A;  4W80 A;  1WQL A;  2JZA A;  1ZN5 A;  3MP7 B;  3RL0 D;  1CW5 A;  2KOG A;  3HD7 D;  2CPS A;  1KOR A;  2WSE J;  3K5B A;  2WSS H;  4OGQ D;  3B5N D;  3GHG C;  1L4A C;  3O6Q B;  1N86 A;  3G3Z A;  2HMJ A;  1NH4 A;  3VCA A;  2A45 G;  2GBW A;  1AVO A;  1USE A;  1P84 D;  1S5L E;  3A0H E;  1JY3 N;  2K3R A;  1JOC A;  1PL5 A;  1S1C X;  1EZV D;  3C0D A;  2QM7 A;  1R8E A;  2XND H;  4IL6 H;  2OYI C;  2N1T A;  5AW1 B;  2WSC J;  4CPG A;  5AVQ B;  2BMO A;  2M3E A;  2HLO A;  1JCC A;  1PGP A;  1YBK A;  4UB6 H;  3FWN A;  3H1I G;  1PZQ A;  5AEW A;  1FZC C;  3H25 A;  2OYH B;  3NMD A;  2OTJ P;  1GD2 E;  2ZJS E;  4HM8 A;  1NTK G;  4U3F E;  1SQX G;  2GUV A;  4QUQ A;  1QLE D;  4Y28 J;  1YIJ P;  2Y9Y A;  4ZNC A;  3VMG D;  1SQQ K;  2QE7 H;  1S9K D;  2K37 A;  1S72 P;  4NB9 D;  4O9B A;  1HVV A;  5AW6 B;  1BE3 D;  2IZ1 A;  2ZT9 C;  1HH0 A;  1LT9 C;  1VQ4 P;  1IFI A;  4DT0 A;  2VRS A;  1QL1 A;  3M91 A;  1PPJ G;  2Z5I A;  3L35 A;  2E43 A;  1ZLL A;  4C46 A;  3GHG B;  4IL6 X;  3RK3 B;  5APS A;  1RE3 A;  3WU2 E;  4D6T G;  1SQQ J;  1NTM G;  4EYY Q;  2BAS A;  1DEB A;  2R5B A;  1N7S B;  2NPS D;  3RBZ A;  1U7J A;  3I56 P;  1JMM A;  3WMM 0;  2ZT9 D;  5EFW B;  1SQV D;  3AE7 C;  1HGZ A;  2XRX A;  1LTJ A;  3S1K A;  1NU1 D;  3CL3 D;  5CMZ A;  3H1H D;  3H1I E;  3SWF A;  1U7M A;  1FZC B;  3RGU A;  3P32 A;  1EG9 A;  2CPB A;  1VQO P;  3BVH A;  2IFM A;  1KQF B;  1LTG C;  1SQX E;  1M56 D;  1NHL A;  1EDL A;  1BGY J;  3P8M C;  3GB4 A;  5H2F E;  2IYO A;  1VPC A;  3M06 A;  1NGM B;  3KHU A;  3IF4 A;  3U1A A;  2GA1 A;  1W5C E;  1AQ5 A;  2DE5 D;  3L37 A;  5DJU B;  3VMI D;  2XSO A;  3HD7 A;  1RHZ B;  2P58 A;  4L76 A;  4NBA D;  3V5B A;  1PPJ E;  1M7L A;  1GMJ A;  1EXJ A;  3B5N A;  2K9J B;  4PD4 H;  3NTN A;  4YXW H;  4H44 C;  2KS1 A;  2P67 A;  2M0B A;  2CK3 H;  2NVG A;  1JY2 N;  1NTM E;  1OIP A;  4HM6 A;  1K73 Q;  3L72 J;  2K9Y A;  3AE3 C;  5KJ7 A;  3AEF C;  1VQK P;  2KZI A;  1BSH A;  1Q82 Q;  1BDC A;  5APX A;  1L4A A;  3MD0 A;  3UIA A;  2FXP A;  2E5T A;  3SFE C;  3CC2 P;  4HM1 A;  1H88 A;  1CSB A;  5AVU B;  5GTI E;  1WRG A;  4DCK A;  4AYC A;  3CCR P;  1URQ C;  1LGH B;  1VM9 A;  4UB8 H;  2FXO A;  3N0Q A;  2AXC A;  2OYI A;  1JM0 A;  3CCU P;  1FS0 E;  3IR9 A;  2N9B A;  3L73 E;  3P8C D;  1YJ9 P;  2NZ2 A;  1BCC D;  2PFX A;  5AW2 B;  2BMQ A;  1M1J B;  4U3F J;  1JNM A;  1JM1 A;  1OW7 A;  1IFJ A;  4W7Y A;  3E1R A;  2KXP B;  2M5A B;  4H44 B;  2WSF H;  3EQQ A;  1J1E B;  3VYI A;  3HTK A;  1URQ D;  3CXH H;  1RF1 A;  1J1D B;  1KIL E;  2C9N Y;  3CC4 P;  2HML A;  1AV1 A;  2B87 B;  2YKQ A;  4AAY B;  4I7Z B;  1OW8 A;  2NPS A;  5KAI E;  2O01 N;  3L70 G;  3H1J G;  1KQG B;  3W67 A;  1LT9 A;  1GL2 B;  2W83 C;  2HYN A;  1P84 H;  4HM3 A;  3Q5S A;  1ZRT E;  2FYN B;  3CMA P;  2RKL A;  2POH A;  1VQN P;  1KZU B;  1AA0 A;  3GG2 A;  2H88 C;  3WUT A;  1NO4 A;  2B24 A;  3E1I A;  4ASW A;  1KD1 Q;  1NVO A;  2A06 G;  5M1B A;  3H1I D; 
#chains in the Genus database with same CATH homology
 1EZV E;  4NB8 D;  2BMO A;  4HM2 A;  4HM0 A;  3GKE A;  2IBZ E;  2QJP C;  3H1I E;  3VCP A;  2QPZ A;  2E4Q A;  1BCC E;  4HJL A;  5KLI C;  1EG9 A;  3TGU E;  3AZC A;  3H1H E;  1ULI A;  1G8K B;  3GCE A;  2HMN A;  1VM9 A;  5AEW A;  3EN1 A;  3N0Q A;  4HKV A;  3GTE A;  2NVF A;  4EMJ B;  2E76 D;  1L0N E;  2NUK A;  1NDO A;  4QDD A;  1O7W A;  1UUV A;  4H13 D;  1Q90 C;  1SQX E;  5HL4 A;  3L73 E;  4HM8 A;  2E4P A;  3GB4 A;  4PV1 D;  3GL0 A;  4NBE D;  5CXM A;  2JO6 A;  1BE3 E;  1L0L E;  4HM4 A;  2BMQ A;  4QDF B;  2CKF A;  4U3F E;  4NBB D;  4QDF A;  3GTS A;  4QUQ A;  2YIU C;  4NBD D;  4QUR A;  2HMO A;  1JM1 A;  4D6T E;  3CXH E;  1KYO E;  2DE5 D;  1RFS A;  1VCK A;  2YFI A;  1VF5 D;  2Q3W A;  2XSH A;  3VMG D;  4PD4 E;  5KKZ C;  5AEU A;  1KB9 E;  2E75 D;  2HMM A;  3VMI D;  2BCC E;  2I7F A;  2NVE A;  2XSO A;  2NUM A;  4NB9 D;  3EQQ A;  1SQB E;  3GOB A;  4HM7 A;  3H1L E;  2XR8 A;  2ZYL A;  3CX5 E;  2YVJ B;  4NBA D;  1NTZ E;  1PPJ E;  1BGY E;  2QJY C;  5BOK A;  3L74 E;  3GZX A;  2E74 D;  2GBX A;  2HML A;  3L70 E;  4NBH D;  3H1J E;  3L75 E;  4H0L D;  4QUP A;  4AAY B;  2NVG A;  1WQL A;  2JZA A;  3CWB E;  3L71 E;  2A06 E;  2BMR A;  3GL2 A;  2FYN C;  1NYK A;  4NBG D;  4QCK A;  1NTM E;  1P84 E;  4HM6 A;  4H44 D;  2D2C D;  2QJK C;  1SQQ E;  2NWF A;  1SQV E;  4OGQ D;  3DQY A;  4HM5 A;  4NBC D;  4P1C H;  4NBF D;  3GZY A;  3H1K E;  5KLV E;  2HMJ A;  4AIV A;  1NU1 E;  4HM3 A;  1O7P A;  1ZRT E;  3VCA A;  1O7H A;  2YFJ A;  1ULJ A;  2GBW A;  1SQP E;  2DE7 D;  4QDC A;  4P1B H;  2B1X A;  1O7N A;  1SJG A;  1PP9 E;  2DE6 D;  1O7M A;  2ZT9 D;  1O7G A;  2HMK A;  3L72 E;  2YFL A;  3VMH D;  1UUW A;  1FQT A;  2B24 A;  3FOU A;  3BCC E;  2XRX A;  1RIE A;  3C0D A;  1NTK E;  1G8J B;  4HM1 A;  3D89 A;  2FYU E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...