1SQXE

Crystal structure analysis of bovine bc1 with stigmatellin a
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
total genus 45
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2004-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1sqxE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1sqxE02
1SQVE 2BCCE 2E4PA 3EQQA 4NBAD 4QURA 2DE6D 3VMID 3H1JE 2HMMA 2QJYC 4QCKA 3CWBE 1VF5D 4QDCA 1PPJE 4HM5A 1UUWA 3GTSA 4QDFB 3H1LE 3C0DA 1NTZE 2NUKA 2A06E 1VCKA 3H1KE 3BCCE 1ULJA 3D89A 2FYUE 2E76D 4HM0A 1EZVE 4NB9D 1O7MA 3CX5E 4HM7A 1NTKE 3L73E 5KLIC 3CXHE 1O7GA 4HM1A 3L75E 1SQQE 4NBBD 1PP9E 4NBDD 1SQXE 2ZYLA 4HJLA 2HMOA 4HM8A 2CKFA 1RIEA 3L74E 3GZYA 3N0QA 4NBGD 4P1CH 1KB9E 1EG9A 3VMHD 2E74D 2JZAA 2GBWA 2DE7D 4NBHD 4NB8D 1ZRTE 2BMQA 2QPZA 3GTEA 5HL4A 4H44D 3H1IE 1VM9A 5BOKA 1L0NE 4HM2A 5KLVE 2B1XA 1BCCE 3L72E 1G8JB 2D2CD 2YVJB 2NVFA 1NDOA 3DQYA 4PD4E 1RFSA 3L71E 1P84E 3VCAA 4HM6A 5AEUA 1NTME 1BE3E 4NBED 1O7NA 3GB4A 2DE5D 4HM3A 2NVEA 2E75D 2QJPC 5CXMA 4U3FE 2B24A 2XRXA 3H1HE 4H13D 1JM1A 5KKZC 4P1BH 1ULIA 2YIUC 3GKEA 3VCPA 4AIVA 2HMKA 2IBZE 1L0LE 4QDFA 2YFLA 1SJGA 2QJKC 3FOUA 2HMLA 1BGYE 4HM4A 2HMNA 2FYNC 1NYKA 4NBCD 3AZCA 3VMGD 3GCEA 4EMJB 1SQPE 1O7PA 3GZXA 1NU1E 4OGQD 4NBFD 3GL0A 1FQTA 2XR8A 2HMJA 3GOBA 4QDDA 4D6TE 1WQLA 2I7FA 2BMRA 2ZT9D 2YFJA 3TGUE 2BMOA 2E4QA 2XSOA 2Q3WA 2NVGA 2YFIA 2NWFA 2NUMA 3GL2A 1KYOE 4QUQA 4AAYB 1O7HA 2XSHA 3L70E 1Q90C 4HKVA 1UUVA 1O7WA 1G8KB 4PV1D 2GBXA 4QUPA 3EN1A 4H0LD 1SQBE 2JO6A 5AEWA
chains in the Genus database with same CATH superfamily
3VMAA 3HD7D 4QURA 3PJSK 1NGMB 3CWBE 4CPGA 1FZFA 1PGJA 1FJPA 1NTZE 4HM0A 2R32A 1WRGA 1J1EC 3BRTB 3HE4A 1T3UA 2WITA 3CC7P 3IFMA 1SFCC 3L4FA 2SPZA 1S9KE 3E7KA 3GG2A 1SQQK 2A06D 3H32A 1HVVA 2BMQA 1RE4C 2AEFA 3RBXA 2HFED 3G9RA 3NXSA 1W5CE 3A0BH 1ZXGA 1SP4A 4EOTA 3OJAB 3P8CE 5AVRB 1MFZA 2AEJA 5B66E 1QLED 4AQRD 4HM3A 1KQSO 4WY4D 4U3FE 4MN4C 1LWUA 2QM7A 1AVYA 4U3FG 1URQD 2W90A 3V2QA 2E75B 1NYHA 2JDIH 2LXBA 3N7NA 1VQ7P 2HMNA 4EMJB 3GCEA 3KXDA 1VQNP 2WPRA 3G4SP 4N78D 1DEEG 2KB7P 2I7FA 1FS0E 3H1JJ 3MGNA 1JB0J 2RKLA 3HD7B 2XZRA 1IK7A 4DJGA 2XSHA 1R5LA 3E1RA 1O7WA 3L37A 3CCUP 3H1ID 3L74J 1QEXA 5AEWA 1KQLA 1L0NK 2DE6D 2BEZF 4QCKA 1RE4A 3FXEA 1HTLC 1PGPA 3LIEA 1BCCJ 3D89A 1PPJD 2D2CC 2KNCB 3M91A 1N73C 1FDIA 4EDFA 5APVA 4HM8A 3KQGA 3L74E 1GU4A 1YJ9P 1L4AA 1WT6A 2FYUK 1LTSC 1ZRTE 1EQ7A 1MKMA 5AW3B 5TISH 1GL2A 1YBKA 4HM2A 1GW4A 2N1TD 1G2CB 2FFDB 3V6IA 1L0ND 4NBED 2KSJA 1N86A 1FBMA 1NKNA 5CXMA 2Y0EA 1JM1A 2BCCG 3EFFK 2OYOA 2P1JA 3PTZA 3HTKB 2QJKC 4IL6E 5B66H 2YXQB 3GZXA 4QDDA 1NTKK 3AEBC 3AEFC 5AVYB 5AVTB 4ASWA 1E79H 1RE3C 2YMKA 5CMZA 1VQ9P 2NWFA 2HODB 1K9MQ 3GL2A 2WT7B 2FY8A 1OVVA 1YI2P 1FE6A 4W80A 1EC5A 3V2PA 2KUBA 2K3RA 1LGHB 1SQQG 3RL0B 2HMMA 4RESB 5KTBA 3AE2C 3PLNA 2WQYC 4I7ZC 3FXDA 4I6MC 1GL2C 3CD6P 1ULJA 2E42A 3M9BA 4PV1B 3CLQA 3Q5PA 2O01N 4HJLA 4TLFA 2K9JB 3CX5I 1HBWA 2M8RA 2GUVA 2E74D 3EQ2A 3WUVA 4NB8D 3W67A 2NPSA 3PH0A 1VM9A 2IFNA 1YITP 2NPSD 3VCAA 4PD4E 4DCKA 2H89C 3ZDMA 5TISE 1NTZG 1VQ6P 2NVEA 1QL1A 3D6YA 2HR3A 2Q9IA 4LC1A 3P7KA 1RE3A 2G8YA 2W27A 4PD4D 2R3SA 4OGQC 3O6QA 3AE9C 3HTKA 2B87A 4L75A 3FOUA 1FAVA 1H89A 2OYIC 4C7NB 3P8CD 1NJIQ 1VQ5P 1OVRA 2FYUD 2O1KA 4OGQD 1LTGC 2Y9YA 5APYA 5CBOA 5KJ7C 3FWNA 3FX0A 1HJ0A 1LWUC 3TGUE 1NTZJ 3VTPC 3L72G 4PJ0H 4JPZB 3Q2YA 1GL2B 1JNMA 2IX7C 1SQPG 3O8ZA 4PD4I 3GLMA 1Z56A 2Y0DA 1FOSE 2E4PA 1S2EA 2I1JA 3TGUJ 3A2AA 5E79H 2R44A 2M3BA 3H1KE 1JM0A 1NTMK 1NU1K 3L70J 4Z1MH 4UB6H 4JYCA 4U7JA 4OWFA 5CCGD 4P1CH 1Q2NA 2MJZA 2N9BA 2QJKB 1IFMA 5KAFH 4OVNF 2JEEA 4IFDK 3WUTA 4K35A 3RL0g 1MZ9A 2B1XA 2OYIA 1YQ4C 2HG5D 3M0DC 1L4AC 2QJPC 2ZYDA 5KJ7A 1KMIZ 2KNCA 5AW1B 5BU8B 1OZHA 3R2PA 1PIXA 3L70D 1IFIA 2FXMA 3L72D 1NKZB 4M3LA 1JCCA 4NBCD 3RK3B 1K05A 2JWDA 3CMAP 4WY4B 1NU1E 5APWA 2RMZA 1YTZI 4WWIA 2BCCJ 3USSA 1NAYA 3CX5H 1IJDB 2HYNA 3L73J 5CCHC 4YPCA 2WSEH 2V7QJ 2E74C 1JTHA 1P84D 1JY2O 5DJUB 3PHLA 1NU1J 1ZRTD 3A7OA 3CMEP 5KLVK 4DT0A 3H1JE 3AECC 3MIWA 4QDCA 2NUKA 3AE1C 4Y99C 2A06G 3AE6C 2FYUE 1AVOA 4C7NA 1O7MA 3AE8C 3L71J 3L71G 1NTKE 5KLIC 3CCMP 3Q5RA 3CXHE 1SQQE 1KYOH 1Y8AA 2HMOA 1EZVI 3TF5A 4OGQB 3HUSB 1JCDA 1KN7A 4BRYA 3H1IE 5BOKA 1URQB 1SQXG 1G8JB 2KS1A 1PZQA 2B89A 1Y47A 3L71E 1P84E 2E76B 2OGUA 5AW0B 4HB1A 1N2DC 1J1EB 1PPJG 4HJGH 2VRSA 1MUUA 2KK7A 2K1AA 1X22A 4I2LC 3M9QA 2NPSC 4AIVA 3F89A 1SJGA 5H2FE 3VP9A 1WMKA 1SLQA 3S4RA 3VN0A 5CCHA 5KLVJ 1OW8A 1Q7YQ 3CCSP 1H0TB 1FOSF 1NTMJ 1BGYD 2E4QA 4R4MA 2KZJA 3E1IA 3L70G 5KLVG 2WZ7A 1IC2A 3V4WA 2LXCB 2DW3A 1HWTC 3UIAA 4QUPA 1EDKA 2IZ0A 2N9YB 3I55P 2G3AA 1H88A 4H0LB 3Q1MA 1L0LK 3CCJP 3WMM0 4PD4H 1LP1A 1FZCB 1YHQP 1FC2C 3CCEP 3WUUA 1SQBG 1CW5A 3HE4B 2ZJSE 4EI2A 1VL2A 1NVOA 1KILD 4H13C 3GW6A 5KJ7D 2Z4EA 3SSUA 3II6A 1VQPP 3L35A 3CX5D 3OW2O 1SQXD 3VMHD 2R5DA 3HRNA 1ZV8A 2WWWA 1AA0A 2JO1A 1KB9H 2YO3A 1J1DC 3TNUB 5AVVB 1NH4A 3GB4A 4PJ0E 1JY2P 2FXPA 1IK9A 3H6PA 1E5WA 3GKEA 4QDFA 3MP7B 4WVZA 2HMLA 3AEAC 2B9BA 1SQPE 3B8EB 1Q81Q 1IFPA 4NBFD 3L36A 1VPCA 3F5HA 3M0DA 1KORA 3C9IA 2O1JA 5KLIB 1FZCC 3RK2D 3H1KJ 4H44B 1JMMA 3L74G 2GM4A 2M0BA 1IFDA 1G8KB 2QRXA 4H13B 1RF1B 2IBZG 5AVUB 1JUNA 1M8OB 1P84I 2FKWB 3P32A 1OIPA 1FDOA 2CPBA 5GTHH 4H44C 3H1LD 1CI6B 1NTMG 1EZVE 5AW8B 4HM7A 3R4YA 3CXHI 2KYVA 4AYCA 1S5LE 2KLUA 1SQXE 4ZNCA 3H1IG 1ZLLA 4U3FJ 1YTZT 2UWJE 4U3FD 3KPEA 2E75C 2CPSA 2OYIB 1EDJA 1NTZD 1SQVD 3L75G 1ZR2A 1U7JA 3VMXA 3OA7A 5TJHA 4KJMA 4D6TD 5BU5A 1AQ5A 4YXDC 3IAOA 3D70A 2V4HA 5KKZC 3H1HG 4NPDA 1FDMA 3BVHA 1FZCA 1NTZK 2B88A 1PL5A 5APTA 4IFMA 3FGAD 1BGYE 3BRVB 3L72J 3GHGB 2XDJA 4DOJA 1RF1C 3V2RA 3CC4P 1WQLA 1XTGB 2FXOA 3PP5A 4PV1C 2JJLA 5GTIE 2O01H 1KYOE 3SWFA 2MKVA 1NTKJ 5KAIE 1LTJB 1YQ3C 1KC8Q 1BGYJ 1SQQJ 3EN1A 1PP9J 2PGDA 1SFCB 2BCCE 5AVSB 2WSFH 1VF5D 1VQMP 1EZVD 5CCGA 1HGVA 1VF5C 1JY3P 5AW6B 1EXJA 3L73E 1HJBA 2QEXP 1LP1B 3RGUA 1PP9E 5CJ0A 4ZMDA 1MV8A 3AEGC 1KD1Q 5GTHE 1UIIA 2YKQA 2J59M 5H2FH 2Z5HA 3BCCD 3OAKA 3L73D 2M5AB 2NPSB 4BRYB 2XNXA 4W7ZA 3EFGA 3RL0C 5KLVE 4OH8B 2KOGA 4JYBA 2FYUJ 2D2CD 3LW5H 3N4XA 1OXZA 1L2PA 1RF1A 1X0TA 4NPEA 1GK6A 1N8RQ 3H1KG 5CHXA 2KZIA 1FZAA 3IN6A 1FZBA 3Q3DA 2H8PD 2OQQA 2YO2A 1YJWP 3SFEC 3AE4C 1MFTA 2E43A 1BE3G 3H1IJ 3KZIH 2FYNC 4A7PA 1AFOA 2L5GB 3GL0A 4I7ZB 1K73Q 2FBWC 2OYHB 4RJTA 3VMZA 3M0AA 2NUMA 2YNYA 3CI9A 1DD3A 3GF7A 1L0LD 1UUVA 1IFNA 1R8EA 3Q5SA 2YIUB 1GW3A 3H1LG 3KDPB 4LGDE 3CCLP 3MHVA 5KAIH 3U1CA 1EXIA 3JCUE 1N7SC 2A06E 2ZYGA 2N1TB 1U57A 4GOFA 1VDFA 2ZT9C 1RIEA 3N0QA 1NHLA 3RK2C 4H0LC 2AXTE 2A45I 5HL4A 4H44D 1L0NE 3A3YB 2FFDA 1NDOA 5AVWB 1OMIA 2JR8A 1FZEA 1OVUA 5AEUA 2QVAA 4KHXA 3W68A 1FJKA 2HPCA 2BASA 2E75D 1N73B 1SQBK 1NTKG 3M9HA 5M1BA 3TGUD 2M3EA 1L0NJ 1K8AQ 5CBNA 1FQTA 3CCVP 2AXCA 4IL6H 2I8DA 3KZIE 1QVFO 1T8ZA 2Q3WA 3BCCJ 3CL3D 3SFDC 1N7SA 1DX7A 4B86A 4QUQA 1USDA 1GL2D 2A45H 1G2CA 4HKVA 1RH5B 3TYYA 1SQBD 3EWKA 2Y9ZA 2B87B 4D6TJ 3V4QA 1ZOYC 4QDFB 3BCCE 3CXHD 4WBAA 3V5BA 1L4AB 2QJPB 3GHGA 3TDKA 4NBBD 4TT3H 1YJNP 1CSBA 2BCCD 2DE7D 5CCGC 3GTEA 3KYQA 3L72E 3GF3A 2AXTH 1LT9A 4K3AA 1QGKB 1BE3E 3B4SA 1DH3A 2Q1KA 4GT1A 5APUA 2YIUC 2IBZI 1BDCA 2YFLA 3BCCG 3O6QB 1PV3A 1OWAA 2OTLP 4HKZH 2QIWA 2ZXEB 1SQPK 1HF9A 1VQKP 1ZMEC 3I5CA 5EFWB 3CWBD 4N3YB 2WT7A 2YFJA 3AEDC 2IPPA 2N1TC 5AVZB 1USEA 3B71A 5CJ4A 3QH9A 1O7HA 1KILB 1BCCD 3L75J 3B5NA 3GHGC 4H0LD 2Q5UA 3T97B 2JO6A 2HPCB 3CC2P 1LNQA 4JBZA 3EQQA 1BE3D 2LKMA 1H8AA 3VMID 3TSIA 2E76C 2IYOA 1G1JA 1M1KQ 1YYCA 1KB9D 5AW7B 1Q82Q 3WU2E 3K5BA 2ZFCA 4IFFA 4HM1A 3L75E 2H88C 4L74A 1L0NG 3RK3E 3GZYA 1JMBA 1KFMA 2ZXXA 2GBWA 4NBHD 2C0WA 1KTMA 1NTKD 3CWBJ 4L73A 2IBZD 2NVFA 2K88A 5KAFE 1BGYG 1NTME 4IL6X 2DE5D 4EYYQ 1AQTA 3HUSC 1EDLA 3H1HE 4UB6E 2FYZA 1OX3A 5CCHD 4P1BH 2C9LY 3SWYA 1ULIA 1SQVK 3PRJA 1S3JA 2HMKA 2IBZE 1IFJA 1LT1A 2W6AA 1KFNA 2RN0A 3CWBG 4ASVA 1NYKA 2FFDC 1A02F 3B5NC 1GU5A 2P67A 2HMJA 2Q3IA 2P7JA 2KIKA 3B5ND 1JOCA 2YMYA 3ABVC 1KQFB 5KLVD 4N6JA 2J5UA 2WPVB 2LR2A 1RHZB 3LIDA 4ZKPA 3RL0D 3A0HE 1PP9D 4QMAA 4R4LA 1GD2E 1X8YA 4HYTB 5AW5B 2QJYC 3H1JG 1ZN5A 4RKUJ 1CI6A 1H0TA 4NB9D 3CX5E 1FU1A 1J1DB 4DZOA 2L91A 2ZYLA 5APSA 3WU2H 1L0LJ 5C39A 2WPSA 2Z5IA 4GIFA 1IO4A 1L4AD 2PFXA 2WMMA 2ZVNB 2ITAA 3H1KD 1FZGA 2D2CB 3B5NB 4KT0J 3T97A 4HM6A 1RQUA 1ZP0C 4Y99B 2YKOA 2ZVOB 1SFCD 2WSEJ 3L73G 3AE5C 2P10A 1D7MA 2W6BA 3VCPA 1PGOA 1P84H 1L0LE 2KP8A 1ZW0A 2H43A 3AE3C 2PRRA 1LT9C 5B5EE 3GOBA 4NPFX 4XE5B 1Q86Q 2ZT9D 3L74D 1LTBC 2QJYB 1A02J 3H1LJ 1KV4A 3NTNA 2YFIA 1M7LA 2K9JA 3HE5B 2QG4A 3C1LA 1G1IA 3CPWO 1S4XA 5KKZB 2GBXA 1VQ4P 5E79E 1SQBE 1SQXJ 4HH2A 4L76A 4D6TG 3G3ZA 4GKGA 2YKPA 3RK3C 1JY2N 1M56D 3AEEC 2N1TA 1PPJE 1UUWA 1QVGO 2Q6QA 1SQQD 2E5TA 1BCCG 4WY4A 1Y9BA 3NMDA 4GDOA 2J58A 1KILA 1NU1D 2FYNB 2AEMA 2M5AA 2QPZA 2K9YA 3MD0A 2WSFJ 2GA1A 1VQLP 1QX8A 2PAJA 1N7SB 1O7NA 2A45G 1S72P 1OW6A 1SVFA 3VYIA 4N78E 2XV5A 1EZVG 1YIJP 3MUDA 1KILE 2HLOA 3V2NA 1OFCX 1XTCC 1BSHA 1O7PA 3GMAA 1T6AA 2XR8A 3H25A 2P58A 2QM8A 4C46A 3HUSA 2XSOA 2KS1B 3MZWB 2Q3EA 1N7LA 1Q90D 1URQA 2WSCJ 2KI7B 2W6JH 4PV1D 2OTKE 2IDBA 4WY4C 2FYUG 3D71A 2O3JA 1SQVE 1L0LG 1JY3O 4O9BA 3CXHH 4NBAD 1GDTA 2IYPA 3TNUA 4IOIH 2WVRA 3S1KA 2QA4P 2Y0CA 3C0DA 3CCQP 3MTUE 1T2KC 1NO4A 2E76D 1J2JB 4ZKUA 2W8ZA 1JEKA 1O7GA 3U1AA 4BXLA 2CK3H 4XFJA 1T2KD 1HH0A 4NBGD 2CKFA 2GUSA 2ZYAA 4XA4A 3VMYA 1GZLA 3U59A 5BVZA 1S5LH 1NAFA 1JY3N 5AW9B 1QL2A 3DQYA 1KQGB 5K5GB 2P2UA 1GMJA 2OARA 2POHA 1K04A 3L71D 3ITKA 2B24A 1M90Q 1W2EA 1NTMD 3HD7C 1RF0A 1VQ8P 2NRGA 3D6ZA 5APXA 1M1JB 3A0HH 5AW2B 1URQC 3M06A 1LTJC 3KHUA 3AZCA 1W2BO 3TK1A 4BWNA 2O01J 3SWKA 3JC22 1CZQA 2BMOA 1DIPA 3H1HJ 1JTHB 3H1HD 3IF4A 5L8RJ 1VF5B 4AAYB 3RBZA 1RY3A 1BSNA 3H32B 2BEQD 1LJ2A 3RK2B 1EDIA 2ZT9B 4JF7A 1SFCA 4Y28J 3S9OA 3IR9A 2OYHC 2WTYA 4AUWA 3RK3D 3GTSA 4WB4A 3P8MC 1LWUB 1SS1A 2C9NY 1DD4A 5GTIH 4UB8E 4NBDD 1KB9E 1EG9A 3HD7A 5DJTB 1M1JC 1N7SD 5B5EH 1BCCE 1LTJA 2YVJB 1X9VA 1LT9B 2XNDH 1JO5A 1HUCA 2QSIA 3C8VA 2JKVA 2XRXA 2V7QH 1KILC 2WSSH 4H13D 5APQA 2IFMA 1GTWA 2K37A 4LLHA 2W83C 4HM4A 1T3JA 3VMGD 1SQBJ 4GODA 1U7MA 2QE7H 1TU3F 2IZ1A 4D6TE 2RH0A 3BASA 2BMRA 2OYHA 4W7YA 2JP3A 2NVGA 3BATA 3MUDC 1NOHA 2ZAEB 1NU1G 2E5YA 3CCRP 1HGZA 1N73A 2KSEA 3QWOC 4EIJA 2I1KA 1KZUB 3VP8A 1DEBA 1S5LX 3H1JD 3A5TA 3I56P 4HM5A 1LTTC 3H1LE 5AVXB 1M1JA 1VCKA 3G6EP 2R3CA 2R5BA 1M57D 2H7HA 2NZ2A 1ZR4A 1BE3J 1LTAC 3NFQA 1IZNB 1NWQA 2KXPB 3VOPA 1S1CX 3A0BE 3JCUH 3AE7C 3JSVC 2JZAA 2E74B 5AVQB 2HODA 1RQVA 2JWAA 4UB8H 1UIXA 4JQ0D 2OTJP 2KLVA 2XU6A 1RFSA 4YXWH 3G71P 2PP6A 4GOEA 1AJYA 4YTPC 1OW7A 1BDDA 1SQPD 1GK4A 5AW4B 2YXRB 2WPQA 1SQXK 4I1LA 1SQVG 1SQVJ 3L75D 3HE5A 2Q7CA 1PFIA 1S9KD 2XKMA 4C7RA 2WSCH 1X79B 1RF0C 3LW5J 3TGUG 2C0XA 1KB9I 3FWLA 4RO0A 1KYOI 1PGQA 1PP9G 1R5SA 3L70E 1Q90C 1LTIC 1KYOD 1VQOP 1SQPJ 1AV1A
chains in the Genus database with same CATH topology
1SQVE 2BCCE 2E4PA 3EQQA 4NBAD 4QURA 2DE6D 3VMID 3H1JE 2HMMA 2QJYC 4QCKA 3CWBE 1VF5D 4QDCA 1PPJE 4HM5A 1UUWA 3GTSA 4QDFB 3H1LE 3C0DA 1NTZE 2NUKA 2A06E 1VCKA 3H1KE 3BCCE 1ULJA 3D89A 2FYUE 2E76D 4HM0A 1EZVE 4NB9D 1O7MA 3CX5E 4HM7A 1NTKE 3L73E 5KLIC 3CXHE 1O7GA 4HM1A 3L75E 1SQQE 4NBBD 1PP9E 4NBDD 1SQXE 2ZYLA 4HJLA 2HMOA 4HM8A 2CKFA 1RIEA 3L74E 3GZYA 3N0QA 4NBGD 4P1CH 1KB9E 1EG9A 3VMHD 2E74D 2JZAA 2GBWA 2DE7D 4NBHD 4NB8D 1ZRTE 2BMQA 2QPZA 3GTEA 5HL4A 4H44D 3H1IE 1VM9A 5BOKA 1L0NE 4HM2A 5KLVE 2B1XA 1BCCE 3L72E 1G8JB 2D2CD 2YVJB 2NVFA 1NDOA 3DQYA 4PD4E 1RFSA 3L71E 1P84E 3VCAA 4HM6A 5AEUA 1NTME 1BE3E 4NBED 1O7NA 3GB4A 2DE5D 4HM3A 2NVEA 2E75D 2QJPC 5CXMA 4U3FE 2B24A 2XRXA 3H1HE 4H13D 1JM1A 5KKZC 4P1BH 1ULIA 2YIUC 3GKEA 3VCPA 4AIVA 2HMKA 2IBZE 1L0LE 4QDFA 2YFLA 1SJGA 2QJKC 3FOUA 2HMLA 1BGYE 4HM4A 2HMNA 2FYNC 1NYKA 4NBCD 3AZCA 3VMGD 3GCEA 4EMJB 1SQPE 1O7PA 3GZXA 1NU1E 4OGQD 4NBFD 3GL0A 1FQTA 2XR8A 2HMJA 3GOBA 4QDDA 4D6TE 1WQLA 2I7FA 2BMRA 2ZT9D 2YFJA 3TGUE 2BMOA 2E4QA 2XSOA 2Q3WA 2NVGA 2YFIA 2NWFA 2NUMA 3GL2A 1KYOE 4QUQA 4AAYB 1O7HA 2XSHA 3L70E 1Q90C 4HKVA 1UUVA 1O7WA 1G8KB 4PV1D 2GBXA 4QUPA 3EN1A 4H0LD 1SQBE 2JO6A 5AEWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQV E;  2BCC E;  2E4P A;  3EQQ A;  4NBA D;  4QUR A;  2DE6 D;  3VMI D;  3H1J E;  2HMM A;  2QJY C;  4QCK A;  3CWB E;  1VF5 D;  4QDC A;  1PPJ E;  4HM5 A;  1UUW A;  3GTS A;  4QDF B;  3H1L E;  3C0D A;  1NTZ E;  2NUK A;  2A06 E;  1VCK A;  3H1K E;  3BCC E;  1ULJ A;  3D89 A;  2FYU E;  2E76 D;  4HM0 A;  1EZV E;  4NB9 D;  1O7M A;  3CX5 E;  4HM7 A;  1NTK E;  3L73 E;  5KLI C;  3CXH E;  1O7G A;  4HM1 A;  3L75 E;  1SQQ E;  4NBB D;  1PP9 E;  4NBD D;  1SQX E;  2ZYL A;  4HJL A;  2HMO A;  4HM8 A;  2CKF A;  1RIE A;  3L74 E;  3GZY A;  3N0Q A;  4NBG D;  4P1C H;  1KB9 E;  1EG9 A;  3VMH D;  2E74 D;  2JZA A;  2GBW A;  2DE7 D;  4NBH D;  4NB8 D;  1ZRT E;  2BMQ A;  2QPZ A;  3GTE A;  5HL4 A;  4H44 D;  3H1I E;  1VM9 A;  5BOK A;  1L0N E;  4HM2 A;  5KLV E;  2B1X A;  1BCC E;  3L72 E;  1G8J B;  2D2C D;  2YVJ B;  2NVF A;  1NDO A;  3DQY A;  4PD4 E;  1RFS A;  3L71 E;  1P84 E;  3VCA A;  4HM6 A;  5AEU A;  1NTM E;  1BE3 E;  4NBE D;  1O7N A;  3GB4 A;  2DE5 D;  4HM3 A;  2NVE A;  2E75 D;  2QJP C;  5CXM A;  4U3F E;  2B24 A;  2XRX A;  3H1H E;  4H13 D;  1JM1 A;  5KKZ C;  4P1B H;  1ULI A;  2YIU C;  3GKE A;  3VCP A;  4AIV A;  2HMK A;  2IBZ E;  1L0L E;  4QDF A;  2YFL A;  1SJG A;  2QJK C;  3FOU A;  2HML A;  1BGY E;  4HM4 A;  2HMN A;  2FYN C;  1NYK A;  4NBC D;  3AZC A;  3VMG D;  3GCE A;  4EMJ B;  1SQP E;  1O7P A;  3GZX A;  1NU1 E;  4OGQ D;  4NBF D;  3GL0 A;  1FQT A;  2XR8 A;  2HMJ A;  3GOB A;  4QDD A;  4D6T E;  1WQL A;  2I7F A;  2BMR A;  2ZT9 D;  2YFJ A;  3TGU E;  2BMO A;  2E4Q A;  2XSO A;  2Q3W A;  2NVG A;  2YFI A;  2NWF A;  2NUM A;  3GL2 A;  1KYO E;  4QUQ A;  4AAY B;  1O7H A;  2XSH A;  3L70 E;  1Q90 C;  4HKV A;  1UUV A;  1O7W A;  1G8K B;  4PV1 D;  2GBX A;  4QUP A;  3EN1 A;  4H0L D;  1SQB E;  2JO6 A;  5AEW A; 
#chains in the Genus database with same CATH topology
 3VMA A;  3HD7 D;  4QUR A;  3PJS K;  1NGM B;  3CWB E;  4CPG A;  1FZF A;  1PGJ A;  1FJP A;  1NTZ E;  4HM0 A;  2R32 A;  1WRG A;  1J1E C;  3BRT B;  3HE4 A;  1T3U A;  2WIT A;  3CC7 P;  3IFM A;  1SFC C;  3L4F A;  2SPZ A;  1S9K E;  3E7K A;  3GG2 A;  1SQQ K;  2A06 D;  3H32 A;  1HVV A;  2BMQ A;  1RE4 C;  2AEF A;  3RBX A;  2HFE D;  3G9R A;  3NXS A;  1W5C E;  3A0B H;  1ZXG A;  1SP4 A;  4EOT A;  3OJA B;  3P8C E;  5AVR B;  1MFZ A;  2AEJ A;  5B66 E;  1QLE D;  4AQR D;  4HM3 A;  1KQS O;  4WY4 D;  4U3F E;  4MN4 C;  1LWU A;  2QM7 A;  1AVY A;  4U3F G;  1URQ D;  2W90 A;  3V2Q A;  2E75 B;  1NYH A;  2JDI H;  2LXB A;  3N7N A;  1VQ7 P;  2HMN A;  4EMJ B;  3GCE A;  3KXD A;  1VQN P;  2WPR A;  3G4S P;  4N78 D;  1DEE G;  2KB7 P;  2I7F A;  1FS0 E;  3H1J J;  3MGN A;  1JB0 J;  2RKL A;  3HD7 B;  2XZR A;  1IK7 A;  4DJG A;  2XSH A;  1R5L A;  3E1R A;  1O7W A;  3L37 A;  3CCU P;  3H1I D;  3L74 J;  1QEX A;  5AEW A;  1KQL A;  1L0N K;  2DE6 D;  2BEZ F;  4QCK A;  1RE4 A;  3FXE A;  1HTL C;  1PGP A;  3LIE A;  1BCC J;  3D89 A;  1PPJ D;  2D2C C;  2KNC B;  3M91 A;  1N73 C;  1FDI A;  4EDF A;  5APV A;  4HM8 A;  3KQG A;  3L74 E;  1GU4 A;  1YJ9 P;  1L4A A;  1WT6 A;  2FYU K;  1LTS C;  1ZRT E;  1EQ7 A;  1MKM A;  5AW3 B;  5TIS H;  1GL2 A;  1YBK A;  4HM2 A;  1GW4 A;  2N1T D;  1G2C B;  2FFD B;  3V6I A;  1L0N D;  4NBE D;  2KSJ A;  1N86 A;  1FBM A;  1NKN A;  5CXM A;  2Y0E A;  1JM1 A;  2BCC G;  3EFF K;  2OYO A;  2P1J A;  3PTZ A;  3HTK B;  2QJK C;  4IL6 E;  5B66 H;  2YXQ B;  3GZX A;  4QDD A;  1NTK K;  3AEB C;  3AEF C;  5AVY B;  5AVT B;  4ASW A;  1E79 H;  1RE3 C;  2YMK A;  5CMZ A;  1VQ9 P;  2NWF A;  2HOD B;  1K9M Q;  3GL2 A;  2WT7 B;  2FY8 A;  1OVV A;  1YI2 P;  1FE6 A;  4W80 A;  1EC5 A;  3V2P A;  2KUB A;  2K3R A;  1LGH B;  1SQQ G;  3RL0 B;  2HMM A;  4RES B;  5KTB A;  3AE2 C;  3PLN A;  2WQY C;  4I7Z C;  3FXD A;  4I6M C;  1GL2 C;  3CD6 P;  1ULJ A;  2E42 A;  3M9B A;  4PV1 B;  3CLQ A;  3Q5P A;  2O01 N;  4HJL A;  4TLF A;  2K9J B;  3CX5 I;  1HBW A;  2M8R A;  2GUV A;  2E74 D;  3EQ2 A;  3WUV A;  4NB8 D;  3W67 A;  2NPS A;  3PH0 A;  1VM9 A;  2IFN A;  1YIT P;  2NPS D;  3VCA A;  4PD4 E;  4DCK A;  2H89 C;  3ZDM A;  5TIS E;  1NTZ G;  1VQ6 P;  2NVE A;  1QL1 A;  3D6Y A;  2HR3 A;  2Q9I A;  4LC1 A;  3P7K A;  1RE3 A;  2G8Y A;  2W27 A;  4PD4 D;  2R3S A;  4OGQ C;  3O6Q A;  3AE9 C;  3HTK A;  2B87 A;  4L75 A;  3FOU A;  1FAV A;  1H89 A;  2OYI C;  4C7N B;  3P8C D;  1NJI Q;  1VQ5 P;  1OVR A;  2FYU D;  2O1K A;  4OGQ D;  1LTG C;  2Y9Y A;  5APY A;  5CBO A;  5KJ7 C;  3FWN A;  3FX0 A;  1HJ0 A;  1LWU C;  3TGU E;  1NTZ J;  3VTP C;  3L72 G;  4PJ0 H;  4JPZ B;  3Q2Y A;  1GL2 B;  1JNM A;  2IX7 C;  1SQP G;  3O8Z A;  4PD4 I;  3GLM A;  1Z56 A;  2Y0D A;  1FOS E;  2E4P A;  1S2E A;  2I1J A;  3TGU J;  3A2A A;  5E79 H;  2R44 A;  2M3B A;  3H1K E;  1JM0 A;  1NTM K;  1NU1 K;  3L70 J;  4Z1M H;  4UB6 H;  4JYC A;  4U7J A;  4OWF A;  5CCG D;  4P1C H;  1Q2N A;  2MJZ A;  2N9B A;  2QJK B;  1IFM A;  5KAF H;  4OVN F;  2JEE A;  4IFD K;  3WUT A;  4K35 A;  3RL0 g;  1MZ9 A;  2B1X A;  2OYI A;  1YQ4 C;  2HG5 D;  3M0D C;  1L4A C;  2QJP C;  2ZYD A;  5KJ7 A;  1KMI Z;  2KNC A;  5AW1 B;  5BU8 B;  1OZH A;  3R2P A;  1PIX A;  3L70 D;  1IFI A;  2FXM A;  3L72 D;  1NKZ B;  4M3L A;  1JCC A;  4NBC D;  3RK3 B;  1K05 A;  2JWD A;  3CMA P;  4WY4 B;  1NU1 E;  5APW A;  2RMZ A;  1YTZ I;  4WWI A;  2BCC J;  3USS A;  1NAY A;  3CX5 H;  1IJD B;  2HYN A;  3L73 J;  5CCH C;  4YPC A;  2WSE H;  2V7Q J;  2E74 C;  1JTH A;  1P84 D;  1JY2 O;  5DJU B;  3PHL A;  1NU1 J;  1ZRT D;  3A7O A;  3CME P;  5KLV K;  4DT0 A;  3H1J E;  3AEC C;  3MIW A;  4QDC A;  2NUK A;  3AE1 C;  4Y99 C;  2A06 G;  3AE6 C;  2FYU E;  1AVO A;  4C7N A;  1O7M A;  3AE8 C;  3L71 J;  3L71 G;  1NTK E;  5KLI C;  3CCM P;  3Q5R A;  3CXH E;  1SQQ E;  1KYO H;  1Y8A A;  2HMO A;  1EZV I;  3TF5 A;  4OGQ B;  3HUS B;  1JCD A;  1KN7 A;  4BRY A;  3H1I E;  5BOK A;  1URQ B;  1SQX G;  1G8J B;  2KS1 A;  1PZQ A;  2B89 A;  1Y47 A;  3L71 E;  1P84 E;  2E76 B;  2OGU A;  5AW0 B;  4HB1 A;  1N2D C;  1J1E B;  1PPJ G;  4HJG H;  2VRS A;  1MUU A;  2KK7 A;  2K1A A;  1X22 A;  4I2L C;  3M9Q A;  2NPS C;  4AIV A;  3F89 A;  1SJG A;  5H2F E;  3VP9 A;  1WMK A;  1SLQ A;  3S4R A;  3VN0 A;  5CCH A;  5KLV J;  1OW8 A;  1Q7Y Q;  3CCS P;  1H0T B;  1FOS F;  1NTM J;  1BGY D;  2E4Q A;  4R4M A;  2KZJ A;  3E1I A;  3L70 G;  5KLV G;  2WZ7 A;  1IC2 A;  3V4W A;  2LXC B;  2DW3 A;  1HWT C;  3UIA A;  4QUP A;  1EDK A;  2IZ0 A;  2N9Y B;  3I55 P;  2G3A A;  1H88 A;  4H0L B;  3Q1M A;  1L0L K;  3CCJ P;  3WMM 0;  4PD4 H;  1LP1 A;  1FZC B;  1YHQ P;  1FC2 C;  3CCE P;  3WUU A;  1SQB G;  1CW5 A;  3HE4 B;  2ZJS E;  4EI2 A;  1VL2 A;  1NVO A;  1KIL D;  4H13 C;  3GW6 A;  5KJ7 D;  2Z4E A;  3SSU A;  3II6 A;  1VQP P;  3L35 A;  3CX5 D;  3OW2 O;  1SQX D;  3VMH D;  2R5D A;  3HRN A;  1ZV8 A;  2WWW A;  1AA0 A;  2JO1 A;  1KB9 H;  2YO3 A;  1J1D C;  3TNU B;  5AVV B;  1NH4 A;  3GB4 A;  4PJ0 E;  1JY2 P;  2FXP A;  1IK9 A;  3H6P A;  1E5W A;  3GKE A;  4QDF A;  3MP7 B;  4WVZ A;  2HML A;  3AEA C;  2B9B A;  1SQP E;  3B8E B;  1Q81 Q;  1IFP A;  4NBF D;  3L36 A;  1VPC A;  3F5H A;  3M0D A;  1KOR A;  3C9I A;  2O1J A;  5KLI B;  1FZC C;  3RK2 D;  3H1K J;  4H44 B;  1JMM A;  3L74 G;  2GM4 A;  2M0B A;  1IFD A;  1G8K B;  2QRX A;  4H13 B;  1RF1 B;  2IBZ G;  5AVU B;  1JUN A;  1M8O B;  1P84 I;  2FKW B;  3P32 A;  1OIP A;  1FDO A;  2CPB A;  5GTH H;  4H44 C;  3H1L D;  1CI6 B;  1NTM G;  1EZV E;  5AW8 B;  4HM7 A;  3R4Y A;  3CXH I;  2KYV A;  4AYC A;  1S5L E;  2KLU A;  1SQX E;  4ZNC A;  3H1I G;  1ZLL A;  4U3F J;  1YTZ T;  2UWJ E;  4U3F D;  3KPE A;  2E75 C;  2CPS A;  2OYI B;  1EDJ A;  1NTZ D;  1SQV D;  3L75 G;  1ZR2 A;  1U7J A;  3VMX A;  3OA7 A;  5TJH A;  4KJM A;  4D6T D;  5BU5 A;  1AQ5 A;  4YXD C;  3IAO A;  3D70 A;  2V4H A;  5KKZ C;  3H1H G;  4NPD A;  1FDM A;  3BVH A;  1FZC A;  1NTZ K;  2B88 A;  1PL5 A;  5APT A;  4IFM A;  3FGA D;  1BGY E;  3BRV B;  3L72 J;  3GHG B;  2XDJ A;  4DOJ A;  1RF1 C;  3V2R A;  3CC4 P;  1WQL A;  1XTG B;  2FXO A;  3PP5 A;  4PV1 C;  2JJL A;  5GTI E;  2O01 H;  1KYO E;  3SWF A;  2MKV A;  1NTK J;  5KAI E;  1LTJ B;  1YQ3 C;  1KC8 Q;  1BGY J;  1SQQ J;  3EN1 A;  1PP9 J;  2PGD A;  1SFC B;  2BCC E;  5AVS B;  2WSF H;  1VF5 D;  1VQM P;  1EZV D;  5CCG A;  1HGV A;  1VF5 C;  1JY3 P;  5AW6 B;  1EXJ A;  3L73 E;  1HJB A;  2QEX P;  1LP1 B;  3RGU A;  1PP9 E;  5CJ0 A;  4ZMD A;  1MV8 A;  3AEG C;  1KD1 Q;  5GTH E;  1UII A;  2YKQ A;  2J59 M;  5H2F H;  2Z5H A;  3BCC D;  3OAK A;  3L73 D;  2M5A B;  2NPS B;  4BRY B;  2XNX A;  4W7Z A;  3EFG A;  3RL0 C;  5KLV E;  4OH8 B;  2KOG A;  4JYB A;  2FYU J;  2D2C D;  3LW5 H;  3N4X A;  1OXZ A;  1L2P A;  1RF1 A;  1X0T A;  4NPE A;  1GK6 A;  1N8R Q;  3H1K G;  5CHX A;  2KZI A;  1FZA A;  3IN6 A;  1FZB A;  3Q3D A;  2H8P D;  2OQQ A;  2YO2 A;  1YJW P;  3SFE C;  3AE4 C;  1MFT A;  2E43 A;  1BE3 G;  3H1I J;  3KZI H;  2FYN C;  4A7P A;  1AFO A;  2L5G B;  3GL0 A;  4I7Z B;  1K73 Q;  2FBW C;  2OYH B;  4RJT A;  3VMZ A;  3M0A A;  2NUM A;  2YNY A;  3CI9 A;  1DD3 A;  3GF7 A;  1L0L D;  1UUV A;  1IFN A;  1R8E A;  3Q5S A;  2YIU B;  1GW3 A;  3H1L G;  3KDP B;  4LGD E;  3CCL P;  3MHV A;  5KAI H;  3U1C A;  1EXI A;  3JCU E;  1N7S C;  2A06 E;  2ZYG A;  2N1T B;  1U57 A;  4GOF A;  1VDF A;  2ZT9 C;  1RIE A;  3N0Q A;  1NHL A;  3RK2 C;  4H0L C;  2AXT E;  2A45 I;  5HL4 A;  4H44 D;  1L0N E;  3A3Y B;  2FFD A;  1NDO A;  5AVW B;  1OMI A;  2JR8 A;  1FZE A;  1OVU A;  5AEU A;  2QVA A;  4KHX A;  3W68 A;  1FJK A;  2HPC A;  2BAS A;  2E75 D;  1N73 B;  1SQB K;  1NTK G;  3M9H A;  5M1B A;  3TGU D;  2M3E A;  1L0N J;  1K8A Q;  5CBN A;  1FQT A;  3CCV P;  2AXC A;  4IL6 H;  2I8D A;  3KZI E;  1QVF O;  1T8Z A;  2Q3W A;  3BCC J;  3CL3 D;  3SFD C;  1N7S A;  1DX7 A;  4B86 A;  4QUQ A;  1USD A;  1GL2 D;  2A45 H;  1G2C A;  4HKV A;  1RH5 B;  3TYY A;  1SQB D;  3EWK A;  2Y9Z A;  2B87 B;  4D6T J;  3V4Q A;  1ZOY C;  4QDF B;  3BCC E;  3CXH D;  4WBA A;  3V5B A;  1L4A B;  2QJP B;  3GHG A;  3TDK A;  4NBB D;  4TT3 H;  1YJN P;  1CSB A;  2BCC D;  2DE7 D;  5CCG C;  3GTE A;  3KYQ A;  3L72 E;  3GF3 A;  2AXT H;  1LT9 A;  4K3A A;  1QGK B;  1BE3 E;  3B4S A;  1DH3 A;  2Q1K A;  4GT1 A;  5APU A;  2YIU C;  2IBZ I;  1BDC A;  2YFL A;  3BCC G;  3O6Q B;  1PV3 A;  1OWA A;  2OTL P;  4HKZ H;  2QIW A;  2ZXE B;  1SQP K;  1HF9 A;  1VQK P;  1ZME C;  3I5C A;  5EFW B;  3CWB D;  4N3Y B;  2WT7 A;  2YFJ A;  3AED C;  2IPP A;  2N1T C;  5AVZ B;  1USE A;  3B71 A;  5CJ4 A;  3QH9 A;  1O7H A;  1KIL B;  1BCC D;  3L75 J;  3B5N A;  3GHG C;  4H0L D;  2Q5U A;  3T97 B;  2JO6 A;  2HPC B;  3CC2 P;  1LNQ A;  4JBZ A;  3EQQ A;  1BE3 D;  2LKM A;  1H8A A;  3VMI D;  3TSI A;  2E76 C;  2IYO A;  1G1J A;  1M1K Q;  1YYC A;  1KB9 D;  5AW7 B;  1Q82 Q;  3WU2 E;  3K5B A;  2ZFC A;  4IFF A;  4HM1 A;  3L75 E;  2H88 C;  4L74 A;  1L0N G;  3RK3 E;  3GZY A;  1JMB A;  1KFM A;  2ZXX A;  2GBW A;  4NBH D;  2C0W A;  1KTM A;  1NTK D;  3CWB J;  4L73 A;  2IBZ D;  2NVF A;  2K88 A;  5KAF E;  1BGY G;  1NTM E;  4IL6 X;  2DE5 D;  4EYY Q;  1AQT A;  3HUS C;  1EDL A;  3H1H E;  4UB6 E;  2FYZ A;  1OX3 A;  5CCH D;  4P1B H;  2C9L Y;  3SWY A;  1ULI A;  1SQV K;  3PRJ A;  1S3J A;  2HMK A;  2IBZ E;  1IFJ A;  1LT1 A;  2W6A A;  1KFN A;  2RN0 A;  3CWB G;  4ASV A;  1NYK A;  2FFD C;  1A02 F;  3B5N C;  1GU5 A;  2P67 A;  2HMJ A;  2Q3I A;  2P7J A;  2KIK A;  3B5N D;  1JOC A;  2YMY A;  3ABV C;  1KQF B;  5KLV D;  4N6J A;  2J5U A;  2WPV B;  2LR2 A;  1RHZ B;  3LID A;  4ZKP A;  3RL0 D;  3A0H E;  1PP9 D;  4QMA A;  4R4L A;  1GD2 E;  1X8Y A;  4HYT B;  5AW5 B;  2QJY C;  3H1J G;  1ZN5 A;  4RKU J;  1CI6 A;  1H0T A;  4NB9 D;  3CX5 E;  1FU1 A;  1J1D B;  4DZO A;  2L91 A;  2ZYL A;  5APS A;  3WU2 H;  1L0L J;  5C39 A;  2WPS A;  2Z5I A;  4GIF A;  1IO4 A;  1L4A D;  2PFX A;  2WMM A;  2ZVN B;  2ITA A;  3H1K D;  1FZG A;  2D2C B;  3B5N B;  4KT0 J;  3T97 A;  4HM6 A;  1RQU A;  1ZP0 C;  4Y99 B;  2YKO A;  2ZVO B;  1SFC D;  2WSE J;  3L73 G;  3AE5 C;  2P10 A;  1D7M A;  2W6B A;  3VCP A;  1PGO A;  1P84 H;  1L0L E;  2KP8 A;  1ZW0 A;  2H43 A;  3AE3 C;  2PRR A;  1LT9 C;  5B5E E;  3GOB A;  4NPF X;  4XE5 B;  1Q86 Q;  2ZT9 D;  3L74 D;  1LTB C;  2QJY B;  1A02 J;  3H1L J;  1KV4 A;  3NTN A;  2YFI A;  1M7L A;  2K9J A;  3HE5 B;  2QG4 A;  3C1L A;  1G1I A;  3CPW O;  1S4X A;  5KKZ B;  2GBX A;  1VQ4 P;  5E79 E;  1SQB E;  1SQX J;  4HH2 A;  4L76 A;  4D6T G;  3G3Z A;  4GKG A;  2YKP A;  3RK3 C;  1JY2 N;  1M56 D;  3AEE C;  2N1T A;  1PPJ E;  1UUW A;  1QVG O;  2Q6Q A;  1SQQ D;  2E5T A;  1BCC G;  4WY4 A;  1Y9B A;  3NMD A;  4GDO A;  2J58 A;  1KIL A;  1NU1 D;  2FYN B;  2AEM A;  2M5A A;  2QPZ A;  2K9Y A;  3MD0 A;  2WSF J;  2GA1 A;  1VQL P;  1QX8 A;  2PAJ A;  1N7S B;  1O7N A;  2A45 G;  1S72 P;  1OW6 A;  1SVF A;  3VYI A;  4N78 E;  2XV5 A;  1EZV G;  1YIJ P;  3MUD A;  1KIL E;  2HLO A;  3V2N A;  1OFC X;  1XTC C;  1BSH A;  1O7P A;  3GMA A;  1T6A A;  2XR8 A;  3H25 A;  2P58 A;  2QM8 A;  4C46 A;  3HUS A;  2XSO A;  2KS1 B;  3MZW B;  2Q3E A;  1N7L A;  1Q90 D;  1URQ A;  2WSC J;  2KI7 B;  2W6J H;  4PV1 D;  2OTK E;  2IDB A;  4WY4 C;  2FYU G;  3D71 A;  2O3J A;  1SQV E;  1L0L G;  1JY3 O;  4O9B A;  3CXH H;  4NBA D;  1GDT A;  2IYP A;  3TNU A;  4IOI H;  2WVR A;  3S1K A;  2QA4 P;  2Y0C A;  3C0D A;  3CCQ P;  3MTU E;  1T2K C;  1NO4 A;  2E76 D;  1J2J B;  4ZKU A;  2W8Z A;  1JEK A;  1O7G A;  3U1A A;  4BXL A;  2CK3 H;  4XFJ A;  1T2K D;  1HH0 A;  4NBG D;  2CKF A;  2GUS A;  2ZYA A;  4XA4 A;  3VMY A;  1GZL A;  3U59 A;  5BVZ A;  1S5L H;  1NAF A;  1JY3 N;  5AW9 B;  1QL2 A;  3DQY A;  1KQG B;  5K5G B;  2P2U A;  1GMJ A;  2OAR A;  2POH A;  1K04 A;  3L71 D;  3ITK A;  2B24 A;  1M90 Q;  1W2E A;  1NTM D;  3HD7 C;  1RF0 A;  1VQ8 P;  2NRG A;  3D6Z A;  5APX A;  1M1J B;  3A0H H;  5AW2 B;  1URQ C;  3M06 A;  1LTJ C;  3KHU A;  3AZC A;  1W2B O;  3TK1 A;  4BWN A;  2O01 J;  3SWK A;  3JC2 2;  1CZQ A;  2BMO A;  1DIP A;  3H1H J;  1JTH B;  3H1H D;  3IF4 A;  5L8R J;  1VF5 B;  4AAY B;  3RBZ A;  1RY3 A;  1BSN A;  3H32 B;  2BEQ D;  1LJ2 A;  3RK2 B;  1EDI A;  2ZT9 B;  4JF7 A;  1SFC A;  4Y28 J;  3S9O A;  3IR9 A;  2OYH C;  2WTY A;  4AUW A;  3RK3 D;  3GTS A;  4WB4 A;  3P8M C;  1LWU B;  1SS1 A;  2C9N Y;  1DD4 A;  5GTI H;  4UB8 E;  4NBD D;  1KB9 E;  1EG9 A;  3HD7 A;  5DJT B;  1M1J C;  1N7S D;  5B5E H;  1BCC E;  1LTJ A;  2YVJ B;  1X9V A;  1LT9 B;  2XND H;  1JO5 A;  1HUC A;  2QSI A;  3C8V A;  2JKV A;  2XRX A;  2V7Q H;  1KIL C;  2WSS H;  4H13 D;  5APQ A;  2IFM A;  1GTW A;  2K37 A;  4LLH A;  2W83 C;  4HM4 A;  1T3J A;  3VMG D;  1SQB J;  4GOD A;  1U7M A;  2QE7 H;  1TU3 F;  2IZ1 A;  4D6T E;  2RH0 A;  3BAS A;  2BMR A;  2OYH A;  4W7Y A;  2JP3 A;  2NVG A;  3BAT A;  3MUD C;  1NOH A;  2ZAE B;  1NU1 G;  2E5Y A;  3CCR P;  1HGZ A;  1N73 A;  2KSE A;  3QWO C;  4EIJ A;  2I1K A;  1KZU B;  3VP8 A;  1DEB A;  1S5L X;  3H1J D;  3A5T A;  3I56 P;  4HM5 A;  1LTT C;  3H1L E;  5AVX B;  1M1J A;  1VCK A;  3G6E P;  2R3C A;  2R5B A;  1M57 D;  2H7H A;  2NZ2 A;  1ZR4 A;  1BE3 J;  1LTA C;  3NFQ A;  1IZN B;  1NWQ A;  2KXP B;  3VOP A;  1S1C X;  3A0B E;  3JCU H;  3AE7 C;  3JSV C;  2JZA A;  2E74 B;  5AVQ B;  2HOD A;  1RQV A;  2JWA A;  4UB8 H;  1UIX A;  4JQ0 D;  2OTJ P;  2KLV A;  2XU6 A;  1RFS A;  4YXW H;  3G71 P;  2PP6 A;  4GOE A;  1AJY A;  4YTP C;  1OW7 A;  1BDD A;  1SQP D;  1GK4 A;  5AW4 B;  2YXR B;  2WPQ A;  1SQX K;  4I1L A;  1SQV G;  1SQV J;  3L75 D;  3HE5 A;  2Q7C A;  1PFI A;  1S9K D;  2XKM A;  4C7R A;  2WSC H;  1X79 B;  1RF0 C;  3LW5 J;  3TGU G;  2C0X A;  1KB9 I;  3FWL A;  4RO0 A;  1KYO I;  1PGQ A;  1PP9 G;  1R5S A;  3L70 E;  1Q90 C;  1LTI C;  1KYO D;  1VQO P;  1SQP J;  1AV1 A; 
#chains in the Genus database with same CATH homology
 1SQV E;  2BCC E;  2E4P A;  3EQQ A;  4NBA D;  4QUR A;  2DE6 D;  3VMI D;  3H1J E;  2HMM A;  2QJY C;  4QCK A;  3CWB E;  1VF5 D;  4QDC A;  1PPJ E;  4HM5 A;  1UUW A;  3GTS A;  4QDF B;  3H1L E;  3C0D A;  1NTZ E;  2NUK A;  2A06 E;  1VCK A;  3H1K E;  3BCC E;  1ULJ A;  3D89 A;  2FYU E;  2E76 D;  4HM0 A;  1EZV E;  4NB9 D;  1O7M A;  3CX5 E;  4HM7 A;  1NTK E;  3L73 E;  5KLI C;  3CXH E;  1O7G A;  4HM1 A;  3L75 E;  1SQQ E;  4NBB D;  1PP9 E;  4NBD D;  1SQX E;  2ZYL A;  4HJL A;  2HMO A;  4HM8 A;  2CKF A;  1RIE A;  3L74 E;  3GZY A;  3N0Q A;  4NBG D;  4P1C H;  1KB9 E;  1EG9 A;  3VMH D;  2E74 D;  2JZA A;  2GBW A;  2DE7 D;  4NBH D;  4NB8 D;  1ZRT E;  2BMQ A;  2QPZ A;  3GTE A;  5HL4 A;  4H44 D;  3H1I E;  1VM9 A;  5BOK A;  1L0N E;  4HM2 A;  5KLV E;  2B1X A;  1BCC E;  3L72 E;  1G8J B;  2D2C D;  2YVJ B;  2NVF A;  1NDO A;  3DQY A;  4PD4 E;  1RFS A;  3L71 E;  1P84 E;  3VCA A;  4HM6 A;  5AEU A;  1NTM E;  1BE3 E;  4NBE D;  1O7N A;  3GB4 A;  2DE5 D;  4HM3 A;  2NVE A;  2E75 D;  2QJP C;  5CXM A;  4U3F E;  2B24 A;  2XRX A;  3H1H E;  4H13 D;  1JM1 A;  5KKZ C;  4P1B H;  1ULI A;  2YIU C;  3GKE A;  3VCP A;  4AIV A;  2HMK A;  2IBZ E;  1L0L E;  4QDF A;  2YFL A;  1SJG A;  2QJK C;  3FOU A;  2HML A;  1BGY E;  4HM4 A;  2HMN A;  2FYN C;  1NYK A;  4NBC D;  3AZC A;  3VMG D;  3GCE A;  4EMJ B;  1SQP E;  1O7P A;  3GZX A;  1NU1 E;  4OGQ D;  4NBF D;  3GL0 A;  1FQT A;  2XR8 A;  2HMJ A;  3GOB A;  4QDD A;  4D6T E;  1WQL A;  2I7F A;  2BMR A;  2ZT9 D;  2YFJ A;  3TGU E;  2BMO A;  2E4Q A;  2XSO A;  2Q3W A;  2NVG A;  2YFI A;  2NWF A;  2NUM A;  3GL2 A;  1KYO E;  4QUQ A;  4AAY B;  1O7H A;  2XSH A;  3L70 E;  1Q90 C;  4HKV A;  1UUV A;  1O7W A;  1G8K B;  4PV1 D;  2GBX A;  4QUP A;  3EN1 A;  4H0L D;  1SQB E;  2JO6 A;  5AEW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...